De novo Erzeugung und Strukturanalyse eines Protein-Protein ...

freidok.uni.freiburg.de

De novo Erzeugung und Strukturanalyse eines Protein-Protein ...

De novo Erzeugung und Strukturanalyse eines

Protein-Protein-Kontaktes und

Versuche zur strukturellen Charakterisierung der

Peroxine PEX19 und PEX3

sowie

Kristallstrukturen eines moskitoziden Holotoxins

und einer aromatischen Flavin-Monooxygenase

INAUGURALDISSERTATION

zur Erlangung des Doktorgrades

der Fakultät für Chemie, Pharmazie und Geowissenschaften

der Albert-Ludwigs-Universität

Freiburg im Breisgau

vorgelegt von

Diplom-Biochemikerin Nora Treiber

aus Karlsruhe

Freiburg im Breisgau, Mai 2008


Vorsitzender des Promotionsausschusses: Prof. Dr. Rolf Schubert

Referent: Prof. Dr. Georg E. Schulz

Korreferent: Prof. Dr. Thorsten Friedrich

Datum der Promotion: 03. Juli 2008


Teile dieser Arbeit wurden in den folgenden Artikeln veröffentlicht:

Grueninger, D., Treiber, N., Ziegler, M.O.P., Koetter, J.W.A., Schulze, M.-S. & Schulz, G.E.

(2008). Designed Protein-Protein Association. Science 319, 206-209.

Treiber, N. & Schulz, G. E. (2008). Structure of 2,6-Dihydroxypyridine 3-hydroxylase from a

Nicotine-degrading Pathway. J. Mol. Biol. 379, 94-104

Treiber, N., Reinert, D.J., Carpusca, I., Aktories, K. & Schulz, G.E. (2008). Structure and

mode of action of a mosquitocidal holotoxin. J. Mol. Biol. (in press)

Koordinaten und Strukturfaktoren wurden in der RCSB-Proteindatenbank

(www.pdb.org) unter folgenden Eintragungen hinterlegt:

2v7g: Crystal Structure of an engineered Urocanase Tetramer

2vou: Structure of 2,6-Dihydroxypyridine-3-hydroxylase from Arthrobacter nicotinovorans

2vsa: Structure and mode of action of a mosquitocidal holotoxin

2vse: Structure and mode of action of a mosquitocidal holotoxin


Inhaltsverzeichnis

1 Einleitung.............................................................................................. 1

1.1 Künstliche Proteinkontakte....................................................................................1

1.1.1 Protein-Protein-Interaktionen .............................................................................1

1.1.2 Eigenschaften von Kontaktflächen.....................................................................5

1.1.3 Urocanase aus Pseudomonas putida ..................................................................6

1.2 Die Peroxine PEX19 und PEX3 ............................................................................9

1.2.1 Peroxisomen .......................................................................................................9

1.2.2 Biogenese der Peroxisomen..............................................................................11

1.2.3 PEX19...............................................................................................................13

1.2.4 PEX3.................................................................................................................14

1.3 Das Moskitozide Toxin (MTX)...........................................................................16

1.3.1 ADP-Ribosyltransferasen .................................................................................16

1.3.2 Toxine aus Bacillus sphaericus ........................................................................23

1.3.3 Das moskitozide Toxin (MTX) ........................................................................24

1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH) ..................................................27

1.4.1 Der Abbau von Nikotin durch Arthrobacter nicotinovorans ...........................27

1.4.2 Die 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH) aus Arthrobacter

nicotinovorans ..................................................................................................30

1.4.3 Externe Flavin-Monooxygenasen.....................................................................31

1.5 Ziele der Arbeit....................................................................................................35

2 Materialien .......................................................................................... 37

2.1 Geräte und Chemikalien ......................................................................................37

2.2 Vektoren ..............................................................................................................40

2.3 Mikroorganismen und Medien ............................................................................42

2.3.1 Escherichia coli-Stämme..................................................................................42

2.3.2 Medien und Festagarplatten..............................................................................42

3 Methoden............................................................................................. 44

3.1 Kultivierung von Bakterien .................................................................................44

3.1.1 Bestimmung der optischen Dichte von Bakterienkulturen...............................44

3.1.2 Kultivierung für die Plasmidpräparation ..........................................................44

3.1.3 Kultivierung für die Proteinproduktion ............................................................44

3.1.4 Einbau von Selenomethionin in Proteine .........................................................46

3.2 Molekularbiologische Methoden.........................................................................47

3.2.1 Einführen von Mutationen mittels der QuikChange TM -Methode .....................47

3.2.2 Amplifikation von DNA-Fragmenten mittels PCR..........................................47

3.2.3 Restriktionsspaltung von DNA.........................................................................48

3.2.4 Dephosphorylierung von DNA-Enden .............................................................49

3.2.5 Ligation von DNA-Fragmenten .......................................................................49

3.2.6 Einführen einer TEV-Schnittstelle ...................................................................49

3.2.7 Herstellung calciumkompetenter Zellen...........................................................50

3.2.8 Transformation calciumkompetenter Zellen ....................................................51

3.2.9 Plasmidpräparation (Peqlab, Qiagen)...............................................................51

3.2.10 Agarosegelelektrophorese ................................................................................51

I


3.2.11 Kolonie-PCR.................................................................................................... 52

3.2.12 Aufreinigen von DNA-Banden aus Agarosegelen........................................... 52

3.2.13 Aufreinigung von DNA-Fragmenten aus PCR-Ansätzen................................ 53

3.2.14 Bestimmung von DNA-Konzentration und -Reinheit ..................................... 53

3.2.15 Sequenzierung.................................................................................................. 53

3.3 Proteinbiochemische Methoden.......................................................................... 54

3.3.1 Bestimmung der Proteinkonzentration............................................................. 54

3.3.2 SDS-Gelelektrophorese.................................................................................... 55

3.3.3 Native PAGE.................................................................................................... 56

3.3.4 Coomassie-Färbung ......................................................................................... 56

3.3.5 Elektrophoretischer Proteintransfer auf Nitrocellulose.................................... 57

3.3.6 N-terminale Sequenzierung von Proteinen (Edman-Abbau) ........................... 57

3.3.7 Dynamische Lichtstreuung .............................................................................. 57

3.3.8 Optimierungsschritte von Proteinreinigungen ................................................. 58

3.3.9 Faltungsversuche für PEX3 ............................................................................. 59

3.3.10 Enzymaktivitätstests......................................................................................... 60

3.3.11 Untersuchungen zum Einfluss von Reduktionsmittel auf DHPH.................... 60

3.4 Proteinreinigung.................................................................................................. 61

3.4.1 Säulenparameter und verwendete Puffer ......................................................... 61

3.4.2 Gelpermeationschromatographie ..................................................................... 63

3.4.3 Reinigung der Urocanase................................................................................. 63

3.4.4 Reinigung von PEX19 ..................................................................................... 65

3.4.5 Reinigung von PEX19 76-271 als His 6 -Fusionsprotein ....................................... 68

3.4.6 Reinigung von PEX3 34-373 als Thioredoxin-His 6 -Fusionsprotein .................... 68

3.4.7 Reinigung der TEV-Protease ........................................................................... 70

3.4.8 Reinigung von DHPH ...................................................................................... 71

3.5 Röntgenkristallographische Methoden ............................................................... 72

3.5.1 Kristallisation................................................................................................... 72

3.5.2 Datensammlung und -prozessierung sowie vorläufige Analysen.................... 75

3.5.3 Phasierung........................................................................................................ 78

3.5.4 Dichtemodifikation .......................................................................................... 80

3.5.5 Modellbau ........................................................................................................ 81

3.5.6 Verfeinerung der Strukurmodelle .................................................................... 83

3.5.7 Validierung von Proteinstrukturen................................................................... 84

3.5.8 Strukturanalyse und -darstellung ..................................................................... 85

4 Ergebnisse und Diskussion.................................................................88

4.1 Proteinkontakte ................................................................................................... 88

4.1.1 Reinigung der Wildtyp-Urocanase................................................................... 88

4.1.2 Allgemeine Konzeption der Mutationen.......................................................... 92

4.1.3 „Kopf-Kopf“-Mutanten.................................................................................... 93

4.1.4 „Fuss-Fuss“-Mutanten ..................................................................................... 99

4.1.5 Kristallisation der Tetramermutante .............................................................. 104

4.1.6 Datensammlung ............................................................................................. 106

4.1.7 Strukturlösung................................................................................................ 107

4.1.8 Strukturbeschreibung ..................................................................................... 111

4.1.9 Struktur der neu gebildeten Kontaktfläche .................................................... 116

4.2 Die Peroxine PEX19 und PEX3 ....................................................................... 119

4.2.1 Reinigung von PEX19 ................................................................................... 119

II


4.2.2 Kristallisationsversuche von PEX19 ..............................................................126

4.2.3 Klonierung von PEX19 76-271 und Herstellung von Cysteinmutanten .............127

4.2.4 Reinigung von PEX19 76-271 und der Cysteinmutanten ...................................127

4.2.5 Kristallisationsversuche von PEX19 76-271 und der Cysteinmutanten .............129

4.2.6 Klonierung und Reinigung von PEX3............................................................130

4.2.7 Klonierung und Reinigung von PEX3 34-373 ....................................................130

4.2.8 Kristallisationsversuche von PEX3 34-373 .........................................................135

4.2.9 Klonierung und Reinigung von PEX3 26-373 ....................................................135

4.2.10 Datensammlung..............................................................................................136

4.2.11 Strukurlösung .................................................................................................138

4.2.12 Strukturbeschreibung......................................................................................143

4.2.13 Herstellung des PEX3-PEX19-Komplexes ....................................................145

4.2.14 Kristallisation des PEX19-PEX3 34-373 -Komplexes.........................................147

4.2.15 Datensammlung..............................................................................................148

4.3 Das Moskitozide Toxin (MTX).........................................................................150

4.3.1 Reinigung des MTX-Holotoxins ....................................................................150

4.3.2 Kristallisation von MTX-Holotoxin ...............................................................152

4.3.3 Datensammlung..............................................................................................153

4.3.4 Strukturlösung ................................................................................................155

4.3.5 Strukturbeschreibung......................................................................................160

4.3.6 Vergleich mit strukturverwandten Proteinen..................................................170

4.3.7 Funktionsweise von MTX ..............................................................................173

4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH) ................................................186

4.4.1 Reinigung von DHPH.....................................................................................186

4.4.2 Kristallisation von DHPH...............................................................................189

4.4.3 Reinigung und Kristallisation von Selenomethionin-markiertem DHPH ......191

4.4.4 Herstellung, Reinigung und Kristallisation von Cysteinmutanten .................191

4.4.5 Datensammlung..............................................................................................194

4.4.6 Strukturlösung ................................................................................................196

4.4.7 Strukturbeschreibung......................................................................................205

4.4.8 Vergleich mit strukturverwandten Proteinen..................................................209

4.4.9 Funktionsweise ...............................................................................................213

5 Zusammenfassung und Ausblick ..................................................... 227

6 Anhang .............................................................................................. 232

6.1 Anhang I: Vektorkarten.....................................................................................232

6.2 Anhang II: Primer für QuikChange TM ...............................................................237

6.3 Anhang III: PCR-Primer....................................................................................240

6.4 Anhang IV: Eichgeraden ...................................................................................241

6.5 Anhang V: Reinigung der TEV-Protease ..........................................................243

6.6 Anhang VI: Datensätze von PEX3 26-373 ............................................................245

6.7 Anhang VII: Reinigung und Kristallisation von EBF .......................................249

7 Referenzen......................................................................................... 252

8 Danksagung ...................................................................................... 264

III


Abkürzungen

ADP

ApUp

ARF

ART

AS

ASU

BESSY

CT

CV

ddH 2 O

DHPH

DNA

EBF

ER

ERAD

FAD

FOM

GST

LT

MHBH

mPTS

MTX

MWCO

NAD + /NADH

NADPH

NCS

NMR

ORF

PAETA

PAGE

PARP

PBD

PH

PHBH

PMP

PT

PTS

RCSB

RBL

rms

rmsd

RT

SLS

SNARE

β-TAD

TEV

Trx

Adenindiphosphat

Adenylyl(3’-5’)uridin-Monophosphat

ADP-ribosylation factor

ADP-Ribosyltransferase

Aminosäure/Aminosäurerest(e)

asymmetric unit (asymmetrische Einheit)

Berliner Elektronenspeicherring-Gesellschaft für Synchrotronstrahlung

(Synchrotron, Berlin, Deutschland)

Choleratoxin

Säulenvolumen (column volume)

doppelt deionisiertes Wasser

2,6-Dihydroxypyridin-3-Hydroxylase

Desoxyribonukleinsäure (Deoxyribonucleid acid)

early B-cell factor

Endoplasmatisches Retikulum

ER-associated protein degradation (ER-assoziierter Proteinabbau)

Flavinadenindinukleotid

figure of merit

Glutathion-S-Transferase

heat labile toxin (hitzeempfindliches Toxin)

meta-Hydroxybenzoat-4-Hydroxylase

membrane-PTS (PTS der peroxisomalen Membranproteine)

Moskitozides Toxin

molecular weight cut-off (Molekulares Ausschlussgewicht)

Nicotinamidadenindinukleotid (oxidiert/reduziert)

Nicotinamidadenindinukleotidphosphat

non crystallographic symmetry (nichtkristallographische Symmetrie)

nuclear magnetic resonance (Kernresonanz)

open reading frame

Pseudomonas aeruginosa Exotoxin A

Polyacrylamidgelelektrophorese

Poly-ADP-Ribose-Polymerase

peroxisome biogenesis disorder (Störung der Peroxisomenbiogenese)

Phenolhydroxylase

para-Hydroxybenzoat-3-Hydroxylase

peroxisomales Membranprotein (peroxisomal membrane protein)

Pertussistoxin

peroxisomal targeting signal (Zielsteuerungssignal der peroxisomalen Proteine)

Research Collaboratory for Structural Bioinformatics, Proteinstrukturdatenbank

Ricin B-like (Ricin B-ähnlich)

root mean square

root mean square deviation (mittlere quadratische Abweichung)

Raumtemperatur

Swiss Light Source (Synchrotron, Villigen, Schweiz)

soluble N-ethylmaleimide-sensitive-factor attachment receptor

β-Methylen-thiazol-4-carboxamid Adenindinukleotid

tobacco etch virus

Thioredoxin

Abkürzungen für Chemikalien sind dem Chemikalienverzeichnis (Abschnitt 2.1) zu entnehmen.

IV


Glossar

activation loop an der Aktivierung beteiligter Loop

active site loop Loop im aktiven Zentrum

Alignment

Anordnung

Annealing

Abkühlen

β-trefoil

Kleeblattfaltung

ball-and-stick

Kugel-und-Stab-Darstellungsform von Molekülen

beamline

Messstation am Synchrotron

cluster

Anhäufung, Zusammenlagerung

figure of merit Gütefaktor

high/low energy remote Wellenlänge (höherer oder niedrigerer Energie), die weit entfernt (von einer

anderen Wellenlänge) liegt

inclusion bodies Einschlusskörper, Aggregat unlöslichen Proteins

inflection point Wendepunkt

Insert

einzufügender Genabschnitt

in silico

auf dem Computer

Interface

Kontaktfläche

in vitro

im Reagenzglas

in vivo

in der lebenden Zelle

Linker

Verbindungsstück

lipid raft

Cholesterin-reiche Mikrodomäne in der Zellmembran

Loop

Schlaufe

low melting

mit geringer Schmelztemperatur

maximum likelihood größte Wahrscheinlichkeit

microseeding

Einbringen winziger Kristallisationskeime

model bias

Einfluss des Modells

real-time

Echtzeit

random

zufällig, ungeordnet

Recycling

Wiederverwertung

patch

Fleck, Stelle

peak

Absorptionsmaximum

Pellet

Präzipitat

phase extension Ausweitung der Phasen auf einen Datensatz höher Auflösung

phasing power Leistungsbeitrag zur Phasierung

repeat

Wiederholung

restraint

Einschränkung

rigid body

starrer Körper

screening

systematische Suche durch Testen zahlreicher Bedingungen

simulated annealing simuliertes Abkühlen eines Proteins zum Auffinden von Energieminima

sitting/hanging drop sitzender/hängender Tropfen

soaken, Soak

Tränken, Tränkexperiment

stacking

Stapel

strained

unter Spannung stehend

tag

„Schild“, Anhang, Markierung

targeting

Zielsteuerung

test set

Testgruppe

turn

Kurve

Turnover

Durchsatz

V


1.1 Künstliche Proteinkontakte

1 Einleitung

1.1 Künstliche Proteinkontakte

1.1.1 Protein-Protein-Interaktionen

Proteine üben ihre Funktion durch Wechselwirkung mit anderen Molekülen wie kleinen

organischen Molekülen, DNA, Lipiden oder anderen Proteinen aus. Die spezifische

Interaktion zwischen Proteinmolekülen ist die Grundlage vieler biochemischer Prozesse in der

Zelle, angefangen bei der Bildung von Enzymkomplexen bis hin zu den Mechanismen von

Signaltransduktion und Immunantwort. Unspezifische Proteinaggregation ist dagegen die

Ursache von Krankheiten wie Alzheimer, Sichelzellanämie und Prionen-Erkrankungen.

Permanente Kontakte sind im Laufe der Evolution oftmals aus transienten Interaktionen

hervorgegangen. So gibt es kovalente Interaktionen, bei denen durch das Verschmelzen von

Genen verschiedene enzymatische Aktivitäten auf einer einzigen Polypeptidkette

zusammengefasst wurden, wie z. B. bei der Fettsäuresynthase von Säugern. Kovalente

Interaktionen entstehen auch über die Ausbildung von Disulfidbrücken, die entweder eine

dauerhafte Assoziation bewirken – zum Beispiel die leichten und schweren Ketten eines

Antikörpers – oder eine Regulation durch Dissoziation je nach Redoxzustand der Umgebung

ermöglichen, wie es beim Pertussistoxin der Fall ist. Die meisten Proteininteraktionen sind

jedoch nicht-kovalenter Natur und decken ein breites Spektrum von obligatorischen und

permanenten bis hin zu transienten Wechselwirkungen ab. Die Ausbildung von permanenten

Proteinkomplexen ist beispielsweise durch die Assemblierung zu funktionell

zusammengehörigen Enzymaktivitäten, die einen schnelleren Metabolismus ermöglichen

(z. B. die DNA-Polymerase III aus E. coli) und durch die Ermöglichung zusätzlicher

regulatorischer Mechanismen (z. B. Hämoglobin im Vergleich zu Myoglobin) vorteilhaft.

Auch nicht-obligatorische Interaktionen können eine hohe Stabilität haben, wie es bei

Antigen-Antikörper-Komplexen und Enzym-Inhibitor-Komplexen der Fall ist. Auf der

anderen Seite ist die transiente Natur vieler Wechselwirkungen essentiell für ihre Funktion,

beispielsweise bei katalytischen Prozessen, in Signaltransduktionskaskaden und für die

Eigenschaften von Rezeptoren.

1


1 Einleitung

Die große Vielfalt der Proteininteraktionen lässt sich grob in verschiedene Typen einordnen.

Eine Unterscheidungsmöglichkeit ist durch die Art der Untereinheiten gegeben: In Hetero-

Oligomeren sind die Untereinheiten verschieden, während Homo-Oligomere aus einer Sorte

Untereinheiten bestehen. Dabei ist entweder die gleiche Oberfläche (isologe Interaktion)

involviert, wobei das Oligomer zumeist eine C 2 -Achse aufweist, oder es sind verschiedene

Kontaktflächen beteiligt (heterologe Interaktion), was zur Ausbildung zyklischer oder

infiniter Komplexe führt. Weiterhin unterscheidet man zwischen obligatorischen und nichtobligatorischen

Interaktionen. Bei obligatorischen Interaktionen sind die einzelnen Protomere

in vivo nicht stabil oder nicht funktionell. Dies tritt in der Regel zwischen Homo-Oligomeren

auf und erfordert eine simultane Expression und Colokalisation bei der Synthese. Viele

hetero-oligomere Strukturen sind dagegen nicht-obligatorisch. Nicht-obligatorische

Interaktionen sind häufig an Regulationsmechanismen beteiligt und decken ein breites

Spektrum von intrazellulären Signalkomplexen über Antigen-Antikörper-Komplexe und

Enzym-Inhibitor-Komplexe bis hin zu Rezeptor-Liganden-Komplexen ab.

Ein weiteres Unterscheidungsmerkmal ist durch die Stärke und Dauer der Interaktion

gegeben. Während obligatorische Interaktionen in der Regel auch permanent sind, können

nicht-obligatorische Interaktionen permanent oder transient sein. Transiente Interaktionen

wiederum reichen von sehr schwachen Wechselwirkungen, bei denen sich die Protomere und

der Komplex im Gleichgewicht befinden, bis hin zu starken Interaktionen, bei denen ein

Auslöser zur Dissoziation nötig ist. Dabei sind Stärke und Dauer der Assoziation eng mit der

Funktion verknüpft und unterliegen häufig verschiedenen Kontrollmechanismen: Eine

permanente, häufig irreversible Interaktion, wie sie z. B. in Antigen-Antikörper-Komplexen

vorliegt, wird in der Regel durch die Kontrolle der Lokalisation reguliert, während reversible

Interaktionen, die als molekularer „Schalter“ fungieren, durch die physikochemische

Umgebung wie pH, Temperatur oder Effektormoleküle kontrolliert werden [1]. Diese

Einteilung zeigt jedoch nur die Extrema der möglichen Komplexbildung zwischen Proteinen

auf, es sind auch sämtliche Zwischenstufen denkbar. Protein-Protein-Interaktionen sind so

vielfältig wie die Aufgaben, die sie erfüllen.

Die enorme Bedeutung von Protein-Protein-Wechselwirkungen für das Verständnis der

biochemischen Vorgänge in einem Organismus hat zahlreiche Untersuchungen inspiriert. Um

Protein-Protein-Interaktionen zu untersuchen, können verschiedene Ansätze gewählt werden:

2


1.1 Künstliche Proteinkontakte

Die Struktur eines spezifischen Proteinkomplexes kann gelöst und analysiert werden: Für die

Aufklärung von atomaren Details sind dabei Röntgenstrukturanalyse und NMR-Studien zum

Einsatz gekommen, und mittlerweile sind zahlreiche Strukturen von Komplexen auf atomarer

Ebene bekannt und ihre Koordinaten in der Proteindatenbank (www.pdb.org) abgelegt. Dabei

handelt es sich in der Regel um permanente oder zumindest relativ feste Kontakte, da ein

transienter Komplex zur Strukturanalyse in diesem Zustand zunächst „eingefangen“ werden

muss. Statistische Ansätze wurden genutzt, um die Unterschiede zwischen Interaktionsflächen

und „normaler Oberfläche“ eines Proteins zu charakterisieren [1-7]. Die große Vielfalt von

Arten der Proteinwechselwirkungen spiegelt sich auch in einer unterschiedlichen atomaren

Umsetzung wieder, und es gibt kaum allgemeine Regeln, wie eine Kontaktfläche aufgebaut

sein muss. Die verschiedenen Arbeiten kommen, je nach verwendeten Daten und

Analysemethoden, zu unterschiedlichen Ergebnissen. Diese können auch stets nur als

Durchschnittswerte verstanden werden, da es eine hohe Streubreite gibt. Zudem hat diese

Methode den Nachteil, nur die Kontakte analysieren zu können, wie sie die Evolution

hervorgebracht hat, ohne dass bekannt ist, welche Eigenschaften der Interaktionsflächen

essentiell sind und welche nicht. Weiterhin ist die Aussagekraft einer Struktur von ihrer

Auflösung abhängig und zudem wurden in den meisten Arbeiten Wassermoleküle im

Interface vernachlässigt. Trotz all dieser Einschränkungen lassen sich zumindest grobe

Eigenschaften für Kontaktflächen festlegen (Abschnitt 1.1.2).

Die Kontaktflächen bekannter Interaktionspartner können zerstört oder verändert werden: Es

ist bereits gelungen, die Spezifität von Enzymen zu verändern [8, 9], indem in der

Kontaktfläche Aminosäurereste ausgetauscht wurden. Weiterhin konnte z. B. aus einer

dimeren Triosephosphatisomerase durch Mutationen im Interface eine monomere Form

hergestellt werden, ohne dass die Struktur und enzymatische Aktivität verloren gingen [10].

Bei dieser Vorgehensweise ist jedoch zu beachten, dass es relativ einfach ist, durch Einführen

großer, raumfüllender Aminosäurereste die Komplementarität eines Interfaces zu zerstören

oder durch Entfernen von Disulfid- oder Salzbrücken die spezifischen Wechselwirkungen zu

schwächen, ohne dass dies nähere Informationen über die Charakteristika der Kontaktfläche

liefert. Sollen durch Zerstören einer Kontaktfläche allgemeine Informationen erzielt werden,

so ist eine systematische Vorgehensweise notwendig.

3


1 Einleitung

Die bekannten allgemeinen Eigenschaften von Protein-Interaktionsflächen können verwendet

werden, um künstlich Proteinkomplexe herzustellen: Es ist bekannt, dass die Mutation

einzelner oder weniger Aminosäurereste zur Ausbildung eines Proteinkontaktes führen kann.

Dies ist pathologisch bei der Sichelzellanämie der Fall, wo der Austausch eines einzelnen

Aminosäurerests in der β-Kette von Hämoglobin (Glu6 Val) zur Ausbildung von Fasern

führt [11]. In Kristallen können Kontakte entstehen, die zum Teil in der Natur nicht

vorkommen oder die im Vergleich zum natürlichen Kontakt verstärkt sind. Dies zeigt, dass

künstliche Kontaktflächen generell gebildet werden können. Kristallkontakte sind zwar in der

Regel kleiner und schwächer als in Lösung vorkommende Kontakte, aber manchmal sind sie

so stark, dass sie nicht von natürlichen Interaktionen unterschieden werden können [12, 13].

Die Manipulation von Kristallkontakten wird dazu verwendet, um Kristalle zu erzeugen, die

besser für die Röntgenstrukturanalyse geeignet sind [14, 15]. In einigen Fällen konnten

Kristalle nur dadurch erhalten werden, dass Aminosäurereste, für die eine hohe

Oberflächenwahrscheinlichkeit vorhergesagt war, mutiert wurden, und damit die Ausbildung

von Kristallkontakten ermöglicht wurde [14, 16-18]. Diese Beispiele zeigen, dass es generell

möglich ist, neue Interaktionsstellen an Proteinen zu erzeugen.

Ein weiterführender Schritt ist die Erzeugung starker Kontakte, die auch in Lösung stabil sind.

Die Generierung eines neuen Proteinkontaktes durch Screening ist ein bekannter Prozess im

Antikörper-Antigen-System und kann auch in künstlichen Systemen verwendet werden [19].

Schwieriger ist die gezielte Veränderung von Proteinoberflächen auf eine Weise, die zur

Ausbildung von Proteinkomplexen führt [20, 21]. Dies ist durch Veränderung bereits

bekannter Kontakte gelungen [22, 23]. Auch ein völlig neues Interface konnte bereits

erschaffen werden, da aber keine Kristalle erhalten wurden, war keine detaillierte Analyse

möglich [24].

Die Erschaffung neuer Kontakte bietet im Vergleich mit anderen Methoden zur Untersuchung

von Protein-Protein-Wechselwirkungen die Möglichkeit, minimale Bedingungen für eine

Wechselwirkung ausfindig zu machen. Allerdings liefert ein künstlicher Kontakt immer nur

ein einzelnes Beispiel für eine mögliche Art der Interaktion, und da die Erzeugung solcher

Kontakte äußerst schwierig ist, wird es größerer Anstrengung bedürfen, um ausreichend

Daten für eine systematische Interpretation zu sammeln.

4


1.1 Künstliche Proteinkontakte

1.1.2 Eigenschaften von Kontaktflächen

Die Kontaktfläche eines Proteins A K wird als die Oberfläche des Proteins definiert, die durch

die Ausbildung des Kontaktes nicht mehr dem Wasser zugänglich ist. Die

lösungsmittelzugängliche Oberfläche wird als ASA (accessible surface area), die

unzugängliche als BASA (buried accessible surface area) bezeichnet. Es gilt somit für einen

Komplex aus zwei Untereinheiten:

1

A K

=

1 ( ASA + ASA − ASA ) = 2

BASA

2

1

2

12

Gleichung 1.1.1

mit ASA i ASA der Untereinheit i

ASA ij ASA des Komplexes aus den Untereinheiten i und j

Die Energie, die zur Bindung von Proteinen benötigt wird, muss den Entropieverlust der

Bindungspartner bei der Interaktion kompensieren und setzt sich zunächst zusammen aus

van-der-Waals-Kräften, Wasserstoffbrücken und Salzbrücken. Eine genauere Betrachtung

zeigt jedoch, dass van-der-Waals-Kräfte und Wasserstoffbrücken nur die Energie der zum

Solvenz eingegangen gleichwertigen Bindungen kompensieren können. Dazu sind eine hohe

Komplementarität der Kontaktflächen und eine enge Packung nötig. Die eigentliche Energie

für die Bindung ist auf den hydrophoben Effekt der Interaktion zurückzuführen. Um die

Energie zum Ausgleich des Entropieverlustes von ca. 20-30 kcal/mol aufzubringen, muss

dabei rein rechnerisch eine Oberfläche von mindestens 600 Å 2 pro Untereinheit in den

Kontakt involviert sein [2], und statistische Untersuchungen [5] zeigen, dass dies in aller

Regel der Fall ist. Insgesamt korreliert die Bindungsstärke aber nicht mit der Größe der

Kontaktfläche [1].

Die sterische Komplementarität der Oberflächen ist die wichtigste Voraussetzung für die

Ausbildung eines Protein-Kontaktes [25]. Die Proteinoberflächen können entweder bereits für

den Kontakt vorgeformt sein („Schlüssel-Schloss-Prinzip“) oder durchlaufen bei der

Ausbildung des Kontaktes eine strukturelle Umbildung (induced fit). Kontaktflächen, die eine

starke strukturelle Umbildung erfahren, sind in der Regel größer (> 1000 Å 2 ) als vorgeformte.

Sie können bis zu 2400 Å 2 betragen [5].

Die Untersuchung der Packungsdichte zeigt, dass Aminosäurereste in Kontaktflächen ähnlich

dicht gepackt sind wie im Inneren von Proteinen und damit eine dichtere Packung aufweisen

5


1 Einleitung

als die anderen an der Oberfläche lokalisierten Aminosäurereste [5]. Ihre Seitenketten

besitzen außerdem eine geringere konformationelle Entropie und sind weniger flexibel [25].

Statistische Untersuchungen zeigen, dass eine durchschnittliche Interaktionsfläche ca.

800 (± 200) Å 2 groß ist und etwa eine Wasserstoffbrücke pro 85 Å 2 besitzt, für die der

Carbonylsauerstoff der Proteinhauptkette eine wichtige Rolle spielt. Tendenziell besitzen

Kontaktflächen weniger Ladungen als die Proteinoberfläche im Durchschnitt [5]. Der

unpolare Charakter ist nicht signifikant erhöht, die hydrophoben Aminosäurereste tendieren

aber dazu, in clustern angeordnet zu sein [26]. Die Aminosäurezusammensetzung

unterscheidet sich ebenfalls: In Kontaktflächen treten die aromatischen Aminosäurereste

sowie die aliphatischen Aminosäuren Valin, Leucin, Isoleucin und Methionin häufiger auf.

Zudem besitzen Kontaktflächen weniger geladene Gruppen; dies gilt insbesondere für Lysin,

nicht jedoch für Arginin. Insgesamt ist die Streubreite aber sehr groß, so dass keine

allgemeinen Regeln abgeleitet werden können [5]. Andere Arbeiten unterteilen

Proteinkontaktflächen in verschiedene Typen, die leichte Unterschiede in der

Aminosäurezusammmensetzung und der Präferenz der eingegangenen Kontakte zwischen den

Aminosäureresten zeigen, aber auch hier sind die Übergänge zwischen den Gruppen fließend

[7]. Einig sind sich aber die Autoren [1, 5, 7] darin, dass sich Homo-Oligomere von anderen

Komplexen unterscheiden, indem sie insgesamt ein hydrophoberes Interface und weniger

Salzbrücken aufweisen. Dies steht mit der Tatsache im Einklang, dass Homo-Oligomere

häufig obligatorisch sind, während die Proteine nicht-obligater Komplexe auch als Monomere

stabil sein müssen und daher keine großen hydrophoben Flächen aufweisen dürfen.

1.1.3 Urocanase aus Pseudomonas putida

Urocanase (EC 4.2.1.49) ist ein homodimeres Enzym, das am Abbau von Histidin beteiligt ist.

Histidin wird in vielen Organismen in einem von anderen Aminosäuren verschiedenem

Abbauweg in vier oder fünf Schritten zu Glutamat abgebaut. Der Abbau beginnt mit der

Eliminierung von Ammoniak durch die Histidase. Das entstehende Urocanat wird dann zu

Hydroxy-Imidazol-Propionat hydroxyliert, das anschließend spontan zur Ketoform

tautomerisiert (Abbildung 1.1.1). Diese Reaktion wird durch die Urocanase katalysiert und

kann photometrisch bei 277 nm, einem Absorptionsmaximum von Urocanat, verfolgt werden.

6


1.1 Künstliche Proteinkontakte

N

N

H

OH

N

+ H

H

2

O

H

N

- H H -

COO

COO

H

N

N

H

O

H

H

-

COO

H

Urocanat Hydroxy-Imidazol-Propionat Imidazolon-Propionat

H

H

Abbildung 1.1.1

Enzymreaktion der Urocanase aus Pseudomonas putida

Unter physiologischen Bedingungen liegt die Urocanase aus Pseudomonas putida als Dimer

mit einer molekularen Masse von 2 x 60’781 Da vor. Jede Untereinheit besitzt ein sehr fest,

aber nicht kovalent gebundenes NAD + , das für die Katalyse essentiell ist. Die Hydroxylierung

von Urocanat durch die Urocanase ist interessanterweise die einzige bekannte Reaktion, in der

NAD + als Elektrophil fungiert. Das NAD + wird bereits während der Proteinfaltung in das

Enzym eingebaut und während der Katalyse nicht ausgetauscht.

Abbildung 1.1.2

Bändermodell der Struktur der Urocanase

Die beiden Untereinheiten sind in hellblau-blau sowie rot-orange, die NAD + -Bindedomänen

in hellblau und orange sowie die Kerndomänen in blau und rot dargestellt (pdb-code 1uwl).

Die atomare Struktur der Urocanase (Abbildung 1.1.2) zeigt, dass es sich um ein

symmetrisches Homodimer handelt [27]. Jede der Untereinheiten besteht aus zwei großen

Domänen, wobei die Kerndomäne aus N- und C-Terminus (AS 1 - 141 und AS 344 - 557)

7


1 Einleitung

und die NAD + -Bindungsdomäne aus den dazwischen liegenden Aminosäureresten (142 - 343)

besteht. Die Kerndomäne bewirkt den Kontakt zwischen den Untereinheiten, der mit 3230 Å 2

sehr groß ist und auf ein obligatorisches Interface hinweist. Die NAD + -Bindungsdomäne zeigt

eine typische Rossmann-Faltung und sitzt wie ein Deckel auf dem aktiven Zentrum in der

Kerndomäne. Damit das Substrat in das aktive Zentrum eindringen kann, muss eine

Bewegung der NAD + -Bindungsdomäne gegen die Kerndomäne erfolgen. Diese Bewegung

könnte durch Helix α9 vermittelt werden, deren erhöhte B-Faktoren auf eine größere

Flexibilität hinweisen. Zudem wurde für die Kristallisation der Urocanase eine

Cysteinmutante verwendet. Die erhaltene Struktur zeigte zwar das mutierte Cystein

(C198S) an der Oberfläche, konnte aber nicht erklären, warum ausgerechnet dieses Cystein

Disulfidbrücken ausbildete und so die Kristallisation verhinderte. Eine Bewegung der NAD + -

Bindungsdomäne würde dieses Cystein jedoch stärker als zuvor dem Solvens aussetzen und

eine Ausbildung von Disulfidbrücken ermöglichen. Weitere Hinweise auf eine Bewegung der

NAD + -Bindungsdomäne konnten der Struktur jedoch nicht entnommen werden. Inzwischen

gibt es eine weitere, noch unveröffentlichte Struktur der Urocanase aus Bacillus

stearothermophilus (pdb-code 1x87), bei der die NAD + -Bindungsdomäne von der

Kerndomäne weggeklappt ist.

8


1.2 Die Peroxine PEX19 und PEX3

1.2 Die Peroxine PEX19 und PEX3

1.2.1 Peroxisomen

Peroxisomen sind ubiquitär vorkommende Zellorganellen, die erstmals 1954 von Rhodin [28]

beschrieben und zunächst als microbodies bezeichnet wurden. Sie sind mit einer einzelnen,

für die meisten Moleküle impermeablen Membran umschlossen, normalerweise sphärisch und

haben einen Durchmesser von 0.1-1 µm [29, 30]. Aufgrund ihrer zentralen Rolle im

menschlichen Metabolismus von Wasserstoffperoxid wurden sie von De Duve und Baudhuin

1966 [31] Peroxisomen genannt. Weitere wichtige metabolische Funktionen schließen den

Abbau langkettiger Fettsäuren, die Biosynthese von Plasmalogenen und einige Schritte der

Cholesterinbiosynthese ein [29, 30, 32, 33].

Die essentielle Bedeutung der Peroxisomen im Körperstoffwechsel zeigt sich in einer ganzen

Reihe von Erbkrankheiten des Menschen, die mit Fehlfunktionen der Peroxisomen assoziiert

werden konnten. Neben Erkrankungen, die auf der Fehlfunktion oder dem Fehlen eines

einzelnen Enzyms basieren, sind dabei auch Syndrome bekannt, bei denen die Biogenese der

Peroxisomen gestört ist. Bei Patienten mit dem schon früher beschriebenen

Zellwegersyndrom bewiesen Goldfischer et al. im Jahre 1973 die Abwesenheit von Katalasehaltigen

Vesikeln [34]. Zusammen mit der neonatalen Adrenoleukodystrophie, der infantilen

Refsumschen Erkrankung und der Rhizomelischen Chondrodysplasie bildet es die Gruppe der

so genannten peroxisome biogenesis disorders (PBDs). Diese werden autosomal rezessiv

vererbt und führen zu verlangsamter neurologischer Entwicklung und frühem Tod der

Patienten [29, 32].

Bei systematischer Untersuchung der Zellen von Patienten mit PBD konnten diese in bislang

12 Komplementationsgruppen eingeteilt werden. Die in diesen Gruppen defizienten Gene

werden als PEX-Gene, ihre Proteinprodukte als Peroxine bezeichnet [29, 35]. In Hefe sind 32

PEX-Gene identifiziert, im Menschen wurden bisher 15 homologe Proteine gefunden (Tabelle

1.2.1). Zellen, die Defizienz in unterschiedlichen Peroxinen aufweisen, lassen sich in drei

generelle Phänotypen einteilen. In den schwersten Fällen sind überhaupt keine Peroxisomen

detektierbar, in der zweiten Gruppe sind zwar Peroxisomen vorhanden, aber nicht

funktionsfähig, und beim dritten Phänotyp ist die Zahl der Peroxisomen stark reduziert [35].

9


1 Einleitung

Tabelle 1.2.1 Übersicht der Peroxine

Name

PEX1

PEX2

PEX3

PEX4

PEX5

PEX6

PEX7

PEX8

PEX9

PEX10

PEX11

PEX12

PEX13

PEX14

PEX15

PEX16

PEX17

PEX18

PEX19

PEX20

PEX21

PEX22

PEX23

PEX24

PEX25

PEX26

PEX27

PEX30-32

Mr [kDa]

100-150

40

40

20-24

70

100

40

60-80

44

35

25

40

44

40

44

36

25

31

33

46

31

20

46

61

34

Charakteristik

AAA-ATPase (ATPase associated with diverse

cellular activities)

integrales Membranprotein, RING-Motiv

integrales Membranprotein

peroxisomenassoziierte Ubiquitin-Ligase

zwei Spleißformen bei Säugern, TRP-Domänen

AAA-ATPase (ATPase associated with diverse

cellular activities)

WD40-Repeats

integrales Membranprotein

integrales Membranprotein

integrales Membranprotein, RING-Motiv

integrales Membranprotein

integrales Membranprotein, RING-Motiv

integrales Membranprotein, SH3-Domäne

integrales Membranprotein

integrales Membranprotein

intraperoxisomales peripheres Membranprotein

integrales Membranprotein?

cytoplasmatisch

farnesyliertes, vorwiegend cytosolisches Protein

cytoplasmatisch

integrales Membranprotein

integrales Membranprotein

integrales Membranprotein

peripheres Membranprotein

entspricht wahrscheinlich PEX15

Vorgeschlagene Funktionen

Matrixprotein- Import/ Vesikelfusion

Translokationsmaschinerie?

Import von PMPs

Turnover von PEX18/ PEX21, Recycling von PEX5

Transportrezeptor für Matrix-Import (PTS1, PTS3,

bei Säugern PTS2 durch lange Isoform)

Matrixprotein- Import/ Vesikelfusion

Transportrezeptor für PTS2

Translokationsmaschinerie?

Proliferation, Transport mittellanger Fettsäureketten

Translokationsmaschinerie?

Rezeptordocking

Rezeptordocking

PMP-Import

Rezeptordocking, PMP-Import

PTS2-abhängiger Importweg

beteiligt am Membranproteinimport

Thiolase-Dimerisierung/-Import

PTS2-abhängiger Importweg

verankert PEX4 an der Peroxisomenmembran

beteiligt am Matriximport

beteiligt an Matrix- und Membranproteinimport [36]

Regulation von Größe und Zahl der Peroxisomen [37]

[38, 39]

Regulation von Größe und Zahl der Peroxisomen [37]

Regulation von Größe und Zahl der Peroxisomen [40]

Org.: Organismus; s: Säuger, h: >2 Hefen, S.c.: S. cerevisiae, Y.l. : Y. lipolytica, nach [30, 35] sowie angegebenen Referenzen

Org.

s, h

s, h

s, h

s, h

s, h

s, h

s, h

h

Y.l.

s, h

s, h

s, h

s, h

s, h

S.c.

s, Y.l.

h

S.c.

s, h

Y.l.

S.c.

h

Y.l.

Y.l.

S.c.

s

S.c.

S.c.

10


1.2 Die Peroxine PEX19 und PEX3

1.2.2 Biogenese der Peroxisomen

Die Biosynthese eines Zellorganells gliedert sich allgemein in drei Stadien: die Bildung der

Lipiddoppelschicht, die Insertion von Membranproteinen und den Import von

Matrixproteinen. Sowohl Membran- als auch Matrixproteine von Peroxisomen werden von

nukleärer DNA codiert, im Cytosol an freien Ribosomen synthetisiert und posttranslational an

ihren Bestimmungsort transportiert. Dabei ist die Insertion von Membranproteinen ATPunabhängig,

während der Eintransport von Matrixproteinen ATP erfordert [30, 32]. Dies legt

nahe, dass diese beiden Prozesse nach vollständig unterschiedlichen Mechanismen ablaufen.

Import von Matrixproteinen

Der Import von Matrixproteinen (Abbildung 1.2.1) ist der am besten verstandene Schritt in

der Peroxisomenbiogenese. Es sind bisher drei Sortierungssignale (peroxisomal targeting

signal, PTS) beschrieben, die Proteine in die Peroxisomenmatrix steuern.

Mehr als 90% der Matrixproteine enthalten die als PTS1 bezeichnete Signalsequenz, die aus

einem C-terminalen Tripeptid mit der Sequenz SKL oder konservierten Substitutionen dieser

Aminosäurereste besteht. Solche Proteine interagieren mit dem Importrezeptor PEX5. PEX5

ist vorwiegend cytosolisch, wurde aber auch an der Peroxisomenmembran und im Peroxisom

beobachtet. Dies legt die Vermutung nahe, dass es als mobiler Transportrezeptor zwischen

Cytosol und Peroxisomenmatrix pendelt. Dabei ist noch nicht völlig geklärt, ob PEX5 seine

Ladung nur an die Membran bringt (shuttle receptor) oder mit der Ladung in die Peroxisomen

gelangt (extended shuttle). PEX5 interagiert mit einer ganzen Reihe peroxisomaler

Membranproteine, darunter PEX13, PEX14, PEX10 und PEX12 sowie in Hefe mit PEX8.

Dabei wird vermutet, dass PEX13 und PEX14 zusammen mit PEX17 als Andockproteine

fungieren, PEX10 und PEX12 könnten zusammen mit PEX2 regulatorisch an der

Translokation beteiligt sein. In Hefe interagiert PEX8 in der Peroxisomenmatrix mit PEX5

und könnte somit für die Ablösung der Fracht von PEX5 verantwortlich sein. Ein Homologes

für PEX8 im Säuger ist noch nicht bekannt [29, 30].

Nur wenige Matrixproteine werden über eine als PTS2 bezeichnete Signalsequenz in die

Peroxisomen transportiert. PTS2 ist ein Peptidmotiv von neun Aminosäureresten mit der

11


1 Einleitung

breiten Konsensussequenz (R/K)-(L/V/I)-XXXXX-(H/Q)-(L/A/F) am N-Terminus der

Proteine. Dieses Motiv wird von PEX7, dem Rezeptor für PTS2-Proteine gebunden. In

Säugetieren interagiert beladenes PEX7 mit einer längeren Isoform von PEX5 und schleust

PTS2-Proteine so in den Matriximportweg ein [29, 30]. Im Gegensatz zum PTS1 wird das

PTS2 bei Säugern in der Peroxisomenmatrix abgespalten [41].

Abbildung 1.2.1 Schematische Darstellung des Imports von peroxisomalen Matrixproteinen

Ein drittes, bisher nicht genau definiertes Sortierungssignal (PTS3) wird für Proteine

vermutet, die trotz fehlender PTS1 und PTS2-Signale in die Peroxisomen gelangen. Proteine

mit einem PTS3 werden ebenfalls durch PEX5 erkannt, allerdings verwenden sie eine andere

Bindungsstelle als PTS1-Proteine [30].

Neben den Peroxinen werden im Cytosol zumindest für PTS1-Proteine auch Chaperone

benötigt [30], deren genaue Rolle jedoch unklar ist, denn im Gegensatz zum Proteinimport ins

ER und in die Mitochondrien können Peroxisomen gefaltete Proteine und auch ganze

Proteinkomplexe importieren. Es können auch Proteine ohne Signalsequenz im Komplex mit

einem PTS-enthaltenden Protein in die Peroxisomen dirigiert werden [29, 30]. Selbst bei

12


1.2 Die Peroxine PEX19 und PEX3

PTS1-markierten Goldpartikeln mit einem Durchmesser von bis zu 9 nm wurde ein Transport

ins Peroxisom beobachtet. Für den Translokationsmechanismus werden mehrere Hypothesen

vorgeschlagen. Weder für eine Importpore noch für eine Einstülpung der Membran sind

jedoch überzeugende experimentelle Hinweise vorhanden [30].

Import von Membranproteinen

Es sind zahlreiche peroxisomale Membranproteine (PMPs) bekannt, das Sortierungssignal

(mPTS) und ihre Insertion in die Membran ist jedoch weitgehend ungeklärt. Eine

Konsensussequenz wie für PTS1 oder PTS2-Proteine scheint es nicht zu geben, allerdings

beschreiben mehrere Autoren als Targeting-Signal einen basischen Loop und mindestens eine

angrenzende Transmembrandomäne [30]. Eine essentielle Rolle für die Insertion der

Membranproteine scheinen die drei Peroxine PEX3, PEX16 und PEX19 zu spielen. Patienten,

denen eines dieser Proteine fehlt, besitzen keine nachweisbaren Peroxisomen. Die PMPs

werden entweder abgebaut oder misslokalisiert [30, 32]. Daneben scheint auch PEX17 am

Import von Membranproteinen beteiligt zu sein, allerdings gibt es hier widersprüchliche

Daten [30, 32].

1.2.3 PEX19

PEX19 wurde 1994 erstmals in menschlichen Zellen entdeckt und zunächst als HK33

(housekeeping gene 33) bezeichnet [42]. Gleichzeitig wurde ein peroxisomales, farnesyliertes

Protein (PxF) in Hamsterzellen identifiziert, das 93% Homologie aufwies [43]. 1997 wurde

das menschliche Homolog kloniert und das Gen charakterisiert [44]. PEX19 komplementiert

die Komplementationsgruppe CG-J (CG-14), die sich durch völlige Abwesenheit

nachweisbarer Peroxisomen auszeichnet. Das Protein trägt ein Farnesylierungssignal CAAX

(C: Cystein, A: aliphatische, X: C-terminale, beliebige Aminosäure; HsPEX19: CLIM) und ist

im Menschen, im Hamster und in S. cerevisiae teilweise farnesyliert, in P. pastoris und in

Y. lipolytica wurde dagegen keine Farnesylierung gefunden. Die funktionelle Bedeutung der

Farnesylierung ist bislang nicht eindeutig geklärt [44-47]. Es besitzt eine theoretische Masse

von ca. 33 kDa, läuft aber im SDS-Gel bei 39 kDa (farnesyliert) und 40 kDa [47]. PEX19

liegt vorwiegend cytosolisch vor, ist aber zu einem kleinen Teil auch mit der

13


1 Einleitung

Peroxisomenmembran assoziiert [43, 44]. In Y. lipolytica wurde davon abweichend eine

überwiegend peroxisomale Lokalisation gefunden [46].

PEX19 interagiert mit allen bekannten peroxisomalen Membranproteinen. In Abwesenheit

von PEX19 werden diese Membranproteine entweder abgebaut oder misslokalisiert. Ob die

Interaktion von PEX19 mit den PMPs im Cytosol oder an den Peroxisomen stattfindet, ist

umstritten, die widersprüchliche Datenlage kann aber möglicherweise auf die

unterschiedlichen verwendeten Organismen zurückgeführt werden [30, 32, 33]. In vielen

PMPs stimmt die peroxisomale Targetingsequenz mit der Bindedomäne für PEX19 überein

[30, 32, 33, 48]. Eine Ausnahme ist PEX3. In der Ratte und im Menschen reichen die ersten

33 Aminosäurereste für eine peroxisomale Lokalisation aus, die Interaktion mit PEX19 findet

jedoch an den Aminosäureresten 120-136 statt. Diese interagieren mit dem N-terminalen Teil

von PEX19 (AS 1-56) [49, 50].

Widersprüchliche Daten bezüglich des Ortes der Interaktion sowie der Frage, ob das

Sortierungssignal der PMPs immer mit der Erkennungssequenz für PEX19 übereinstimmt,

haben zu zwei verschiedenen Theorien über die Funktion von PEX19 geführt. Die Erkennung

der Signalsequenz durch PEX19 im Cytosol legt eine Aufgabe als Importrezeptor und

Chaperon für peroxisomale Membranprotein mit Ausnahme von PEX3 nahe [49]. Davon

abweichend finden andere Autoren eine Interaktion an der Peroxisomenmembran an einer von

der Signalsequenz verschiedenen Position und schlagen daher eine Rolle als regulatorischer

Faktor für Membranproteinkomplexe vor [51, 52].

1.2.4 PEX3

PEX3 ist ein integrales Membranprotein, das an den ersten Schritten der

Peroxisomenbiogenese beteiligt ist. Fehlt PEX3, so sind keinerlei Peroxisomen nachweisbar,

peroxisomale Matrix- und Membranproteine sind instabil oder werden misslokalisiert [30, 32,

33]. Lokalisation und Stabilität von PEX19, dem einzigen bekannten Interaktionspartner,

werden nicht beeinflusst [53]. Im Gegensatz zu anderen Membranproteinen findet die

Interaktion zwischen PEX19 und PEX3 an den Peroxisomen statt [54], die peroxisomale

Signalsequenz und die PEX19-Bindestelle sind verschieden und PEX3 wird unabhängig von

14


1.2 Die Peroxine PEX19 und PEX3

PEX19 in spezialisierte ER-Abschnitte lokalisiert [55]. Daher wird für PEX3 eine Funktion

als Dockingrezeptor für PEX19 vermutet. Humanes PEX3 besteht aus 373 Aminosäureresten

und hat eine Molekularmasse von 42 kDa. Laut Vorhersage besitzt es eine N-terminale

Transmembranhelix (AS 15-33), die mit dem Sortierungssignal übereinstimmt. Der

C-terminale Teil mit der PEX19-Bindestelle (AS 120-136 [55]) befindet sich im Cytosol

[30, 32].

Ursprung der Lipidmembran

Eine der umstrittensten Fragen bezüglich der Peroxisomenbiogenese ist die nach ihrer

Herkunft. Bei anderen Zellorganellen sind generell zwei Biogenesewege bekannt: GOLGI-

Apparat, Endosomen, Lysosomen und Kernmembran haben ihren Ursprung im

Endoplasmatischen Retikulum und können bei Verlust neu gebildet werden. Dagegen

entstehen die endosymbiontischen Organellen durch autonome Replikation, eine Neubildung

ist nicht möglich.

Peroxisomen besitzen die Fähigkeit, sich durch Teilung zu vermehren. Dieser Prozess ist

vermutlich abhängig von PEX11 [29]. Auf der anderen Seite können Peroxisomen aber auch

de novo entstehen, etwa bei der Komplementation von peroxindefizienten Zellen mit dem

defekten Gen. Die Frage nach der Herkunft der Lipidmembran bei diesem Prozess war lange

Zeit ungeklärt [30]. Neuere Ergebnisse weisen aber auf eine Beteiligung des ERs hin [56].

Dabei wurde die Lokalisation von fluoreszenzmarkiertem PEX3 mittels real-time

Fluoreszenzmikroskopie beobachtet und festgestellt, dass PEX3 zunächst im ER auftaucht.

Dort ist es in Foci konzentriert. Bei Abwesenheit von PEX19 kann PEX3 das

Endoplasmatischen Retikulum nicht verlassen. PEX19 bewirkt die Abschnürung von PEX3-

haltigen Vesikeln vom ER, die dann zu voll funktionsfähigen Peroxisomen heranreifen.

Ebenso wird fluoreszenzmarkiertes PEX19 zunächst an den PEX3-Foci am ER und

anschließend an den reifenden Peroxisomen angereichert [56].

PEX3 besitzt keine klassische Signalsequenz für das ER und wird unabhängig vom SRP

(signal recognition particle) ins ER transportiert. Damit gehört es zu einer größeren Gruppe

von Proteinen, die auf bisher ungeklärtem Weg ins ER gelangen, wie zum Beispiel die tailanchored

Proteine, zu denen auch SNARE-Proteine gehören [57].

15


1 Einleitung

1.3 Das Moskitozide Toxin (MTX)

1.3.1 ADP-Ribosyltransferasen

ADP-Ribosyltransferasen (ARTs) katalysieren die Hydrolyse von NAD + und den Transfer der

ADP-Riboseeinheit auf ein Zielprotein oder eine Ziel-DNA. Diese enzymatische Aktivität

wurde zunächst bei toxischen Proteinen gefunden, inzwischen sind aber auch eine ganze

Reihe nicht-toxischer Enzyme bekannt, darunter die eukaryotischen Mono-ADP-

Ribosyltransferasen und die Poly-ADP-Ribosyltransferasen (PARPs), die an der Reparatur

von DNA-Doppelstrangbrüchen beteiligt sind, sowie virale Proteine [58-60].

ADP-ribosylierende Toxine

ADP-ribosylierende Toxine katalysieren den Transfer einer ADP-Riboseeinheit von NAD +

auf ein Zielprotein. Beim Menschen können durch diese Toxine eine ganze Anzahl

gefährlicher und oft tödlich verlaufender Krankheiten ausgelöst werden, darunter Cholera,

Diphtherie und Keuchhusten. Die Zielproteine sind in der Regel wichtige Regulationsproteine

in der Zelle, und ihre Modifizierung führt zu ihrer In- oder Daueraktivierung. In beiden Fällen

ist eine schwerwiegende Deregulation wichtiger zellulärer Prozesse die Folge, die in den

meisten Fällen zum Zelltod führt (Tabelle 1.3.1). Auf Grund ihrer großen Bedeutung sind

diese Toxine intensiv erforscht und von vielen ist die Struktur gelöst worden (Tabelle 1.3.2

zeigt eine Auswahl). Neben der Transferaseaktivität besitzen alle bekannten ADPribosylierenden

Toxine auch eine langsame NAD + -Hydrolaseaktivität.

Alle ADP-ribosylierenden Toxine besitzen eine AB-Struktur, bei der die A-Komponente die

katalytisch aktive Einheit darstellt und die B-Komponente zellbindende Funktionen hat.

Allerdings unterscheiden sich die Toxine in der Art und Weise, in der diese Zweiteilung

realisiert wird. Auf Grund ihrer Domänenorganisation lassen sich die ADP-ribosylierenden

Toxine in vier Gruppen einteilen [58]:

• Die AB 5 -Toxine bestehen aus einer katalytisch aktiven A-Komponente und einem

B 5 -Pentamer, das als Homo- (Choleratoxin) oder Heterooligomer (Pertussistoxin) vorliegen

kann und neben der Zellbindung auch für die Translokation zuständig ist. Es bildet einen

stabilen Ring, auf dessen Mitte die A-Komponente zu liegen kommt. Alle bekannten Toxine

dieser Gruppe modifizieren Untereinheiten der trimeren G-Proteine.

16


1.3 Das Moskitozide Toxin (MTX)

Tabelle 1.3.1 Übersicht über ADP-Ribosyltransferasen und ihre Wirkung

Toxin

Organismus

Klasse

NAD +-

Bindestelle

Modifizierte

Aminosäure

Pertussistoxin (PT)

Bordetella pertussis

AB5

CT

active site loop

Cystein

Choleratoxin (CT)

Vibrio cholerae

AB5

CT

active site loop

Arginin

E. coli heat labile

Enterotoxin (LT)

Escherichia coli

AB5

CT

active site loop

Arginin

Diphtherietoxin (DT)

Corynebacterium

diphtheriae

AB mit drei

Domänen

DT

Diphthamid

Pseudomonas

Exotoxin A (PAETA)

Pseudomonas

aeruginosa

AB mit drei

Domänen

DT

Diphthamid

VIP2

Bacillus cereus

AB binäres Toxin

CT

Arginin

(Arg177)

Iotatoxin

Clostridium perfringens

AB binäres Toxin

CT

Arginin

(Arg177)

C3bot

Clostridium botulinum

Einzelne

Polypeptidkette

CT

Asparagin

(Asn41)

C3stau

Staphylococcus aureus

Einzelne

Polypeptidkette

CT

Asparagin

(Asn41)

MTX

Bacillus sphaericus

AB4 auf einer

Polypeptidkette

CT

active site loop

Arginin

Ecto-ART2

Ratte

Einzelne

Polypeptidkette

CT

Arginin

Zielprotein

Giα, Gt und

Gs

Gs

eEF2

eEF2

Aktin

Aktin

Rho A-C

Rho A-C,

RhoE, Rnd3

?

Integrine

Wirkung

Entkoppeln der Effektoren vom

Adenylatcyclase-Signaltransduktionsweg

Daueraktivierung des G-Proteins und

dadurch unkontrollierte Aktivierung der

Adenylatcyclase

Daueraktivierung des G-Proteins und

dadurch unkontrollierte Aktivierung der

Adenylatcyclase

Hemmung der Proteinsynthese

Hemmung der Proteinsynthese

Hemmung der Aktinpolymerisation

Hemmung der Aktinpolymerisation

Depolymerisation des Aktin-Cytoskeletts

Depolymerisation des Aktin-Cytoskeletts

?

Zellregulation und Rolle in der Apoptose

17


1 Einleitung

• Diphtherietoxin und Exoenzym A (PAETA) besitzen drei Domänen, die von einer

Polypeptidkette gebildet werden. Ein einziges Protein ist zuständig für Rezeptorbindung,

Membrantranslokation und ADP-Ribosylierung. Beide Toxine wirken durch ADP-

Ribosylierung eines modifizierten Histidinrests (Diphthamid) des Transkriptionsfaktors

eEF2.

• Die aktinmodifizierenden Toxine sind binäre Proteine, bei denen die zellbindende und die

katalytisch wirksame Komponente voneinander unabhängig ihre Wirkung ausüben und

nicht wie die AB 5 -Toxine zuvor einen Komplex bilden. Sie ADP-ribosylieren Aktin und

beeinträchtigen so die Funktion des Cytoskeletts.

• Die C3-Exoenzyme bestehen aus einer einzelnen, kleinen Domäne, deren Wirkungsweise

noch weitgehend ungeklärt ist. Über die ADP-Ribosylierung von regulatorischen Rho-

Proteinen beeinträchtigen sie ebenfalls die Funktion des Aktin-Cytoskeletts.

Tabelle 1.3.2

Toxin

Choleratoxin

Pertussistoxin

Diphtherietoxin

Exotoxin A

heat labile

Enterotoxin (LT)

Übersicht über Strukturen von ADP-ribosylierenden Toxinen (Auswahl)

Holotoxin

Holotoxin Y30S (intrinsisch aktiv)

katalytische Domäne mit ARF6

katalytische Domäne mit ARF6 und NAD +

Holotoxin

Holotoxin mit ATP

Holotoxin Dimer

Holotoxin Dimer mit ApUp

Holotoxin Monomer mit ApUp

Holotoxin Dimer mit NAD +

katalytische Domäne mit ApUp

Holotoxin

katalytische Domäne mit β-TAD

katalytische Domäne mit Nicotinamid und AMP

katalytische Domäne mit eEF2

katalytische Domäne mit eEF2 und β-TAD

Holotoxin

partiell aktiviertes Holotoxin

pdb-code

1s5e 1s5f 1xtc

1s5b 1s5c 1s5d

2a5d

2a5f

1prt

1bcp

1sgk

1ddt

1mdt

1tox

1dtp

1ikq

1aer

1dma

1zm2 1zm3

1zm4

1lta

1ltb

MTX 30-308 katalytische Domäne mit inhibitorischem Linker 2cb4

18


1.3 Das Moskitozide Toxin (MTX)

NAD + -Bindung und Katalysemechanismus

Die Struktur einiger ADP-ribosylierender Toxine konnte inzwischen in Anwesenheit von

NAD + oder einem nichthydrolysierbaren Analogon von NAD + bestimmt werden (Tabelle

1.3.2). Exotoxin A wurde sogar zusätzlich im Komplex mit seinem Substrat strukturell

untersucht. Die Analyse dieser Strukturen ermöglicht eine Aussage über die Vorgänge bei der

NAD + -Bindung sowie der weiteren Katalyse.

Das NAD + wird so gebunden, dass die glykosidische Bindung leicht hydrolysiert werden

kann. Das in allen ARTs gefundene katalytische Glutamat bildet eine Wasserstoffbrücke mit

der 2’-OH-Gruppe der Ribose [58]. Für den Katalysemechanismus wurden sowohl ein S N 2-

als auch ein S N 1-Mechanismus vorgeschlagen. In beiden Fällen soll das katalytische Glutamat

das bei der Spaltung der Bindung zwischen Nicotinamid und Ribose entstehende

Oxocarbeniumion stabilisieren. Ein vereinfachter Mechanismus ist in Abbildung 1.3.1 zu

sehen [58]. Die Struktur des Exotoxins A im Komplex mit seinen beiden Substraten [61]

weist ebenso wie biochemische Untersuchungen [62] zumindest für dieses Protein auf einen

random Mechanismus 3. Ordnung hin.

Substrat

Glu

O

OH

HO

HO

ADP

O

O

N +

O

NH 2

Glu

O

OH

R

HO

HO

ADP

O

O

N +

O

NH 2

Substrat

Abbildung 1.3.1

Mechanismus der ADP-Ribosyltransferasen [58]

HO

HO

R

O

+

N

O

NH 2

ADP

O

19


1 Einleitung

Aktivierung der ADP-ribosylierenden Toxine

Die ADP-ribosylierenden Toxine werden sämtlich als Proenzyme produziert und müssen

einen Aktivierungsprozess durchlaufen. Dieser beinhaltet eine proteolytische Spaltung und

zudem häufig die Reduktion einer Disulfidbrücke. Dadurch wird die katalytische

A-Komponente von der zellbindenden B-Komponente gelöst. In der Regel erfährt die

A-Komponente noch eine konformationelle Umordnung, bevor sie voll aktiv ist [59]. Der

Aktivierungsprozess stellt sicher, dass die Toxine erst an ihrem Zielort ihre toxische Wirkung

entfalten können. Häufig sind zusätzlich auch zelleigene Proteine oder andere zelluläre

Komponenten für die Aktivität nötig. So wird Choleratoxin durch ARF (ADP-ribosylating

factor) der Zielzelle aktiviert [63], und Pertussistoxin benötigt zumindest in vitro die

Anwesenheit von ATP und Phospholipiden [64].

Strukturmerkmale der ADP-Ribosyltransferasen

Trotz geringer Sequenzhomologie besitzen alle ARTs eine aus etwa 70-100 Aminosäureresten

bestehende Kernstruktur, die das aktive Zentrum mit der NAD + -Bindestelle umfasst. Im

Gegensatz zur Rossmann-Faltung anderer NAD + -bindender Proteine weisen ARTs eine

andere α/β-Faltung für die NAD + -Bindestelle auf. Die Kernstruktur besteht aus zwei

zueinander senkrechten β-Faltblättern, die durch eine variable Anzahl von α-Helices oben und

unten flankiert werden. Die NAD + -Bindestelle liegt in einer Spalte, die aus dem β-Faltblatt

und einer α-Helix (C3bot, C3stau, VIP2, Iota, Ecto-ART) oder einem active site loop (CT,

LT, DT, PT, PAETA, MTX) besteht [58-60].

Auf Grund ihrer Faltung im aktiven Zentrum lassen sich die ARTs in zwei Gruppen einteilen

[58], die durch verschiedene konservierte Motive gekennzeichnet werden (Tabelle 1.3.3). Die

DT-Gruppe basiert auf den Eigenschaften der Kernstruktur des Diphtherietoxins und

beinhaltet außerdem PAETA und die PARPs aus Säugetierzellen. Alle anderen ARTs, deren

Struktur bekannt ist, gehören zur CT-Gruppe, die durch die NAD + -Bindung analog zum

Choleratoxin gekennzeichnet wird. Diese Gruppe lässt sich weiter unterteilen in Proteine mit

einem active site loop und Enzyme mit einer α-Helix als Teil der NAD + -Bindestelle (α-3-

Helix-Toxine). Die folgenden Strukturmotive treten auf [58-60]:

20


1.3 Das Moskitozide Toxin (MTX)

• Das ARTT-Motiv beinhaltet das katalytisch aktive Glutamat und im Falle der CT-Gruppe

ein weiteres Glutamat oder Glutamin zwei Aminosäurereste davor (Q/E-x-E-Motiv), das

essentiell für die NAD + -Transferase-, nicht aber für die NAD + -Hydrolaseaktivität ist.

• Das STS-Motiv ist Teil eines β-Faltblatts der NAD + -Bindetasche und dient als Anker, um

die NAD + -Bindestelle zusammenzuhalten. Es enthält die Aminosäureabfolge aromatischhydrophob-Serin-Threonin-Serin.

In der DT-Gruppe ist das STS-Motiv entweder teilweise

(DT) oder völlig (PAETA) verloren gegangen. Statt des STS-Motivs besitzen Proteine der

DT-Gruppe ein Tyrosinpaar, das die Nicotinamideinheit von oben und unten durch

Interaktion der π-Orbitale bindet (Tyr-X 10 -Tyr-Motiv).

• Alle ARTs besitzen ein konserviertes Arginin (CT-Gruppe) oder Histidin (DT-Gruppe), das

an der NAD + -Bindung oder der Stabilisierung des aktiven Zentrums beteiligt ist.

Der PN-Loop und das α-3-Motiv treten nur in den aktinbindenden und den C3-ähnlichen

ADP-ribosylierenden Toxinen auf. Der PN-Loop bildet einen essentiellen Teil der NAD + -

Bindetasche. Beim α-3-Motiv handelt es sich um eine α-Helix, die den active site loop der

übrigen Mitglieder der CT-Gruppe ersetzt.

Tabelle 1.3.3 Übersicht über die Strukturmotive in der CT- und der DT-Gruppe

DT-Gruppe

CT-Gruppe

DT, PAETA CT, LT, PT α-3-Toxine

ARTT-Motiv nur katalytisches Glutamat E/Q-x-E

STS-Motiv/ Tyr-X 10 -Tyr-Motiv Tyr-X 10 -Tyr-Motiv STS

Arg/His-Motiv Tyr-His Val/Leu-aromatisch-Arg

PN-Loop - - +

active site loop/ α-3-Helix active site loop active site loop α-3-Helix

Aufnahmemechanismen der Toxine

Die genauen Aufnahmemechanismen sind für die meisten der ADP-ribosylierenden Toxine

nicht vollkommen geklärt. Diphtherietoxin bindet mit der C-terminalen B-Komponente an

seinen Rezeptor und gelangt durch rezeptorvermittelte Endocytose in das Endosom. Durch die

pH-Senkung kommt es durch Protonierung saurer Gruppen in den Loops zu einer

21


1 Einleitung

konformationellen Änderung in der Translokationsdomäne, die sich nun in die Membran

einlagern kann und den Transfer der N-terminalen katalytischen Domäne ins Cytosol bewirkt.

Gleichzeitig werden durch die Änderungen in der Translokationsdomäne die nichtkovalenten

Interaktionen zwischen der A- und der B-Komponente geschwächt, so dass sich die

katalytische Domäne vom restlichen Protein lösen kann. Der genaue Mechanismus der

Translokation ist jedoch nicht geklärt [65, 66].

Noch weniger ist über den Aufnahmemechanismus der anderen Toxine bekannt. Choleratoxin

hat fünf B-Untereinheiten, die alle eine Bindestelle für die Oligosacchariddomäne des

Monosialogangliosids GM 1 besitzen. Durch die Bindung an den Rezeptor könnte das Toxin in

lipid rafts konzentriert werden, es wird aber auch ein Clathrin-abhängiger Mechanismus

diskutiert. Es wird vermutet, dass Choleratoxin über den so genannten retrograden Transport

über die Endosomen und das trans-GOLGI-Netzwerk zunächst in den GOLGI-Apparat

gelangt. Dort wird die C-terminale KDEL-Sequenz vom entsprechenden Rezeptor erkannt

und das Protein zurück ins ER gebracht [67, 68]. Ein entsprechender Mechanismus wird

ebenso für LT, PT, PAETA sowie für weitere Toxine, die nicht über ADP-Ribosylierung

wirken (wie z. B. Shigatoxin und Ricin) vermutet, da sich ihre Aufnahme ebenso wie die von

Choleratoxin durch Brefeldin A hemmen lässt. Von diesen Toxinen besitzen LT und PAETA

ebenfalls eine KDEL-Sequenz, bei den anderen ist nicht bekannt, wie sie ins ER gelangen.

Allerdings hat sich der Transport ins ER erstaunlicherweise wohl in mindestens sechs

Toxinen voneinander unabhängig entwickelt [69].

Auch für den Ablauf des Transports aus dem ER ins Cytosol gibt es bisher nur eine

Hypothese. Es wird vermutet, dass die Toxine einen bestehenden Mechanismus des

Organismus ausnutzen, der ungefaltete oder falsch gefaltete Proteine aus dem ER zurück ins

Cytosol und dort zum Abbau ins Proteasom bringt. Dabei handelt es sich um den ERassociated

protein degradation (ERAD) Pathway. Bei diesem Mechanismus werden Proteine,

die nicht oder falsch gefaltet sind, durch Ubiquitin für den Abbau im Proteasom markiert. Das

Chaperon Calnexin und die Pore Sec61 scheinen dabei am Rücktransport beteiligt zu sein. Für

die oben genannten Toxine wird vermutet, dass sie nach der Dissoziation von ihrer

zellbindenden B-Komponente durch Präsentation ungefalteter Peptide oder hydrophober

Regionen vortäuschen, ungefaltet zu sein. Es wird ferner hypothetisiert, dass sie dem

ubiquitinabhängigen Abbau entgehen, weil sie auffällig wenig Lysine in der enzymatisch

22


1.3 Das Moskitozide Toxin (MTX)

aktiven A-Komponente haben, die zur Ubiquitinylierung verwendet werden könnten, während

der Anteil in den B-Komponenten durchschnittlich ist [69].

Exotoxin A bindet mit der N-terminalen Domäne den α2-Makroglobulinrezeptor und wird

über rezeptorvermittelte Endocytose in die Endosomen aufgenommen. Der weitere

Aufnahmeweg ist unbekannt, und es besitzt weder einen längeren hydrophoben Teil in der

Primärsequenz noch einen hydrophoben patch auf der Oberfläche, die die

Membrantranslokation ermöglichen könnten [70, 71]. C3bot wird vermutlich unspezifisch

durch Pinocytose aufgenommen [72], so dass auch für andere Toxine alternative oder

zusätzliche Mechanismen in Betracht gezogen werden können.

1.3.2 Toxine aus Bacillus sphaericus

Bacillus sphaericus umfasst eine sehr heterogene Gruppe von Gram-negativen Bakterien, die

sich durch ihr streng aerobes Wachstum auszeichnen und kugelförmige Sporen bilden. Einige

Stämme sind toxisch für Moskitolarven und können daher zur biologischen Kontrolle

krankheitsübertragender Moskitoarten eingesetzt werden. Erforscht wird weiterhin, ob sich

die toxischen Stämme zur Bekämpfung von Schädlingen in der Landwirtschaft einsetzen

lassen, wie es beispielsweise mit Bacillus thuringiensis geschieht [73, 74].

Die moskitoziden Stämme werden je nach Ausmaß der Toxizität in zwei Gruppen unterteilt.

Die stark giftigen Stämme produzieren während der Sporulation ein aus zwei

Proteinkomponenten bestehendes Toxin, das als binäres Toxin (BTX oder Bin) bezeichnet

wird. Die beiden Proteine der molekularen Massen von 51 und 42 kDa werden in äquimolaren

Mengen gebildet und lagern sich zu einem Kristall zusammen, der von einer Hülle umgeben

ist. Im Darm von Moskitolarven lösen sich die Toxinkristalle auf und die beiden

Komponenten werden von wirtseigenen Proteasen zu ihren aktiven Formen prozessiert. Der

molekulare Mechanismus, der die Toxizität vermittelt, ist bisher nicht charakterisiert [73, 74].

Die schwach toxischen Stämme besitzen keinen Kristall. Die meisten von ihnen produzieren

die MTX-Toxine, die ausschließlich in der vegetativen Phase gebildet werden. Die beiden

homologen Proteine MTX2 und MTX3 (31.8 und 35.8 kDa) sind weit verbreitet und weisen

Homologie zum für Säuger giftigen ε-Toxin aus Clostridium perfringens und zum Cytotoxin

23


1 Einleitung

aus Pseudomonas aeruginosa auf [75, 76]. Da diese Toxine eine Erhöhung der Membranpermeabilität

durch Porenbildung bewirken [77], wird eine ähnliche Funktionsweise auch für

MTX2 und MTX3 vermutet. MTX dagegen vermittelt seine toxische Wirkung durch ADP-

Ribosylierung.

1.3.3 Das moskitozide Toxin (MTX)

MTX ist ein 100-kDa-Protein, das erstmals aus dem schwach toxischen Bacillus subtilis

Stamm SS-II kloniert wurde [78], aber auch in vielen anderen Stämmen gebildet wird. Es

besteht aus einer mutmaßlichen N-terminalen Signalsequenz (AS 1-29), einer ADP-

Ribosyltransferasedomäne (AS 30-264) und einem C-Terminus, der Homologie zur

kohlenhydratbindenden Domäne von Ricin aufweist [79].

MTX wird während der vegetativen Wachstumsphase von Bacillus subtilis gebildet und ist

toxisch für Larven von Culex quinquefasciatus und Aedes aegypti [80]. Das Toxin wird im

Darm der Moskitolarven in ein 27 kDa schweres katalytisch aktives Fragment (Komponente

A) und ein 70 kDa großes, C-terminales Fragment (Komponente B) gespalten. Diese Spaltung

erfolgt am Aminosäurerest Phe264 und kann in vitro durch Prozessierung mittels

Chymotrypsin nach Phe264 oder Trypsin nach Lys262 imitiert werden [81, 82]. Die

katalytisch aktive A-Komponente (MTX 30-264 ) ist eine Arginin-spezifische ADP-Ribosyltransferase

und weist eine schwache Sequenzhomologie sowie eine hohe strukturelle Ähnlichkeit

zu anderen ARTs auf [83, 84]. Wie andere ARTs zeigt sie neben der ADP-Ribosyltransferaseaktivität

auch eine schwache NAD + -Glykohydrolaseaktivität. Die katalytisch aktiven

Aminosäurereste sind Glu195 und Glu197, wobei Glu195 nur Einfluss auf die Transferase-,

nicht aber auf die Hydrolaseaktivität hat, wie Mutationsstudien gezeigt haben [82]. Auf Grund

von Sequenzvergleichen und der Struktur der katalytischen Domäne von MTX lässt sich

dieses in die Gruppe der CT-ähnlichen ARTs einordnen, denn es besitzt ein ExE-Motiv, den

STS-Konsensus sowie das arom-Arg-Motiv [82, 83]. Das in vivo-Substrat von MTX ist nicht

bekannt, allerdings wird in pro- und eukaryotischen Zelllysaten eine Vielzahl von Proteinen

durch MTX modifiziert. Von diesen wurde bisher lediglich der Elongationsfaktor EF-Tu aus

Escherichia coli identifiziert. Die Modifikation von EF-Tu erklärt, warum die Expression der

katalytisch aktiven Komponente allein toxisch für E. coli ist: MTX ADP-ribosyliert ein

24


1.3 Das Moskitozide Toxin (MTX)

Arginin des Elongationsfaktors, verhindert damit die Ausbildung des ternären EF-Tu-GTP-

Aminoacyl-tRNA-Komplexes und inhibiert so die Proteinsynthese der Zelle [85].

Für die Toxizität von MTX für Moskitolarven ist der enzymatisch aktive Anteil allein

hingegen nicht ausreichend, sondern es wird zusätzlich die C-terminale B-Komponente

benötigt. Der C-Terminus besteht aus zwölf Wiederholungen des QxW-Motivs, die in vier

Einheiten zu drei Wiederholungen angeordnet sind. Die Homologie zu den zuckerbindenden

Domänen von Ricin und anderen Lektin-haltigen Proteinen lässt für die B-Komponente eine

zellbindende Funktion vermuten. Da die katalytische Domäne ein breites Substratspektrum

besitzt, wird spekuliert, dass die zellbindende Komponente für die Spezifität der Toxizität

verantwortlich ist [79]. Über den Aufnahmemechanismus ist nichts bekannt, allerdings wird

auf Grund der geringen Anzahl von nur drei Lysinen in der katalytischen Domäne über die

Möglichkeit des retrograden Transports für MTX spekuliert [69].

Das QxW-Motiv

Das QxW-Motiv wurde erstmals im pflanzlichen Toxin Ricin aus dem Wunderbaum (Ricinus

communis) gefunden. Ricin besteht aus einer katalytischen Domäne (Ricin A), die Ribosomen

durch N-Glykosylierung inaktiviert, und einer über eine Disulfidbrücke kovalent verknüpften

kohlenhydratbindenden Kette (Ricin B). Die B-Kette besteht aus zwei zuckerbindenden

Domänen, und jede dieser Lektindomänen besteht wiederum aus 3 Kopien eines

ursprünglichen, zuckerbindenden Peptids von ca. 40 Aminosäureresten (α, β und γ), die über

einen Linker λ miteinander verbunden sind. Trotz relativ geringer Sequenzhomologie zeigen

die Peptide α, β und γ eine homologe Struktur und werden auf Grund der konservierten

Aminosäurereste als QxW-Motiv bezeichnet. Die Struktur einer Lektin- oder (QxW) 3 -

Domäne besitzt eine pseudo-dreizählige Symmetrie um einen hydrophoben Kern, zu dem

jedes QxW-Motiv ein Tryptophan und zwei andere hydrophobe Aminosäurereste beiträgt. Die

Lektindomäne besitzt nur wenige Sekundärstrukturelemente, die durch lange Loops

miteinander verbunden sind. Jede Domäne besitzt zudem zwei Disulfidbrücken. Obwohl

theoretisch jede QxW-Kopie Kohlenhydrate binden können sollte, finden sich in der

Ricinstruktur nur zwei Bindestellen in den Segmenten 1α und 2γ. Die Bindetaschen zeichnen

sich durch einen drei Aminosäurereste langen Knick aus, der den Boden bildet, einer

aromatischen Aminosäure, die den Deckel bildet und durch stacking-Kräfte Galaktose bindet,

25


1 Einleitung

sowie mehreren polaren Resten, die den Zucker durch Wasserstoffbrücken binden [86-89].

Das QxW-Motiv tritt auch in zahlreichen anderen zuckerbindenden Proteinen auf [86].

Autoinhibitorische Wirkung des C-Terminus

Nach der Spaltung des Toxins in seine beiden Komponenten lassen sich diese in vitro nur

durch denaturierende Methoden voneinander trennen, und die Art und Weise, wie sich die

katalytische Einheit vom C-Terminus in vivo löst, ist ebenso unklar wie die Frage nach dem

Aufnahmemechanismus [82].

Der C-Terminus hat neben der zellbindenden Funktion auch eine autoinhibitorische Wirkung,

die auf zwei Weisen vermittelt wird. Zum einen belegt im Holotoxin der Linker zwischen der

katalytischen und der B-Komponente (AS 265-285) die NAD + -Bindestelle im aktiven

Zentrum und verhindert so die Bindung von NAD + . Für diese Hemmung der Aktivität sind

vor allem die sauren Aminosäurereste, insbesondere Asp273 und Asp275 verantwortlich. Der

C-Terminus erhöht die Wirkung des Linkers um zwei Größenordnungen. Wird das Holotoxin

um das letzte QxW-Motiv (AS 840-870) verkürzt, so wird diese Verstärkung der Inhibition

stark vermindert und bei Deletion der ganzen letzten (QxW) 3 -Domäne sogar völlig

aufgehoben. Gleichzeitig mit der hemmenden Wirkung wird auch die Interaktion zwischen

den Fragmenten verringert. Neben dieser kompetitiven Inhibition wurde aber auch eine

nichtkompetitive Inhibition durch den äußersten C-Terminus festgestellt, der allerdings keine

komplett hemmende Wirkung besitzt. Die genaue Wirkungsweise dieser allosterischen

Inhibition ist bisher nicht geklärt [90].

Sequenzhomologie zu Pierisin

Die einzigen bekannten Proteine mit einer guten Sequenzhomologie zu MTX sind Pierisin-1

aus Pieris rapae und Pierisin-2 aus Pieris brassica (30% bzw. 31% Identität), die

untereinander eine Sequenzidentität von 90% besitzen. Piersisin-1 (98 kDa) ist ein in

menschlichen Zellen Apoptose-induzierendes Toxin, das DNA ADP-ribosyliert.

Interessanterweise ist die Auslösung der Apoptose unabhängig von den bekannten

Signaltransduktionswegen über p53, TNF-α oder Fas-Ligand. Auch Piersin-1 besitzt zwölf

QxW-Motive und bindet mit diesen die endständigen Galaktoseeinheiten der neutralen

Glykosphingolipide Gb3 und Gb4 [91, 92].

26


1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

1.4.1 Der Abbau von Nikotin durch Arthrobacter nicotinovorans

Arthrobacter nicotinovorans ist ein Gram-positives, aerobes Bodenbakterium, das die

Fähigkeit besitzt, Nikotin als einzige Kohlenstoff-, Stickstoff- und Energiequelle zu nutzen

[93]. Das früher unter dem Namen Arthrobacter oxidans bekannte Bakterium gehört zur

Gruppe der coryneformen Bakterien. Der Abbauweg von Nikotin ist in diesem Organismus

sehr gut untersucht. Alle am Abbau beteiligten Enzyme sind auf dem katabolischen 160 kb

Plasmid pAO1 lokalisiert [94]. Sie befinden sich in einem ca. 28 kb langen Gencluster, das

neben dem ORF einer verkürzten Transposase liegt und daher von Arthrobacter

nicotinovorans durch Gentransfer erworben worden sein könnte [95]. Dieser nic-Cluster

beinhaltet alle bekannten Enzyme für den Nikotinabbau sowie einige ORFs, die für bisher

unbekannte Enzyme codieren könnten. Zudem befinden sich in seiner Nachbarschaft Gene für

die Biosynthese benötigter Cofaktoren, wie z. B. für den Molybdän-Cytosin-

Dinukleotidcofaktor der Nikotindehydrogenase und der Ketondehydrogenase. Die Gene

werden nur in Gegenwart von Nikotin exprimiert, was ihre Kontrolle durch ein Nikotin-

Regulon nahe legt [95, 96].

Nikotin ist ein Alkaloid der Tabakpflanze und liegt in dieser überwiegend in der L-Form, aber

auch zu einem kleinen Anteil in der D-Form (0.5%) vor [96]. Es kann bis zu 3% der

Trockenmasse der Blätter ausmachen und dient der Abwehr von Fressfeinden. Menschen

nehmen Nikotin durch den Konsum tabakhaltiger Genussmittel, vor allem durch Rauchen,

auf. Dabei ist Nikotin für den Menschen nicht nur ein Xenobiotikum, sondern es besitzt durch

die Beeinflussung des zentralen Nervensystems auch eine addiktive Wirkung. Nikotin ist

zwar nicht die Ursache für die meisten durch Tabakgenuss verursachten Krankheiten, aber

seine abhängig machende Wirkung ist der Grund für den fortlaufenden Konsum von

Tabakprodukten, der wiederum mit der Aufnahme zahlreicher Kanzerogene und anderer

bioaktiver Substanzen verbunden ist. Der Genuss von Tabak ist der maßgebliche Grund für

einen vorzeitigen Tod in den Industriestaaten sowie die mit Abstand am besten vermeidbare

Ursache für tödliche Krebserkrankungen. Nikotin wird im menschlichen Körper auf

verschiedene Weise abgebaut [97]. Neben seiner gesundheitsschädlichen und addiktiven

Wirkung auf den Menschen birgt Nikotin auch ein Risiko für die Umwelt. Durch die

27


1 Einleitung

Tabakproduktion fallen jährlich etwa 2 Millionen Tonnen Abfall an, davon 300'000 Tonnen

nikotinhaltig. Ab 500 mg Nikotin/kg gilt der Abfall als toxisch und gefährlich und muss

entgiftet werden – der Abfall, der bei der Tabakproduktion entsteht, enthält durchschnittlich

18 g Nikotin/kg [98]. Das Interesse der Tabakindustrie an nikotinabbauenden Organismen ist

daher groß. Zudem wird der Einsatz von nikotinabbauenden Organismen oder ihrer Enzyme

in Nikotinfiltern und Nikotinsensoren diskutiert [96]. Neben Arthrobacter und Pseudomonas

können auch einige Bacillus-Spezies sowie Achromobacter nicotinophagum, Microsporum

gypseum und auch einige Pilze Nikotin abbauen [96].

Der Abbau von Nikotin durch Arthrobacter nicotinovorans ist in Abbildung 1.4.1 dargestellt.

Nikotin wird zunächst am C6-Atom des Pyridinrings durch die Nikotindehydrogenase (NDH)

hydroxyliert. Dieses Enzym enthält einen Molybdäncofaktor in der großen α-Untereinheit, ein

nicht kovalent gebundenes FAD in der mittleren β-Untereinheit und zwei Eisen-

Schwefelzentren in der kleinen γ-Untereinheit. Das Enzym hat eine (αβγ) 2 -Anordnung und ist

nicht stereoselektiv [95, 96].

Im zweiten Schritt wird das entstandene 6-Hydroxy-L-Nikotin durch die 6-Hydroxy-L-

Nikotin-Oxidase (6HLNO) weiter oxidiert und das entstandene 6-Hydroxy-N-

Methylmyosmin wandelt sich durch Addition von Wasser spontan in

6-Hydroxypseudooxynikotin um. 6HLNO ist ein stereoselektives, dimeres Flavoprotein und

gehört zur Familie der Aminoxidasen. Das Enantiomer 6-Hydroxy-D-Nikotin wird durch die

6-Hydroxy-D-Nikotinoxidase (6HDNO) oxidiert. Die monomere, FAD-haltige 6HDNO ist

nicht verwandt mit der 6HLNO, sondern gehört zur Familie der Vanillyloxidasen. Ihre genaue

Bedeutung ist umstritten, da D-Nikotin in der Pflanze nur in geringem Maße vorkommt.

Allerdings kann sich der Anteil von D- gegenüber L-Nikotin durch Hitze und Verwesung bis

auf 10% erhöhen. Das Gen für die 6HDNO gehört zwar nicht zum nic-Cluster, ist aber ganz

in der Nähe lokalisiert. Zudem wurde bis heute kein anderes natürliches Substrat gefunden

[95, 96].

28


1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

H

N

CH 3

N

L-Nikotin

NDH

H

N

Abbildung 1.4.1 Abbauweg von L-Nikotin in Arthrobacter

nicotinovorans [96]

NDH: Nikotindehydrogenase

6HLNO: 6-Hydroxy-L-Nikotinoxidase

KDH: Ketondehydrogenase

DHPONH: 2,6-Dihydroxypseudooxynikotinhydrolase

MABO: γ-N-Methylaminobutyratoxidase

DHPH: 2,6-Dihydroxypyridin-3-Hydroxylase

CH 3

HO N

6-Hydroxy-L-Nikotin

6HLNO

HO N

N

CH 3

6-Hydroxy-N-methylmyosmin

+H 2

O

O

CH 3

NH

HO N

6-Hydroxypseudooxynikotin

KDH

O

CH 3

NH

HO

N

OH

2,6-Dihydroxypseudooxynikotin

DHPONH

HO

HO

O

O

CH 3

NH

γ-N-Methylaminobutyrat

MABO

NH 2

γ-N-Aminobutyrat (GABA)

HO

N

OH

2,6-Dihydroxypyridin

DHPH

OH H O 2

N

O

HO

N OH spontan

N

H

HO O

2,3,6-Trihydroxypyridin

blaues Pigment

O

OH

O

?

29


1 Einleitung

Im nächsten Schritt wird 6-Hydroxypseudooxynikotin durch die Ketondehydrogenase (KDH)

an Position 2 hydroxyliert. Dieses Enzym ist verwandt zur NDH [95, 96]. Das entstandene

2,6-Dihydroxypseudooxynikotin (DHPON) wird anschließend durch die erst kürzlich

identifizierte 2,6-Dihydroxypseudooxynikotinhydrolase (DHPONH) in 2,6-Dihydroxypyridin

(2,6-DHP) und γ-N-Methylaminobutyrat gespalten. DHPONH gehört zur Familie der

α/β-Hydrolasen und spaltet die C-C-Bindung durch Addition von Wasser [96, 99, 100].

γ-N-Methylaminobutyrat wird durch die γ-N-Methylaminobutyratoxidase (MABO) in

γ-Aminobutyrat (GABA) umgewandelt. Das Gen für die MABO gehört dem nic-Cluster nicht

mehr an, sondern ist upstream davon lokalisiert. Der weitere Abbauweg von GABA ist bisher

nicht geklärt [96, 101].

2,6-Dihydroxypyridin wird durch die 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH) weiter

oxidiert. Das entstehende 2,3,6-Trihydroxypyridin dimerisiert in Gegenwart von Sauerstoff

spontan zum „blauen Pigment“. Flüssige Arthrobacter nicotinovorans-Kulturen, die mit

Nikotin wachsen, färben sich blau. Allerdings gibt es auch ein Enzym, das 2,3,6-

Trihydroxypyridin spaltet, so dass kein blaues Pigment entsteht. Dieses Enzym konnte jedoch

bisher nicht genauer identifiziert werden [95, 96].

1.4.2 Die 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH) aus Arthrobacter

nicotinovorans

DHPH wurde erstmals durch Holmes & Rittenberg 1972 identifiziert und teilweise gereinigt

[102, 103]. Sie identifizierten 2,6-Dihydroxypyridin (2,6-DHP) und 2,3,6-Trihydroxypyridin

(2,3,6-THP) als Zwischenprodukte des Nikotinabbaus und konnten die Reaktion auf ein FADhaltiges

Enzym mit NADH-Abhängigkeit zurückführen. Das teilweise isolierte Enzym zeigt

die Eigenschaften einer Monooxygenase und katalysiert die Reaktion

2,6-DHP + NADH + H + + O 2

2,3,6-THP + NAD + + H 2 O

Das aus Arthrobacter nicotinovorans isolierte Enzym erwies sich als relativ instabil, die

Aktivität ließ sich aber durch Zugabe von Glycerin stabilisieren [102, 103].

30


1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Nach Identifikation des Genes dhph als Teil des nic-Clusters auf pAO1 konnte das Protein

rekombinant als Polyhistidinfusionsprotein in E. coli produziert, mittels Affinitätschromatographie

gereinigt und ohne Aktivitätsverlust bei 4°C gelagert werden. Die Aktivität

des Polyhistidinfusionsproteins entsprach dabei der des Proteins ohne Affinitätstag. DHPH ist

ein Dimer (2 x 397 Aminosäurereste) mit einem fest, aber nicht kovalent gebundenen FAD

pro Monomer [95]. Die Reaktion des rekombinanten Proteins ist strikt NADH-abhängig [95],

während für das endogene Enzym nur eine Präferenz für NADH gegenüber NADPH

gefunden wurde [102]. DHPH ist außerdem hochspezifisch für sein Substrat,

2,3-Dihydroxypyridin und 2,6-Dimethoxypyridin wirken als Inhibitoren [95].

1.4.3 Externe Flavin-Monooxygenasen

Durch Sequenzvergleiche lässt sich DHPH in die Gruppe der externen Flavin-

Monooxygenasen einordnen. Monooxygenasen (EC 1.13 und EC 1.14) inserieren ein

Sauerstoffatom in organische Verbindungen. Die Reaktionen sind im Allgemeinen sehr

spezifisch. Da eine solche Reaktion auf rein chemischem Weg nicht oder nur schwer

durchgeführt werden kann, sind Monooxygenasen von großem Interesse für synthetische

Zwecke [104].

Zu den Monooxygenasen zählen hämhaltige Enzyme (Cytochrom P450 Monooxygenasen),

Nicht-Häm-Monooxygenasen, kupferhaltige Monooxygenasen und Flavin-Monooxygenasen.

In den letzten Jahren wurden außerdem einige Monooxygenasen gefunden, die keinen der

genannten Cofaktoren nutzen [104].

Flavin-Monooxygenasen stellen eine der größten und wahrscheinlich die am weitesten

verbreitete Gruppe der Monooxygenasen dar. Sie lassen sich in interne und externe Flavin-

Monooxygenasen sowie flavinabhängige Monooxygenasen unterteilen. Bei den

flavinabhängigen Monooxygenasen ist das Flavin nicht an der Sauerstoffinkorporation

beteiligt, sondern dient lediglich der Oxidation des Substrates. Das Sauerstoffatom stammt

aus Wasser, und das Flavin wird durch andere Elektronenakzeptoren wie Cytochrom c oder

molekularen Sauerstoff reoxidiert. Zu dieser Gruppe gehören beispielsweise die

Vanillylalkoholoxidase und die p-Cresolmethylhydroxylase. Flavin-Monooxygenasen nutzen

31


1 Einleitung

molekularen Sauerstoff als Substrat und bauen eines der beiden Atome in das organische

Substrat, das zweite in Wasser ein. Da die Reaktion zwischen molekularem Sauerstoff und

dem Kohlenstoff organischer Verbindungen spinverboten ist, muss der Sauerstoff zunächst

aktiviert werden. Dazu gibt das in der reduzierten Form vorliegende Flavin ein Elektron an

den Sauerstoff ab, so dass ein Superoxid- und ein Flavinradikal entstehen. Durch Spinumkehr

im Superoxid kommt es zur Ausformung eines kovalenten Addukts zwischen dem C 4a des

Flavinmoleküls und dem Superoxidradikal. Das entstandene C 4a -Hydroperoxyflavin ist

hochreaktiv und kann je nach Protonierungsstatus einen nukleophilen oder elektrophilen

Angriff auf das Substrat ausüben.

Die Reduktion des Flavins erfolgt bei externen Monooxygenasen durch die Coenzyme NADH

oder NADPH (Abbildung 1.4.2). Bei den sehr viel selteneren internen Monooxygenasen wird

das Flavin durch das Substrat selbst wieder reduziert. Bei allen bisher bekannten externen und

internen Monooxygenasen ist der Cofaktor nichtkovalent gebunden, während bei den

flavinabhängigen Monooxygenasen auch eine kovalente Bindung des Flavins durch

beispielsweise Histidin oder Tyrosin möglich ist [104].

R

R

R

O 2

H 3

C N N O

H 3

C N N O H C N N O

+H + 3

NH

NH

NH

H 3

C N

H C N

H

3

-H + H C N

H

3

O

H O

O

O

O

NAD(P) + nucleophile

elektrophile

Oxygenierung

Oxygenierung

NAD(P)H

H 3

C N N O

H 3

C N N O

NH

NH

H 3

C N

H 3

C N

H OH

O

H 2

O

O

O

OH

reduziertes Flavin Peroxyflavin Hydroperoxyflavin

Substrat X, H +

Substrat X

XO

XO

R

R

oxidiertes Flavin

Hydroxyflavin

Abbildung 1.4.2 Reaktionsmechanismus der externen Flavin-Monooxygenasen [104]

32


1.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Tabelle 1.4.1 Übersicht über die Untergruppen der externen Flavin-Monooxygenasen [104]

A

Prototyp

4-Hydroxybenzoat-3-Hydroxylase

(EC 1.14.13.2 und 1.14.13.33 )

UE 1

α

Katalysierte

Reaktionen

Hydroxylierung

Epoxidierung

Substrat

Aromaten mit aktivierender

Hydroxyl- oder Aminogruppe

Cofaktor

FAD

B

Cyclohexanonmonooxygenase

(EC 1.14.13.22)

α

Baeyer-Villiger

N-Oxidation

Oxidation von C- und anderen

(Hetero-) Atomen

FAD

C

Luciferase (EC 1.14.14.3)

α + β

S-Oxidation

Lichtemission

Baeyer-Villiger

Alkansulfonate, langkettige

aliphatische Aldehyde, u.a.

D

4-OH-Phenylacetathydroxylase

(EC 1.14.13.34)

α + β

Hydroxylierung

Aromaten mit aktivierender

Hydroxyl- oder Aminogruppe

E Styrenmonooxygenase

α + β Epoxidierung Styrol

F Tryptophan-7-Halogenase α + β Halogenierung Tryptophan

1 Untereinheiten (UE): Untereinheit α entspricht einer Monooxygenase, Untereinheit β einer Reduktase

Coenzym

NAD(P)H

NADPH

FMN

NAD(P)H

FAD

NAD(P)H

FAD

NAD(P)H

FAD

NAD(P)H

Strukturelle Daten

eine dinukleotidbindende

Domäne mit Rossmann-

Faltung

zwei dinukleotidbindende

Domänen mit Rossmann-

Faltung

Monooxygenaseuntereinheit

mit TIM-Barrel-Faltung

zusätzlich Reduktase

keine bekannt

keine bekannt

eine dinukleotidbindende

Domäne mit Rossmann-

Faltung sowie eine helikale

Domäne

33


1 Einleitung

Die externen Flavin-Monooxygenasen lassen sich anhand von Sequenz- und Strukturdaten in

sechs verschiedene Untergruppen einteilen (Tabelle 1.4.1) [104]. Je nach Typ wird die

Flavineinheit in der Monooxygenase selbst reduziert und stellt einen fest gebundenen

Flavincofaktor dar (Gruppen A und B), oder das Flavin wird von einer externen Reduktase

reduziert und erst dann von der Monooxygenase gebunden (Gruppen C-F). Die katalysierte

Reaktion hängt von der Mikroumgebung des Flavins in der Monooxygenase ab, also z. B.

vom Protonierungsstatus des aktivierten Flavins. Auch die Substratspezifität wird von den

Aminosäureresten im aktiven Zentrum bestimmt [104].

Flavoprotein-Hydroxylasen der Gruppe A sind durch drei fingerprint-Motive gekennzeichnet.

Die N-terminale GxGxxG-Sequenz deutet auf eine βαβ-Faltung (Rossmann-Faltung) hin und

bindet die ADP-Einheit von FAD. Weiterhin wird die Riboseeinheit des Flavins am O3’

durch das hochkonservierte Aspartat des GD-Motivs (GDAAH) gebunden. Ein drittes Motiv,

das DG-Motiv, ist an der Bindung der Phosphateinheiten sowohl von FAD als auch von

NAD(P)H beteiligt. Interessanterweise besitzen diese Flavin-Monooxygenasen keine

NAD(P)H-Bindedomäne, da NAD(P)H nur einen transienten Komplex mit dem Enzym bildet

[104, 105].

DHPH zeigt Ähnlichkeiten zur Salicylathydroxylase und ist damit in die Gruppe A der

externen Flavin-Monooxygenasen einzuteilen. Allerdings zeigt sie Abweichungen in allen

drei fingerprint-Motiven. Das GxGxxG-Motiv lautet bei DHPH GxSxxG, und im GD-Motiv

wird Histidin durch Valin ersetzt. Im DG-Motiv, dessen Sequenz in der Salicylathydroxylase

und der ebenfalls verwandten para-Hydroxybenzoat-3-Hydroxylase DxxxGxDGxK lautet,

findet ein Austausch von zwei geladenen Aminosäureresten gegen eine ungeladene polare

(DN) und eine ungeladene hydrophobe (KA) Aminosäure statt. In beiden verwandten

Enzymen ist Lysin bzw. Histidin wichtig für die Bindung von NAD(P)H. Trotz dieser

Unterschiede besitzt DHPH einen fest gebundenen FAD-Cofaktor [95].

34


1.5 Ziele der Arbeit

1.5 Ziele der Arbeit

Die Röntgenkristallographie ist noch immer die wichtigste Methode zur Aufklärung der

atomaren Struktur von biologischen Makromolekülen. Mit Hilfe dieser Technik sollten zum

einen Informationen über die atomare Beschaffenheit von Proteinkontakten gewonnen

werden, zum anderen sollten die Strukturen von biologisch interessanten Proteinen ermittelt

werden.

Die spezifische Interaktion zwischen Poteinmolekülen ist essentiell für viele biochemische

Prozesse in der Zelle. Ihr Verständnis auf atomarer Ebene ist daher von grundlegendem

Interesse. Für die Untersuchung von Protein-Protein-Interaktionen sollten künstliche

Proteinkontakte geschaffen und detailliert untersucht werden. Dabei sollten Informationen

darüber gewonnen werden, ob eine solche de novo Kontaktbildung detailliert geplant werden

kann, welche Aminosäurereste sich für die Herstellung eines künstlichen Kontakts eignen,

welche weiteren Kriterien für die erfolgreiche Planung ausschlaggebend sind und welche

Eigenschaften eventuell gewonnene Kontaktflächen aufweisen. Zu diesem Zweck sollte

versucht werden, aus dem dimeren Enzym Urocanase eine oder mehrere tetramere Formen

herzustellen.

Peroxisomen sind essentiell wichtige Zellorganellen, deren Biogenese sich von der

Entstehung anderer Zellorganellen unterscheidet. Während der Eintransport von

Matrixproteinen relativ gut verstanden ist, ist über den Import der Membranproteine nur

wenig bekannt. PEX3 und PEX19 sind an den ersten Schritten der Peroxisomenbiogenese

beteiligt und daher von besonderem Interesse. Da von keinem der beiden Proteine

Strukturinformationen vorhanden sind, sollte versucht werden, die Struktur der beiden

Peroxine aufzuklären. Weiterhin wäre es von großem Interesse, die Struktur des Komplexes

von PEX3 und PEX19 lösen.

Das bakterielle Toxin MTX besteht aus einer ADP-Ribosyltransferasedomäne und vier

potentiellen ricinähnlichen Domänen, die vermutlich für die Zellbindung verantwortlich sind

und die zusätzliche eine autoinhibitorische Wirkung besitzen. Die Struktur der katalytischen

Domäne war von D. Reinert [84] gelöst worden. In der hier vorliegenden Arbeit sollte die

Struktur des Holotoxins in Zusammenarbeit mit dem Arbeitskreis Aktories (Institut für

35


1 Einleitung

Experimentelle und Klinische Pharmakologie und Toxikologie, Albert-Ludwigs-Universität,

Freiburg) bestimmt werden und die Funktionsweise des C-Terminus anhand der Struktur

erklärt werden.

2,6-Dihydroxypyridin-3-Hydroxylase ist am bakteriellen Abbau von Nikotin beteiligt und

daher von großem biotechnologischen Interesse. Die Struktur des Enzyms sollte bestimmt

werden, um Erkenntnisse über die Cofaktorbindung, die Substratbindung und den

Katalysemechanismus zu gewinnen.

36


2.1 Geräte und Chemikalien

2 Materialien

2.1 Geräte und Chemikalien

Allgemein

Pipetten 2 µL, 20 µL, 200 µL, 1000 µL und 5000 µL

Multipetten Research Pro 10 / 100

Reinwasseranlage Milli-Q Gradient

Wasserbad K4

Zentrifugen 5415 C, 5804 R und 5417 R

Vortex REAX 2000

Waagen AE 240 und PE 3600

Photometer PR 2210

pH-Elektrode IJ44/Meteo

Küvetten K-Küvetten 407 1/1 und UVette 220-1600 nm

Gilson

Eppendorf

Millipore

Electronic MGW Lauda

Eppendorf

Heidolph

Mettler

Eppendorf

GAT

Eppendorf

Molekularbiologische Arbeiten

Agarosegelelektrophorese- Kammer GNA 100

Thermocycler PTC-200

Thermal Cycler

GE Healthcare

Peltier

MJ-Research

Proteinpräparation

Brutschrank Innova 4230

Bakterienschüttler KS 125 und KS 250

Dampfsterilisator Varioklav 500 EV

Filtropur Sterilfilter 0.2 µm, steril

Filtropur Sterilfilter 0.45 µm, steril

MF TM membrane filters, 0.45 µm HA

Ultraschallgenerator Modell 7100

Ultraschallbad Sonorex RK 106

Zentrifugen RC-2B; RC-5B

French-Pressure Cell SIM AMICO

Zentrifugal-Konzentratoren Vivaspin 15 mL, 5 mL und 0.5 mL

Dialyse-Schläuche (MWCO 14’000)

DLS-Apparatur Dyna Pro-801

Software Dyna Pro-801,Version 5.25.44, April 2000

New Brunswick Scientific

IKA Labortechnik

H & P Labortechnik

Sarstedt

Sarstedt

Millipore

Measuring & Scientific Equipment

Super Bandelin

DuPont

Spectronic Instruments

Vivascience

Roth

Protein Solutions

Protein Solutions

PAGE

Elektrophorese-Apparatur Mini-Protean II

Biometra Power Pack P25T

Geltrockenrahmen

BioRad

Biometra

Eigenbau Institutswerkstatt

37


2 Materialien

Chromatographie

ÄKTA Purifier 100

ÄKTA Explorer 100

ÄKTA Prime

Software Unicorn Version 3.00 und 3.10.11

PrimeView 1.0

Schlauchpumpe ISM321A Ismatec

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

Säulen/-materialien

HiLoad 26/60 Superdex 200 prep grade Säule I und II

HiLoad 26/60 Superdex 75 prep grade

HiLoad 16/60 Superdex 200 prep grade

MonoQ 5/5

Resource-S 6 mL

Q-Sepharose Fast Flow

HiTrap Chelating HP 5 mL

Chelating Sepharose HP

GSTrap 5mL

Profinity IMAC resin

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

GE Healthcare

BioRad

Elektroblotten und Proteinsequenzierung

Netzgerät Power Supply ECPS 3000/150

blotting-Apparatur Fastblot 150 L

Filterpapier Whatman Paper

PVDF-Membran Fluorbind

Sequenator Protein-Sequenzer 477A

GE Healthcare

Biometra

Whatman

Serva

Applied Biosystem

Kristallisation

Deckgläser ∅ 21 mm, Stärke 2

Kristallisationsboxen Linbro-Kultur-Boxen

Crystal Clear Strips, 96er

Mikroskope Stemi 2000

Laborlux-12 POL S

Temperierschränke Wine-cooler

Kristallaufnahmen Cammedia C-3030 Zoom

Hecht-Assistent

Flow Laboratories

Hampton Research

Zeiss

Leitz

Bosch

Olympus

Röntgenographische Methoden

cryo-loops 0.1-1.0 mm

Hampton Research

Kristallisationskits

Crystal Screen I/II TM

Crystal Screen lite TM

Membrane Factory

Index Screen

Crystal Screen Cryo

Wizard Screen I/II

Wizard Cryo I/II

Hampton Research

Hampton Research

Hampton Research

Hampton Research

Hampton Research

Emerald Biostructures

Emerald Biostructures

38


2.1 Geräte und Chemikalien

JB Screen (JBS) 1-10

Detergent Screen I-III

Additive Screen

Crystallization Basic Kit

Crystallization Extension Kit

Jena Bioscience

Hampton Research

Hampton Research

Sigma

Sigma

Chemikalien

Gängige Laborchemikalien wurden von den Firmen Fluka, Merck, Roth oder Serva bezogen und sind hier nicht

aufgeführt. Soweit nicht anders beschrieben, wurden alle Chemikalien mit Reinheitsgrad p.a. verwendet.

Acrylamid, research grade

Agar-Agar

Agarose, research grade

low-melting Agarose

Aminosäuren

Ampicillin, Natriumsalz

APS (Ammoniumperoxodisulfat)

Bromphenolblau

C8E4 (Octyltetraoxyethylen)

Casein Pepton (Pepton 140)

Chloramphenicol

Coomassie Brilliant Blue R-250

DDM (n-Dodecyl-β-D-maltosid)

2,6-DHP (2,6-Dihydroxypyridin)

2,3-DHP (2,3-Dihydroxypyridin)

2,6-DMP (2,6-Dimethoxypyridin)

DNA-Längenstandard (λ-Marker, BstE II-geschnitten)

DNA-Längenstandard, kb-Leiter

DTT (Dithiothreitol)

EDTA, Dinatrium-Salz (Ethyldiamintetraacetat)

Ethidiumbromid

GSH (Glutathion)

Glycerin

Hefeextrakt

HEPES (2-(4-(2-Hydroxyethyl)- 1-piperazinyl)- ethansulfonsäure)

Imidazol

IPTG (Isopropyl-β-D-thiogalactopyranosid), biotechnical grade

LDAO (Lauryldimethylamin-N-oxid)

LMW-Längenstandard

β-ME (β-Mercaptoethanol)

MES (2-(N-Morpholino)ethansulfonsäure)

N,N'-Methylenbisacrylamid, research grade

MPD (Methylpentandiol)

NAD + (Nicotinamidadenindinukleotid, oxidiert)

NADH (Nicotinamidadenindinukleotid, reduziert)

dNTPs, je 10 mM (Desoxynukleosidtriphosphat)

β-OG (n-Octyl-β-D-glucopyranosid)

PEG- (Polyethylenglycol-) 400, 4000, 6000, 8000, 20000

Pepton primatone

PMSF (Phenylmethylsulfonylfluorid)

SDS (Sodiumdodecylsulfat)

Silikonisierlösung

Tetracyclin

TCEP (Tris-2-Carboxyethylphosphin-Hydrochlorid)

TEMED (N,N,N',N'-Tetramethylethylenediamine)

Tris (Tris(hydroxymethyl)-aminomethan)

Triton X-100

Fluka

Gibco

Fluka

Hampton Research

Sigma

Sigma und Gerbu

Merck

Serva

Bachem

Gibco

Fluka

Serva

Gerbu

AK Brandsch, Freiburg

AK Brandsch, Freiburg

AK Brandsch, Freiburg

New England Biolabs

Fermentas

Gerbu

Gerbu

Merck

Serva

Serva

Gibco

Gerbu

AppliChem

Gerbu

Fluka

GE Healthcare

Serva

Fluka

Serva

Fluka

Gerbu

Gerbu

Fermentas

Glycon

Fluka

Sigma

Serva

Fluka

Serva

Fluka

Fluka

Merck

Fluka und Merck

Serva

39


2 Materialien

Enzyme

Benzonase (250 U/µL)

Thrombin lyophilisiert

Restriktionsenzyme (10 U/µL)

Pfu-Polymerase (2.5 U/µL), 10xPuffer + MgSO 4

CIAP (calf intestine alkaline phosphatase, 1 U/µL)

Polynukleotidkinase (10 U/µL)

TEV-Protease

Merck

GE Heathcare

Fermentas

Fermentas

Fermentas

New England Biolabs

eigene Reinigung, Abschnitt 3.4.7 und

Anhang V

Kits

QIAquick ® PCR Purification Kit

QIAquick ® Gel Extraction Kit

E.Z.N.A. ® Plasmid Miniprep Kit II

QIAGEN ® Plasmid Midi Kit

Rapid DNA ® Ligation Kit

QuikChange TM Site Directed Mutagenesis Kit

FoldIt

Qiagen

Qiagen

PeqLab

Qiagen

Fermentas

Stratagene

Hampton Research

2.2 Vektoren

Folgende Vektoren wurden für diese Arbeit eingesetzt:

pT7-7 Expressionsvektor GE Healthcare

pET32a Expressionsvektor mit N-terminalem Novagen

Thioredoxin- und Hexahistinrest

pGEX4T-1 Expressionsvektor für GST-Fusionsproteine GE Healthcare

pGEX.PEX19 pGEX4T-1 mit PEX19 AK Dodt, Tübingen

pGEM-T.PEX3 pGEM-T mit PEX3 AK Dodt, Tübingen

pColdI Kälteschock-induzierbarer Expressionsvektor TAKARA BIO

mit N-terminalem Polyhistidinrest

pColdIV Kälteschock-induzierbarer Expressionsvektor TAKARA BIO

pT7-7.URO pT7-7 mit Urocanase C198S AK Schulz, Freiburg

pH6EX3.DHPH Expressionsvektor für DHPH mit

AK Brandsch, Freiburg

N-terminalem Polyhistidinrest

pHis.TEV Expressionsvektor für TEV-Protease AK Grosschedl, Freiburg

mit Polyhistidinrest

40


2.2 Vektoren

Weiterhin wurden im Verlauf der Arbeit die folgenden Konstrukte hergestellt:

pT7-7.URO_HIS 8 Octahistidinrest am C-Terminus der Abschnitt 3.2.1

Urocanase C198S

pColdI.PEX19 pColdI mit PEX19 Abschnitt 3.2.5

pColdIV.PEX19 pColdIV mit PEX19 Abschnitt 3.2.5

pColdI.TEV_PEX19 pColdI.PEX19 mit TEV-Schnittstelle Abschnitt 3.2.6

vor PEX19

pColdI.TEV_PEX19 76-271 pColdI.PEX19 76-271 mit TEV-Schnittstelle Abschnitt 3.2.5

vor PEX19 76-271

pGEX.PEX3 pGEX4T-1 mit PEX3 Abschnitt 3.2.5

pT7-7.PEX3 pT7-7 mit PEX3 Abschnitt 3.2.5

pColdI.PEX3 pColdI mit PEX3 Abschnitt 3.2.5

pColdIV.PEX3 pColdIV mit PEX3 Abschnitt 3.2.5

pET32a.PEX3 pET32a mit PEX3 Abschnitt 3.2.5

pET32a.TEV_PEX3 pET32a.PEX3 mit TEV-Schnittstelle Abschnitt 3.2.6

vor PEX3

pET32a.PEX3 34-373 pET32a mit PEX3 34-373 Abschnitt 3.2.6

pET32a.TEV_PEX3 34-373 pET32a.PEX3 34-373 mit TEV-Schnittstelle Abschnitt 3.2.6

vor PEX3 34-373

pET32a.TEV_PEX3 26-373 pET32a mit PEX3 26-373 und TEV- Abschnitt 3.2.5

Schnittstelle vor PEX3 26-373

Weiterhin wurden zahlreiche Punktmutationen mittels der QuikChange TM -Methode eingeführt

(Abschnitt 3.2.1). Diese Punktmutationen werden in Klammern zum entsprechenden Gen

notiert.

Vektorkarten der hergestellten Konstrukte sind in Anhang I zu finden.

41


2 Materialien

2.3 Mikroorganismen und Medien

2.3.1 Escherichia coli-Stämme

Tabelle 2.3.1 Verwendete E. coli-Stämme und deren Resistenzen

Stamm Resistenzen Quelle

BL21

Invitrogen

BL21 (DE3)

Invitrogen

BL21 (DE3) Star

Invitrogen

BL21 (DE3) RIL Star Chloramphenicol Invitrogen

BL21 (DE3) pLysS Chloramphenicol Invitrogen

BL21 (DE3) pLysS Gold Chloramphenicol, Tetracyclin Invitrogen

Rosetta (DE3) Chloramphenicol Novagen

Rosetta (DE3) gami Chloramphenicol Novagen

Rosetta (DE3) gami pLysS Chloramphenicol Novagen

Rosetta (DE3) Star Chloramphenicol Novagen

B834 (DE3)

Novagen

XL1 blue

Stratagene

2.3.2 Medien und Festagarplatten

LB-Medium: 1.0% (w/v) NaCl, 0.5% (w/v) Hefeextrakt, 1.0% (w/v) Pepton, pH 7 - 8

TY-Medium: 0.5% (w/v) NaCl, 0.5% (w/v) Hefeextrakt, 0.8% (w/v) Pepton, pH 7 - 8

SOC-Medium: 0.5% (w/v) Hefeextrakt, 2% (w/v) Pepton, 5 mM NaCl, 2.5 mM KCl,

10 mM MgSO 4 , 20 mM Glukose, pH 7.0 (NaOH)

SB-Medium: 2.4% (w/v) Hefeextrakt, 1.2% (w/v) Pepton, 0.4% (v/v) Glycerin, 0.017 M

KH 2 PO 4 , 0.072 M K 2 HPO 4 , pH 7.0 - 7.5 (NaOH)

M9-Minimalmedium:

M9-Salz: 6.0 g/L Na 2 HPO 4 , 3.0 g/L KH 2 PO 4 , 0.5 g/L NH 4 Cl, 1.0 g/L NaCl, 1mM

MgSO 4 , pH 7.5 (NaOH) (autoklaviert)

Kohlenstoffquelle: 20% (w/v) Glukose, sterilfiltriert, 1:10 in M9-Medium eingesetzt

42


2.3 Mikroorganismen und Medien

Medienzusätze für M9:

(steril filtriert)

0.5 µg/L Thiamin

1 mM FeSO 4

100 mg/L L-Lysin

100 mg/L L-Phenylalanin

100 mg/L L-Threonin

50 mg/L L-Isoleucin

50 mg/L L-Leucin

50 mg/L L-Valin

100 mg/L L-Selenomethionin

LeMaster-Medium:

(autoklavierbarer Anteil)

0.50 g/L L-Alanin

0.58 g/L L-Arginin HCl

0.40 g/L L-Asparaginsäure

0.03 g/L L-Cystein

0.67 g/L L-Glutaminsäure

0.33 g/L L-Glutamin

0.54 g/L L-Glycin

0.06 g/L L-Histidin

0.23 g/L L-Isoleucin

0.23 g/L L-Leucin

0.42 g/L L-Lysin HCl

0.13 g/L L-Phenylalanin

0.10 g/L L-Prolin

2.08 g/L L-Serin

0.23 g/L L-Threonin

0.17 g/L L-Tyrosin

0.23 g/L L-Valin

0.50 g/L Adenin

0.67 g/L Guanin

0.17 g/L Thymin

0.50 g/L Uracil

1.50 g/L Natriumacetat

1.50 g/L Bernsteinsäure

0.75 g/L NH 4 Cl

1.08 g/L NaOH

10.5 g/L K 2 HPO 4

Zusätze nach Autoklavieren

pro L Medium

(steril filtriert)

30 µL Thiamin (100 mM)

1 mL MgSO 4 (1 M)

50 mL Glukose (20% (w/v))

150 µL FeSO 4·7 H 2 O (100 mM)

50 mg L-Selenomethionin

sowie Antibiotika nach Bedarf

Festagarplatten enthielten 1.5% (w/v) Agar.

Antibiotika wurden als Stammlösung laut Tabelle 2.3.2 angesetzt, steril filtriert und als 1:1000

Verdünnung eingesetzt.

Tabelle 2.3.2 Stammlösung von Antibiotika

Antibiotikum Konzentration Lösungsmittel

Ampicillin 100 mg/mL 50% (v/v) Ethanol

Chloramphenicol 34 mg/mL Ethanol

Tetracyclin 5 mg/mL Ethanol

43


3 Methoden

3 Methoden

3.1 Kultivierung von Bakterien

3.1.1 Bestimmung der optischen Dichte von Bakterienkulturen

Die optische Dichte von E. coli-Kulturen wurde mit einem Photometer bei 600 nm bestimmt.

3.1.2 Kultivierung für die Plasmidpräparation

Für eine Plasmidpräparation wurden 20 mL LB-Medium mit den entsprechenden Antibiotika

versehen, mit einer Kolonie des plasmidtragenden Bakteriums angeimpft und über Nacht bei

37°C geschüttelt. Die Bakterien wurden durch zehnminütige Zentrifugation (3000*g, 4°C)

geerntet. Wurden größere Mengen Plasmid benötigt, wurde ein 100-mL-Ansatz gewählt.

3.1.3 Kultivierung für die Proteinproduktion

Für die Proteinproduktion wurde direkt aus dem Transformationsansatz laut Tabelle 3.1.1 eine

Übernachtkultur hergestellt (Abschnitt 3.2.8) oder alternativ wie für die Plasmidpräparation

(Abschnitt 3.1.2) von der Festagarplatte angeimpft.

Tabelle 3.1.1 Übersicht über Expressionsplasmide und verwendete Stämme

Protein Plasmid E. coli-Stamm

Urocanase pT7-7.URO BL21 (DE3)

Urocanase als C-terminales Octahistidinfusionsprotein pT7-7.URO_HIS 8 BL21 (DE3)

DHPH als N-terminales Hexahistidinfusionsprotein pH6EX3.DHPH BL21 (DE3)

PEX19 als GST-Fusionsprotein

pGEX.PEX19

BL21 (DE3)

mit Thrombin-Schnittstelle

PEX19 als N-terminales Hexahistidinfusionsprotein pColdI.PEX19 BL21 (DE3)

mit Faktor Xa-Schnittstelle

PEX19 als N-terminales Hexahistidinfusionsprotein pColdI.TEV_PEX19 BL21 (DE3)

mit TEV-Schnittstelle

PEX19 76-271 als N-terminales Hexahistidinfusionsprotein pColdI.TEV_PEX19 76-271 BL21 (DE3)

mit TEV-Schnittstelle

PEX3 als Thioredoxinfusionsprotein mit Hexahistidintag pET32a.TEV_PEX3 Rosetta (DE3)

und TEV-Schnittstelle

PEX3 34-373 als Thioredoxinfusionsprotein mit Hexahistidintag pET32a.TEV_PEX3 34-373 Rosetta (DE3)

und TEV-Schnittstelle

PEX3 26-373 als Thioredoxinfusionsprotein mit Hexahistidintag pET32a.TEV_PEX3 26-373 Rosetta (DE3)

und TEV-Schnittstelle

TEV-Protease als Polyhistidinfusionsprotein pHis.TEV Rosetta (DE3)

44


3.1 Kultivierung von Bakterien

Urocanase

Urocanase wurde in E. coli BL21 (DE3) ohne Induktion produziert. Dazu wurde LB-Medium,

das zuvor mit Ampicillin und 25 mg/L NAD + komplementiert wurde, mit 300 µL/L Vorkultur

beimpft und für 13-15 h unter Schütteln bei 37°C inkubiert.

DHPH

Für die Produktion von DHPH in E. coli BL21 (DE3) wurde LB-Medium mit Ampicillin

versetzt, mit 10 mL/L Vorkultur angeimpft und bei 37°C bis zu einer OD 600 = 0.6 - 0.8

kultiviert. Die Bakterien wurden mit 1 mM IPTG induziert und bei 25°C über Nacht

geschüttelt.

PEX19 als GST-Fusionsprotein

Für die Produktion von GST-PEX19-Fusionsprotein in E. coli BL21 (DE3) wurde LB-

Medium mit Ampicillin versetzt, mit 10 mL/L Vorkultur angeimpft und bei 37°C bis zu einer

OD 600 = 0.6 - 0.8 kultiviert. Die Bakterien wurden mit 1 mM IPTG induziert und 5 Stunden bei

37°C unter Schütteln inkubiert.

PEX19 und PEX19 76-271 als Hexahistidin-Fusionsprotein

Für die Produktion von His 6 -PEX19-Fusionsprotein in E. coli BL21 (DE3) wurde LB-Medium

mit Ampicillin versetzt, mit 10 mL/L Vorkultur angeimpft und bei 37°C bis zu einer

OD 600 = 0.4 - 0.5 kultiviert. Die Temperatur wurde auf 15°C gesenkt, nach einer halben Stunde

die Bakterien mit 1 mM IPTG induziert und über Nacht bei 15°C geschüttelt.

PEX3, PEX3 26-373 und PEX3 34-373

Die Produktion der PEX3-Konstrukte fand in E. coli Rosetta (DE3) statt. Mit Ampicillin und

Chloramphenicol versetztes LB-Medium wurde mit 10 mL/L Vorkultur beimpft und bis zu

einer OD 600 = 0.6 - 0.8 kultiviert. Die Bakterien wurden mit 1 mM IPTG induziert und bei

18°C über Nacht geschüttelt.

TEV-Protease

Die Produktion der TEV-Protease fand in E. coli Rosetta (DE3) statt. Mit Ampicillin und

Chloramphenicol versetztes LB-Medium wurde mit 10 mL/L Vorkultur beimpft und bis zu

einer OD 600 = 0.6 - 0.8 kultiviert. Die Bakterien wurden mit 1 mM IPTG induziert und bei

18°C über Nacht geschüttelt.

Die Bakterien wurden durch 10-minütige Zentrifugation bei 6000*g und 4°C geerntet.

45


3 Methoden

3.1.4 Einbau von Selenomethionin in Proteine

Zur Inkorporation von Selenomethionin anstelle von Methionin in Proteine sind in der

Literatur zwei verschiedene Methoden beschrieben. Zum einen ist es möglich,

Selenomethionin durch die Verwendung eines Methionin-auxotrophen Stamms zu 100% in

Proteine einzubauen [106, 107]. Zum anderen kann die Inkorporation von Selenomethionin

durch die Methode der Produktinhibition erfolgen, die schneller durchgeführt werden kann,

bei der Methionin aber nicht zu 100% durch Selenomethionin ersetzt wird [108, 109].

Für die Herstellung von Selenomethionin-markiertem PEX3 und DHPH wurde der Methioninauxotrophe

E. coli-Stamm B834 (DE3) verwendet. Nach Transformation wurden die

Bakterien in 20 mL LB-Medium mit den entsprechenden Antibiotika über Nacht bei 37°C

angezogen, abzentrifugiert und in 5 mL LeMaster-Medium resuspendiert. Nach einem

weiteren Zentrifugationsschritt wurden die Zellen erneut in 5 mL LeMaster-Medium

resuspendiert und mit dieser Zellsuspension die Hauptkultur (1 mL/L LeMaster-Medium mit

den entsprechenden Antibiotika) beimpft. Die weitere Vorgehensweise entsprach der

normalen Proteinpräparation, allerdings wurde statt sonstiger Reduktionsmittel allen Puffern

0.5 mM TCEP zugesetzt.

Für die Herstellung von Selenomethionin-substituiertem EBF (Anhang 6.7) wurde neben der

Inkorporation durch Verwendung des Methionin-auxotrophen Stammes auch die Methode der

Produktinhibition angewandt. Dazu wurde eine Übernachtkultur von E. coli Rosetta (DE3),

die mit dem EBF-codierenden Plasmid transformiert worden waren, in LB-Medium

angezogen, abzentrifugiert und in M9-Medium, das 2% (w/v) Glucose sowie die

entsprechenden Antibiotika enthielt, kultiviert. 15 Minuten vor der Induktion wurden die

Aminosäuren der Aspartat- und Pyruvatfamilie zugegeben, die die Aspartatkinase hemmen

und dadurch die Synthese von Methionin blockieren. Zusätzlich wurde L-Selenomethionin

zugegeben, das dann anstatt von Methionin in die Proteine eingebaut wird. Die weitere

Proteinpräparation folgte dem Standardprotokoll mit Zusatz von 0.5 mM TCEP in allen

verwendeten Puffern.

46


3.2 Molekularbiologische Methoden

3.2 Molekularbiologische Methoden

3.2.1 Einführen von Mutationen mittels der QuikChange TM -Methode

Zur Einführung von Punktmutationen in Plasmid-DNA wurde die QuikChange TM -Methode

und das entsprechende Kit der Firma Stratagene verwendet. Primerdesign und PCR (Tabelle

3.2.1) wurden in der Regel nach Anleitung durchgeführt, in komplizierten Fällen wurden

jedoch nur teilweise überlappende Primer verwendet, um das Anlagern der Primer an das

Templat gegenüber der Bildung von Primer-Doppelsträngen zu begünstigen. Der im Protokoll

enthaltene Verdau mit DpnI wurde abweichend von der Anleitung über Nacht inkubiert.

Anschließend wurden superkompetente XL1 blue (Stratagene) mit dem Ansatz transformiert

(Abschnitt 3.2.8).

Zur Einführung eines Histidin-Affinitätstags an die Urocanase wurde ebenso vorgegangen,

allerdings wurden 20 Zyklen durchgeführt. Eine Übersicht über die durchgeführten

QuikChange TM -Reaktionen und die Sequenzen der verwendeten Primer sind in Anhang II zu

finden.

Tabelle 3.2.1 PCR-Programm einer QuikChange TM -Reaktion

Initiale Denaturierung 95°C 30 sek

Denaturierung (1) 95°C 30 sek

Annealing (2) 55°C 60 sek

Extension (3) 68°C 90 sek/kb

Anzahl Zyklen (1-3) 16

3.2.2 Amplifikation von DNA-Fragmenten mittels PCR

Zur Amplifikation des PEX3- und des PEX19-Gens bzw. verkürzter Konstrukte dieser Gene

wurde die Polymerase-Kettenreaktion eingesetzt. Dabei besaßen die verwendeten Primer

Restriktionsschnittstellen zur Klonierung in verschiedene Vektoren. Ein PCR-Ansatz von

50 µL enthielt 100 ng Templat, 0.5 µM je Primer, 2.5 U Pfu-Polymerase, 2 mM MgSO 4 ,

1x Pfu-Puffer und 0.2 mM je dNTP. Die durchgeführten PCR-Reaktionen sind in Tabelle 3.2.2

zusammengefasst, das Temperaturprogramm ist aus Tabelle 3.2.3 ersichtlich. Die Sequenzen

der verwendeten Primer sind in Anhang III zu finden.

47


3 Methoden

Tabelle 3.2.2 Übersicht über durchgeführte PCR-Reaktionen

Templat Primer forward Primer reverse Vektor

1 PEX19 pGEX4T-1PEX19 PEX19 NdeI for PEX19 BamHI rev pColdI, IV

2 PEX19 76-271 pGEX4T-1PEX19 TEV PEX19 76 NdeI for PEX19 271 SalI rev pColdI

3 PEX3 pGEMTPEX3 PEX3 NdeI for PEX3 SalI rev pT7-7, pColdI, IV

4 PEX3 pGEMTPEX3 PEX3 BglII for PEX3 SalI rev pGEX4T-1, pET32a

5 PEX3 34-373 pGEMTPEX3 PEX3 34 BglII for PEX3 SalI rev pET32a, pColdI

6 PEX3 26-373 pGEMTPEX3 PEX3 26 for PEX3 SalI rev pET32a

Tabelle 3.2.3

PCR-Programm zur Genamplifikation

Initiale Denaturierung 95°C 3 min

Denaturierung (1) 95°C 2 min

Annealing(2) 65°C 2 min

Extension (3) 75°C 4 min

Finale Extension 75°C 15 min

Anzahl Zyklen (1-3) 30

3.2.3 Restriktionsspaltung von DNA

Analytische Restriktionsspaltung von DNA

Für die analytische Restriktionsspaltung wurde der folgende Restriktionsmix angesetzt:

2 µL Enzym (bei 2 verschiedenen Enzymen je 1 µL), 10 U/µL

12 µL 10x Restriktionspuffer

8 µL H 2 O

Je 10 µL einer Plasmidpräparation wurden mit 2 µL Restriktionsmix gemischt und 1.5-2 h bei

37°C inkubiert. Die Testverdaus wurden durch Agarosegelelektrophorese analysiert (Abschnitt

3.2.10).

Präparative Restriktionsspaltung von DNA

Für eine präparative Restriktionsspaltung wurden 1-2 µg DNA mit 20 U Restriktionsenzym in

50 µL des empfohlenen Puffers für zwei Stunden bei 37°C inkubiert. Nach der

Restriktionsspaltung wurden die DNA-Fragmente über ein Agarosegel aufgereinigt.

48


3.2 Molekularbiologische Methoden

3.2.4 Dephosphorylierung von DNA-Enden

Um an bei der Restriktionsspaltung entstandenen DNA-Enden das 5´-Phosphat zu entfernen,

wurde zum Restriktionsansatz der Vektor-DNA 1 U/50 µL CIAP zugesetzt.

3.2.5 Ligation von DNA-Fragmenten

Zur Ligation wurden 50-100 ng Vektor-DNA mit zwei verschiedenen Konzentrationen des

einzusetzenden Fragmentes gemischt (entsprechend einem Stoffmengen-Verhältnis von 1:2

bzw. 1:5). Die Ligationsreaktion fand in 20 µL 1x rapid ligation buffer (Fermentas) mit 5 U

T4 DNA-Ligase statt. Die Inkubationszeit bei Raumtemperatur betrug mindestens 10 Minuten,

bevor eine Transformation von superkompetenten XL1 blue durchgeführt wurde (Abschnitt

3.2.8). Folgende Ligationen wurden vorgenommen:

PCR-Produkt

(Tabelle 3.2.2)

Tabelle 3.2.4 Übersicht über die Plasmidherstellung

Vektor

Restriktionsspaltung

Restriktionsspaltung

erzeugter Vektor

1 NdeI, BamHI pColdI NdeI, BamHI pColdI.PEX19

1 NdeI, BamHI pColdIV NdeI, BamHI pColdIV.PEX19

2 NdeI, SalI pColdI NdeI, SalI pColdI.TEV_PEX19 76-271

4 BglII, SalI pGEX4T-1 BamHI, SalI pGEX.PEX3

3 NdeI, SalI pT7-7 NdeI, SalI pT7-7.PEX3

3 NdeI, SalI pColdI NdeI, SalI pColdI.PEX3

3 NdeI, SalI pColdIV NdeI, SalI pColdIV.PEX3

4 BglII, SalI pET32a BamHI, SalI pET32a.PEX3

5 BglII, SalI pET32a BamHI, SalI pET32a.PEX3 34-373

6 SalI pET32a.TEV_PEX3 EcoRV, SalI pET32a.TEV_PEX3 26-373

3.2.6 Einführen einer TEV-Schnittstelle

In die Vektoren pET32a.PEX3, pET32a.PEX3 34-373 und pColdI.PEX19 wurde die für die TEV-

Schnittstelle codierende Gensequenz eingefügt. Dazu wurden Oligonukleotide mit der

codierenden Sequenz so konzipiert, dass sie bei Aneinanderlagerung am 3’- und 5’-Ende einen

Überhang analog zu einem mit einer Restriktionsendonuklease geschnittenen DNA-Fragment

bildeten (Abbildung 3.2.1).

49


3 Methoden

Abbildung 3.2.1 Oligonukleotid-Inserts für die Einführung von TEV-Schnittstellen

Für die Klonierung wurde der Vektor entsprechend Abschnitt 3.2.3 und 3.2.4 geschnitten und

dephosphoryliert und anschließend gemäß Abschnitt 3.2.10 und 3.2.12 gereinigt. Je 8 µg der

komplementären Oligonukleotide wurden gemischt und mittels Polynukleotidkinase (10 U) in

30 µL Ligase-Puffer (Rapid Ligation buffer, Fermentas) für zwei Stunden bei 37°C

phosphoryliert. Anschließend wurden die Oligonukleotide durch Erhitzen auf 90°C und

langsames Abkühlen zu doppelsträngiger DNA zusammengelagert. Für die Ligation

(Abschnitt 3.2.5) wurden 100 ng Vektor und 1-5 ng Insert eingesetzt. Tabelle 3.2.5 gibt die

verwendeten Oligonukleotide und Restriktionsenzyme an, die Sequenzen der verwendeten

Primer sind in Anhang III zu finden.

Tabelle 3.2.5

Einfügen einer TEV-Schnittstelle

Ausgangsvektor Restriktionsenzyme Oligonukleotide erzeugter Vektor

pET32a.PEX3 NcoI, EcoRV TEV NcoI for, TEV EcoRV rev pET32a.TEV_PEX3

pET32a.PEX3 34-373 NcoI, EcoRV TEV NcoI for, TEV EcoRV rev pET32a.TEV_PEX3 34-373

pColdI.PEX19 NdeI TEV NdeI for, TEV NdeI rev pColdI.TEV_PEX19

3.2.7 Herstellung calciumkompetenter Zellen

Für eine Hitzeschocktransformation kompetente E. coli-Zellen wurden in einem modifizierten

Protokoll nach Cohen et al. hergestellt [110]. Dazu wurden 2 mL TY-Medium mit einer

Kolonie des entsprechenden Stammes angeimpft, mit den benötigten Antibiotika versehen und

über Nacht bei 37°C inkubiert. 100 mL TY-Medium mit den entsprechenden Antibiotika

wurden mit 0.5 mL der Übernachtkultur angeimpft, die Kultur bis zu einer OD 600 von 0.3

kultiviert und dann 15 Minuten im Eisbad abgekühlt. Alle weiteren Schritte erfolgten bei 4°C

bzw. im Eisbad. Die Zellen wurden 10 Minuten bei 3000*g zentrifugiert, das Pellet in 10 mL

kaltem 100 mM MgCl 2 gewaschen, nach erneuter Zentrifugation (3000*g, 4°C, 10 min) in

20 mL kaltem 100 mM CaCl 2 resuspendiert und 20 Minuten auf Eis inkubiert. Nach einem

zehnminütigen Zentrifugationsschritt bei 3000*g und 4°C wurde das Pellet in 1 mL kaltem

100 mM CaCl 2 / 15% (v/v) Glycerin resuspendiert und in 50 µL Aliquots bei -80°C gelagert.

50


3.2 Molekularbiologische Methoden

3.2.8 Transformation calciumkompetenter Zellen

Zur Transformation calciumkompetenter Zellen mit einem Ligationsprodukt wurden 5 µL des

Ligationsansatzes mit 30 µL superkompetenten XL1 blue gemischt und eine halbe Stunde auf

Eis inkubiert. Der Hitzeschock erfolgte bei 42°C für 45 Sekunden im Wasserbad, anschließend

wurde der Ansatz für zwei Minuten auf Eis gekühlt. Die Zellen wurden eine Stunde mit

0.5 mL SOC-Medium bei 37°C geschüttelt und dann auf LB-Platten mit dem entsprechenden

Selektionsantibiotikum ausplattiert. Zur Transformation von Zellen mit einem QuikChange TM -

Produkt wurden 1 µL des Ansatzes und 30 µL superkompetenter XL1 blue verwendet und wie

oben verfahren. Die Transformanden wurden bei 37°C über Nacht angezogen.

Bei der Transformation mit einem gereinigten Plasmid zur Überexpression wurden ca. 50 ng

Plasmid mit 50 µL calciumkompetenter Zellen des entsprechenden Stammes gemischt und wie

oben verfahren, allerdings wurde der Transformationsansatz nicht auf LB-Platten

ausgestrichen, sondern direkt eine Übernachtkultur hergestellt. Dazu wurden nach der

Anwachsphase mit dem Transformationsansatz 50 mL LB-Medium mit den entsprechenden

Antibiotika angeimpft und bei 37°C über Nacht geschüttelt.

3.2.9 Plasmidpräparation (Peqlab, Qiagen)

Plasmidpräparationen wurden aus 20 mL Kultur mit dem E.Z.N.A. ® Plasmid Miniprep Kit II

(PeqLab) nach Anleitung durchgeführt, die Elution erfolgte durch 2 x 50 µL heißes ddH 2 O.

Für größere Mengen Plasmid wurde das QIAGEN ® Plasmid Midi Kit (Qiagen) mit 100 mL

Kultur nach Anleitung verwendet, für das Resuspendieren der präzipitierten DNA wurden

100 µL ddH 2 O verwendet. Die Ausbeute wurde durch Absorptionsmessung bei 260 nm, die

Reinheit durch das Verhältnis der Absorptionen bei 260 und 280 nm ermittelt.

3.2.10 Agarosegelelektrophorese

Zur Analyse von Restriktions- oder QuikChange TM -Ansätzen sowie zur Präparation von DNA-

Fragmenten wurde eine Agarosegelelektrophorese mit Ethidiumbromid zur Detektion

durchgeführt. Die DNA wurde mit 1/5 Volumen an 6x DNA-Probenpuffer versetzt und auf ein

1%iges horizontales Agarosegel (1% (w/v) Agarose in TAE-Puffer mit 1 µg Ethidiumbromid/mL)

aufgetragen. Die Elektrophorese erfolgte bei Raumtemperatur mit 90 V/120 mA.

51


3 Methoden

TAE-Puffer: 40 mM Tris, 20 mM Essigsäure, 2 mM EDTA, pH 8.1 (NaOH)

6x DNA-Ladepuffer: 10 mM Tris, 1 mM EDTA, 50% (v/v) Glycerin, 0.05% (w/v)

Bromphenolblau, pH 7.5 (HCl)

Als Standard wurde 1 kb-Standard (Fermentas) oder λ-Marker (NEB) verwendet.

3.2.11 Kolonie-PCR

Die Kolonie-PCR wurde als Alternative zur analytischen Restriktionsspaltung eingesetzt, um

Klone zu identifizieren, die ein gewünschtes Ligationsprodukt enthielten. Ein PCR-Ansatz von

25 µL enthielt 0.5 µM je Primer, 1 U Pfu-Polymerase, 2 mM MgSO 4 , 1 x Pfu-Puffer und

2 mM je dNTP. Die durchgeführten Reaktionen mit den entsprechenden Primern sind in

Tabelle 3.2.6 aufgelistet, das Temperaturprogramm kann Tabelle 3.2.3 entnommen werden.

Die Sequenzen der Primer finden sich in Anhang III. Zu je einem Ansatz wurden Bakterien

eines Klons zugesetzt und das entsprechende PCR-Programm gestartet. Gleichzeitig wurden

von den zu analysierenden Klonen Flüssigkulturen angelegt. Die PCR-Produkte wurden per

Agarosegelelektrophorese analysiert. Bei Klonen mit dem gewünschten Konstrukt wurden die

Flüssigkulturen für eine Plasmidpräparation genutzt.

Tabelle 3.2.6

Für die Kolonie-PCR verwendete Primer

Primer forward Primer reverse

PEX3 PEX3 NdeI for PEX3 NdeI rev

PEX19 PEX19 NdeI for PEX19 BamHI rev

PEX3 34-373 PEX3 34-373 BglII for PEX3 SalI rev

PEX3 26-373 PEX3 26-373 for PEX3 SalI rev

pColdI.TEV_PEX19 TEV NdeI for PEX19 SalI rev

pET32a.TEV_PEX3 TEV NcoI for PEX3 SalI rev

pET32a.TEV_PEX3 34-373 TEV NcoI for PEX3 SalI rev

3.2.12 Aufreinigen von DNA-Banden aus Agarosegelen

Nach der Auftrennung im Agarosegel wurden die gewünschten DNA-Banden unter UV-Licht

mit einem Skalpell ausgeschnitten und gewogen. Die Aufreinigung der DNA-Fragmente

erfolgte mit dem QIAquick ® Gel Extraction Kit (Qiagen) gemäß des Herstellerprotokolls,

eluiert wurde mit 30 µL heißem ddH 2 O.

52


3.2 Molekularbiologische Methoden

3.2.13 Aufreinigung von DNA-Fragmenten aus PCR-Ansätzen

Für die Trennung von DNA-Fragmenten von kleineren Oligonukleotiden sowie von Enzymen

wurde das QIAquick ® PCR Purification Kit (Qiagen) gemäß Herstellerangaben verwendet,

eluiert wurde mit 30 µL heißem ddH2O.

3.2.14 Bestimmung von DNA-Konzentration und -Reinheit

DNA-Konzentrationen wurde durch Absorptionsmessung bei 260 nm, die Reinheit durch das

Verhältnis der Absorptionen bei 260 und 280 nm ermittelt. Eine Absorption von 1.0 bei

260 nm entspricht 50 µg/mL DNA, ein Verhältnis der Absorptionen bei 260/280 nm von 1.8

entspricht reiner DNA. Ein höheres Verhältnis deutet auf RNA-Verunreinigung, ein

niedrigeres auf Protein-Kontamination hin.

3.2.15 Sequenzierung

Sequenzierungen wurden durch die Firma Seqlab (Göttingen) unter Verwendung der

Didesoxymethode nach Sanger durchgeführt. Dazu wurden pro Sequenzierung ca. 1.5 µg

Plasmid luftgetrocknet und eingeschickt. Die verwendeten Primer und ihre Sequenzen sind in

Tabelle 3.2.7 zusammengefasst.

Tabelle 3.2.7

Für Sequenzierreaktionen verwendete Primer

Vektor/Gen Richtung Primername Sequenz 5’3’

pT7-7.URO (mit Mutationen)

und pT7-7.PEX3

forward

reverse

T7-Promotor

pT7rev2

TAATACGACTCACTATAGGG

GTTCAGTATCACCCCTGGCG

pT7-7.URO_HIS 8 (mit Mutationen) forward

reverse

T7-Promotor

pT7rev3

TAATACGACTCACTATAGGG

CGATAAGCTTGGGCTGCAGG

pET32a/PEX3-Konstrukte

(mit Mutationen)

forward

reverse

T7-Promotor

T7-Terminator

TAATACGACTCACTATAGGG

GCTAGTTATTGCTCAGCGG

pGEX.PEX3, pGEX.PEX19 forward

reverse

pGEX5’

pGEX3’

GGGCTGGCAAGCCACGTTTGGTG

CCGGGAGCTGCATGTGTCAGAGG

pColdI oder IV/PEX3 oder PEX19

oder PEX19 76-271 (mit Mutationen)

forward

reverse

pCold for

pCold rev

ACGCCATATCGCCGAAAGG

GGCAGGGATCTTAGATTCTG

pH6EX3.DHPH (mit Mutationen) forward Dhph for GCGTGCCGTCATCATCCATGG

53


3 Methoden

3.3 Proteinbiochemische Methoden

3.3.1 Bestimmung der Proteinkonzentration

Bei Lösungen einer einzelnen, reinen Proteinspezies lässt sich nach dem Lambert-Beerschen

Gesetz bei Kenntnis der Molekularmasse und des Extinktionskoeffizienten die

Proteinkonzentration aus der Absorption bei 280 nm berechnen. Der molekulare

Extinktionskoeffizienten beinhaltet die Absorption von Tryptophan-, Tyrosin- und

Cystinresten und wurde mit dem Programm ProtParam berechnet

(www.expasy.org/tools/protparam.html).

Die proteinspezifischen Parameter lassen sich zu einem Faktor f zusammenfassen, so dass sich

die Proteinkonzentration c einer Lösung nach Gleichung 3.3.1 errechnet.

c

[ mg / mL]

A ⋅ f

d

= 280

mit

f

=

M r

ε 280 nm

Gleichung 3.3.1

c = Proteinkonzentration

A 280 = Absorption bei 280 nm

M r = relative Molekularmasse

d = Schichtdicke der Küvette (1 cm)

ε 280nm = molekularer dekadischer Extinktionskoeffizient bei 280 nm

Für DHPH muss bei der Berechnung des Faktors f zusätzlich die Absorption des FAD-

Cofaktors bei 280 nm berücksichtigt werden. Da in der Literatur hierfür kein Wert zu finden

war, wurde ein Absorptionsspektrum von FAD in Wasser aufgenommen. Der

Extinktionskoeffizient für FAD wurde anhand des Verhältnisses der Absorptionen bei 280 nm

und 450 nm (A 280 /A 450 = 2.124) sowie des bekannten Extinktionskoeffizienten bei 450 nm

(ε 450nm = 11’300 M -1 cm -1 ) nach Gleichung 3.3.2 berechnet.

A

A

c ⋅ d ⋅ε

ε

A

= Gleichung 3.3.2

280 280nm

280nm

280

= ⇒ ε

280nm

= ⋅ε

450nm

450

c ⋅ d ⋅ε

450nm

ε

450nm

A450

Es ergab sich ein Extinktionskoeffizient von ε 280nm = 24'000 M -1 cm -1 , der zur Absorption des

Proteins allein (ε 280nm = 59'360 M -1 cm -1 ) hinzugerechnet werden muss, so dass sich für das

Holoprotein ein Extinktionskoeffizient von ε 280nm = 83'360 M -1 cm -1 ergibt. Das Verhältnis der

Absorptionen bei 280 nm und 450 nm ergibt sich dann nach Gleichung 3.3.2 als 7.4.

54


3.3 Proteinbiochemische Methoden

Eine entsprechende Berechnung müsste eigentlich analog für den NAD + -Cofaktor von

Urocanase durchgeführt werden. Da dies jedoch bereits von Kessler [17] vernachlässigt

worden war, wurde der Einheitlichkeit wegen darauf verzichtet und nur die Absorption des

Proteins selbst berücksichtigt.

Die Parameter und die daraus berechneten Faktoren der in dieser Arbeit verwendeten Proteine

sind in Tabelle 3.3.1 aufgeführt.

Tabelle 3.3.1

Parameter und Faktoren der verwendeten Proteine

Protein M r [Da] ε 280nm [M -1 cm -1 ] Faktor f

Urocanase 60’718 93’850 0.647

PEX3 42’140 31’400 1.342

PEX3 34-373 38’331 22’920 1.672

PEX3 26-373 39’225 25’900 1.514

PEX19 32’807 9’970 3.291

PEX19 76-271 21’952 9’970 2.202

TEV 27’527 33’460 0.823

DHPH 43’400 83’360 0.521

MTX 97’313 184’040 0.529

3.3.2 SDS-Gelelektrophorese

Für die SDS-Gelelektrophorese wurden vertikale Minigele mit den Ausmaßen

8 x 6.5 x 0.075 cm (Biorad) eingesetzt. Die Proben wurden mit derselben Menge 2x SDS-

Probenpuffer gemischt, evtl. bis zu 5 Minuten gekocht und aufgetragen. Die Auftrennung

erfolgte bei einer konstanten Stromstärke von 45 mA. Die Elektrophorese wurde gestoppt,

wenn die Lauffront, angezeigt durch Bromphenolblau, die Unterkante des Gels erreichte.

12%iges Trenngel:

11.7% (w/v) Acrylamid

0.3% (w/v) Bisacrylamid

375 mM Tris-HCl, pH 8.8

0.1% (w/v) SDS (7 mM)

0.1% (w/v) APS

0.01% (v/v) TEMED

6%iges Sammelgel:

5.85% (w/v) Acrylamid

0.15% (w/v) Bisacrylamid

125 mM Tris-HCl, pH 6.8

0.1% (w/v) SDS

0.1% (w/v) APS

0.01% (v/v) TEMED

55


3 Methoden

Elektrophoresepuffer: 50 mM Tris, 380 mM Glycin, 0.1% (w/v) SDS, pH 8.3 (stellt sich

ein)

2x SDS-Probenpuffer: 330 mM Tris, 3.6% (w/v) SDS, 20% (v/v) Glycerin, 0.02% (w/v)

Bromphenolblau, pH 6.8 (HCl)

LMW-Längenstandard: 64 µg/µL Phosphorylase B (94 kDa)

83 µg/µL Rinderserumalbumin (67 kDa)

147 µg/µL Ovalbumin (43 kDa)

83 µg/µL Carboanhydrase (30 kDa)

88 µg/µL Trypsin-Inhibitor (20 kDa)

121 µg/µL α-Lactalbumin (14 kDa)

3.3.3 Native PAGE

Für die Native PAGE wurde ein 6%iges Gel ohne Sammelgel hergestellt und über Nacht bei

4°C gekühlt. Die Proben wurden mit Nativ-Probenpuffer gemischt, aufgetragen und die

Elektrophorese unter Eiskühlung bei 30 mA für 15 Minuten und weitere 45 Minuten bei

45 mA durchgeführt.

6%iges Gel:

5.85% (w/v) Acrylamid, 0.15% (Bisacrylamid), 20 mM Tris

(pH 8.0), 0.1% (w/v) APS, 0.01% (v/v) TEMED

Laufpuffer: 50 mM Tris, pH 8.0

5x Nativ-Probenpuffer: 0.05 M Tris, 50% (v/v) Glycerin, 0.05% (w/v) Bromphenolblau,

pH 8.0 (HCl)

3.3.4 Coomassie-Färbung

Für die Coomassie-Färbung wurden die Gele etwa 5 Minuten in heißer Coomassie-

Färbelösung inkubiert. Anschließend wurden die Gele so lange mit Entfärbelösung behandelt,

bis der Hintergrund wieder klar wurde. Dabei wurde der Entfärber bei Bedarf erhitzt und

mehrfach gewechselt.

Färbelösung:

Entfärbelösung:

0.25% (w/v) Coomassie Brilliant Blue R-250, 30% (v/v) Ethanol,

10% (v/v) Essigsäure

30% (v/v) Ethanol, 10% (v/v) Essigsäure

56


3.3 Proteinbiochemische Methoden

3.3.5 Elektrophoretischer Proteintransfer auf Nitrocellulose

Zur N-terminalen Sequenzierung von Proteinen wurden diese mittels Semidry-Verfahren auf

eine PVDF-Membran transferiert.

Dazu wurde folgender Aufbau verwendet:

Anode

6 Blatt Whatman-Papier getränkt mit Transferpuffer

PVDF-Membran, äquilibriert in Methanol und anschließend in Transferpuffer

Polyacrylamidgel

6 Blatt Whatman-Papier getränkt mit Transferpuffer

Kathode

Der Transfer erfolgte für 1.5 Stunden bei einer konstanten Stromstärke von 250 mA.

Proteinbanden wurden durch Inkubation der Membran mit Ponçeau-S-Färbelösung und

anschließendem Waschen mit Entfärbelösung sichtbar gemacht.

Transferpuffer: 200 mM Glycin, 25 mM Tris, 20% (v/v) Methanol, 0.01% (w/v)

SDS (pH 8.3-8.4)

Ponçeau-S-Färbelösung: 2.5% (w/v) Ponçeau-S, 40% (v/v) Methanol, 15% (v/v) Essigsäure

Entfärbelösung: 30% (v/v) Ethanol, 10% (v/v) Essigsäure

3.3.6 N-terminale Sequenzierung von Proteinen (Edman-Abbau)

Die N-terminale Sequenzierung von Proteinen wurde durch E. Schiltz durchgeführt

3.3.7 Dynamische Lichtstreuung

Bei der dynamischen Lichtstreuung werden durch die Molekülbewegung hervorgerufene

Fluktuationen des Streulichtes einer Probe über die Zeit gemessen. Daraus lässt sich der

Diffusionskoeffizient ermitteln und mit diesem wiederum der hydrodynamische Radius R H

über die Stokes-Einstein-Gleichung bestimmen (Gleichung 3.3.3). Aus R H lässt sich unter

Annahme einer mittleren Dichte ρ für ein globuläres Molekül die Masse M r nach Gleichung

3.3.4 berechnen. Die Messung der DLS erfolgte mit Proteinkonzentrationen von etwa

1 mg/mL. Für jedes Protein wurden jeweils 20 Messungen durchgeführt und mit der

Auswertesoftware DynaPro-801 (Fa. Protein Solutions) analysiert.

57


3 Methoden

R H

kT

= 6πη

D

Gleichung 3.3.3

4 3

M r

= π ⋅ R H

⋅ ρ

3

Gleichung 3.3.4

mit R H = hydrodynamischer Radius [m]

k = Boltzmann-Konstante [J·K -1 ]

T = absolute Temperatur [K]

η = Viskosität des Lösungsmittels [kg·m -1·s -1 ]

D = Diffusionskoeffizient [m 2·s -1 ]

M r = molekulare Masse [kg]

ρ = mittlere Dichte des Lösungsmittels [kg/m 3 ]

3.3.8 Optimierungsschritte von Proteinreinigungen

Optimierung der Proteinexpression von PEX3 und PEX3 34-373

Zur Optimierung der Expression von PEX3- und PEX3 34-373 -Fusionsproteinen wurden

Expressionsstamm, -temperatur und -dauer variiert. Dazu wurde eine Übernachtkultur mit

entsprechenden Antibiotika angeimpft, aus dieser eine 10-mL-Kultur des gewünschten

Mediums mit entsprechenden Antibiotika angeimpft und dann bis zu einer OD 600 von 0.5 - 0.7

kultiviert. Eine Probe von 0.5 mL wurde bei 16000*g 30 Sekunden abzentrifugiert und der

Niederschlag in 50 µL 2xSDS-Probenpuffer aufgenommen. Die Zellen wurden mit 1 mM

IPTG induziert, bei 18°C oder 37°C inkubiert und für 5 Stunden stündlich sowie nach 8 und

20 Stunden eine weitere Probe von 0.5 mL genommen und wie oben behandelt. Die Proben

wurden 5 Minuten gekocht und anschließend 10 µL jeder Probe der SDS-Gelelektrophorese

unterworfen.

Untersuchungen zur Löslichkeit des PEX3- und PEX3 34-373 -Thioredoxinfusionsproteins

Um die Löslichkeit der PEX3-Konstrukte zu verbessern, wurden verschiedene

Wachstumsdauern, Medien sowie Aufschlussmethoden untersucht. Je 4 Kolben mit 330 mL

LB- oder SB-Medium (mit Ampicillin und Chloramphenicol) wurden mit je 3 mL einer

Übernachtkultur von Rosetta (DE3) mit pET32a.PEX3 bzw. pET32a.PEX3 34-373 angeimpft und

bei einer OD 600 von 0.6 - 0.8 die Expression der PEX3-Konstrukte induziert. Nach 2, 4, 8 und

20 Stunden Kultivierung wurden die Zellen 10 Minuten bei 4°C und 3000*g abzentrifugiert

58


3.3 Proteinbiochemische Methoden

und das Pellet in 30 mL His-A-Puffer (Abschnitt 3.4.1) resuspendiert. Je 10 mL wurden mit

zwei verschiedenen Ultraschallprogrammen (Tabelle 3.3.2) bzw. mit der French Press

aufgeschlossen. Die unlöslichen Bestandteile wurden durch 30-minütige Zentrifugation bei

4°C und 43000*g abzentrifugiert, der Überstand abgenommen und das Pellet in 2 mL His-A-

Puffer resuspendiert. Je 10 µL von Pellet und Überstand wurden mit 10 µL 2x DNA-

Probenpuffer gemischt, 5 Minuten gekocht und mittels SDS-PAGE analysiert.

Tabelle 3.3.2

Ultraschallprogramme zur Untersuchung des Einflusses auf die

Löslichkeit von PEX3

Schallzeit Pulsdauer Pausendauer

gesamt

Ultraschallprogramm 1 60 sek 1 sek 2 sek

Ultraschallprogramm 2 60 sek 5 sek 10 sek

Optimierung der Spaltung von PEX3- und PEX19-Fusionsproteinen mit verschiedenen

Proteasen

Für die Optimierung der Spaltung von PEX3- und PEX19-Fusionsproteinen mit verschiedenen

Proteasen wurde die Spalttemperatur, Spaltdauer sowie die eingesetzte Proteaseaktivität

variiert. Dazu wurden die Fusionsproteine auf 10 mg/mL im entsprechenden Schneidepuffer

(Faktor Xa-Schneidepuffer: 50 mM Tris, 100 mM NaCl, 5 mM CaCl 2 , pH 8.0; TEV-

Schneidepuffer: His-A-Puffer (Abschnitt 3.4.1)) eingestellt und je 100 µL der Proteinlösung

bei drei verschiedenen Temperaturen (4°C, 25°C und 37°C) mit je zwei verschiedenen

Proteaseaktivitäten (2 U oder 10 U Faktor Xa/mg Protein bzw. 5 µg oder 10 µg TEV-

Protease/mg Protein) inkubiert. Direkt vor Zugabe der Protease sowie 5 Minuten, 15 Minuten,

30 Minuten, 1 h, 2 h, 4 h, 6/8h und 24 h nach Zugabe wurden 10 µL Probe je Ansatz

entnommen, mit 10 µL 2x SDS-Probenpuffer versetzt und mittels SDS-PAGE analysiert.

3.3.9 Faltungsversuche für PEX3

In inclusion bodies produziertes PEX3-Thioredoxinfusionsprotein wurde durch Waschen der

Einschlusskörper aus dem nach dem Aufschluss gemäß Abschnitt 3.1.3 gewonnenen

Niederschlag gereinigt. Dazu wurde das Pellet in 10 mL Triton-Puffer (50 mM Tris, 100 mM

NaCl, 10 mM EDTA, pH 8.0, 30 mM Triton-X 100) resuspendiert und zwei Stunden lang

59


3 Methoden

unter Rühren bei 4°C inkubiert. Der Ansatz wurde anschließend 20 Minuten bei 4300*g

abzentrifugiert und der Überstand verworfen. Die im Niederschlag enthaltenen inclusion

bodies wurden in 10 mL His-A-Puffer (Abschnitt 3.4.1) resuspendiert, abermals unter Rühren

für 2 Stunden bei 4°C inkubiert und nachfolgend bei 4300*g abzentrifugiert. Das Pellet wurde

in 6 M Guanidinhydrochlorid aufgelöst und für Rückfaltungsversuche mit dem FoldIt-Screen

(Hampton Research) gemäß Herstellerangaben eingesetzt.

3.3.10 Enzymaktivitätstests

Aktivitätstest der Urocanase

Für den Aktivitätstest wurden 964 µL Uro-A-Puffer (Abschnitt 3.4.1) und 30 µL Urocanat

(10 mM) gemischt und auf 25°C erwärmt. Zum Starten der Reaktion wurden 6 µL

Enzymlösung (10 mg/mL) zugegeben, die Lösung kurz invertiert und in einem Photometer

die Abnahme der Absorption bei 277 nm (Absorptionsmaximum von Urocanat, molarer

Extinktionskoeffizient ε 277nm = 1880 M -1 cm -1 ), verfolgt.

Aktivitätstest von DHPH

Für den Aktivitätstest wurden 995 µL Testpuffer (50 mM KH 2 PO 4 , pH 7.1, 0.1 mM

2,6-Dihydroxypyridin, 0.2 mM NADH) auf 25°C erwärmt, zum Starten der Reaktion 5 µL

Enzymlösung (8 mg/mL) zugegeben, die Lösung kurz invertiert und die Reaktion

photometrisch verfolgt. Dazu wurde entweder die Abnahme der Absorption bei 334 nm durch

Verbrauch von NADH oder die Zunahme der Absorption bei 578 nm durch Entstehen des

blauen Pigments verfolgt.

3.3.11 Untersuchungen zum Einfluss von Reduktionsmittel auf DHPH

Um den Einfluss von Reduktionsmittel auf DHPH zu testen, wurde mit gereinigtem Protein

eine SDS-PAGE mit und ohne β-Mercaptoethanol im Probenpuffer durchgeführt. Weiterhin

wurde das Protein durch eine GPC mit und ohne DTT im GPC-Puffer (GPC-A-Puffer, GPC-

B-Puffer) analysiert (Abschnitt 3.4.1), die Detektion erfolgte durch Absorptionsmessung bei

280 nm.

60


3.4 Proteinreinigung

3.4 Proteinreinigung

3.4.1 Säulenparameter und verwendete Puffer

Puffer:

His-A-Puffer: 50 mM NaH 2 PO 4 , 300 mM NaCl, 10 mM Imidazol, pH 8.0 (NaOH)

His-B-Puffer: 50 mM NaH 2 PO 4 , 300 mM NaCl, 500 mM Imidazol, pH 8.0 (HCl)

GSH-Puffer: 50 mM Tris, 10 mM Glutathion, pH 8.0 (HCl)

PBS: 140 mM NaCl, 2.7 mM KCl, 10 mM Na 2 HPO 4 , 1.8 mM KH 2 PO 4 , pH 7.4

GPC-A-Puffer: 50 mM Tris, 200 mM NaCl, 5 mM DTT, pH 8.0 (HCl)

GPC-B-Puffer: 50 mM Tris, 200 mM NaCl, pH 8.0 (HCl)

GPC-C-Puffer: 50 mM Tris, 200 mM NaCl, 2 mM DTT, pH 8.3 (HCl)

MonoQ-A-Puffer: 50 mM Tris, 5 mM DTT, pH 8.0 (HCl)

MonoQ-B-Puffer: 50 mM Tris, 500 mM NaCl, 5 mM DTT, pH 8.0 (HCl)

MonoQ-A2-Puffer: 50 mM Tris, pH 8.0 (HCl)

MonoQ-B2-Puffer: 50 mM Tris, 500 mM NaCl, pH 8.0 (HCl)

Uro-A-Puffer: 50 mM Tris, 5 mM DTT, pH 8.0 (HCl)

Uro-B-Puffer: 50 mM Tris, 1 M NaCl, 5 mM DTT, pH 8.0 (HCl)

TEV-A-Puffer: 50 mM Tris, pH 6.5 (HCl)

TEV-B-Puffer: 1 M Imidazol, pH 8.0 (HCl)

TEV-C-Puffer: 1 M NaCl, 2.7 mM KCl, 10 mM Na 2 HPO 4 , 1.8 mM KH 2 PO 4 , pH 7.4

Bei sämtlichen Puffern wurde der pH-Wert bei Raumtemperatur eingestellt. Die Puffer

wurden vor Verwendung durch eine 0.2 µm-Membran filtriert und im Ultraschallbad unter

Vakuum entgast.

61


3 Methoden

Säulen:

Tabelle 3.4.1

Ni-Säule I

Ni-Säule II

(HiTrap)

Affinitätschromatographie-Säulen:

Säulenmaterial

Chelating Sepharose High

Performance

Chelating Sepharose High

Performance

Säulendurchmesser

Säulenhöhe Säulenvolumen

[mm] [mm] [mL]

33 25 20

16 25 5

Ni-Säule III Profinity IMAC Resin 16 50 10

GSTrap Glutathione Sepharose 16 25 5

High Performance

Tabelle 3.4.2 Ionenaustauschchromatographie-Säulen

Säulenmaterial Säulendurchmesser

Säulenhöhe Säulenvolumen

[mm] [mm]

[mL]

MonoQ Mono Q 5 50 1

Resource S SOURCE 15S 16 30 5

Q-Sepharose-FF- Q-Sepharose FF 32 50 40

Säule

Tabelle 3.4.3

HiLoad-26/60 Superdex-200

prep grade Säule I

HiLoad-26/60 Superdex-200

prep grade Säule II

HiLoad-26/60 Superdex-75

prep grade

HiLoad-16/60 Superdex-200

prep grade

Gelpermeationschromatographie-Säulen

Dextran mit

Agarose

Dextran mit

Agarose

Dextran mit

Agarose

Dextran mit

Agarose

Ø

[mm]

Höhe

[mm]

Volumen

[mL]

Säulenmaterial

Trennbereich

[kDa]

Kalibriergerade

26 60 ca. 310 10-600 Anhang IV

26 60 ca. 320 10-600 Anhang IV

26 60 ca. 310 3-70 Anhang IV

16 60 ca. 120 10-600 Anhang IV

62


3.4 Proteinreinigung

Regenerieren und Lagern der Säulen

Zur Entfernung unspezifisch gebundenen Proteins wurden die Affinitäts- und

Ionenaustauschchromatographiesäulen mit 1 Säulenvolumen (CV) 6 M Guanidinhydrochlorid

gewaschen und mit ddH 2 O nachgewaschen, bis die Leitfähigkeit unter 1 mS/cm abgesunken

war.

Gelpermeationschromatographiesäulen wurden mit 1 CV 0.5 M NaOH unter umgekehrter

Fließrichtung gewaschen und mit ddH 2 O nachgespült.

Chelating Sepharose High Performance-Material wurde mit 0.5 CV 0.1 M NiSO 4 beladen.

Ungebundenes Nickel wurde mit 2 CV ddH 2 O und anschließend 5 - 10 CV Acetatpuffer

(20 mM Natriumacetat, 300 mM NaCl, pH 3.0 (HCl)) ausgewaschen. Zum Entfernen von

Nickel und unspezifisch an Nickel gebundenen Proteins wurden die Säulen mit 1.5 CV 0.1 M

EDTA, pH 8.0 (NaOH) behandelt und mit 2 CV ddH 2 O nachgespült.

Sämtliche Säulen wurden in 20% (v/v) Ethanol gelagert.

3.4.2 Gelpermeationschromatographie

Für sämtliche GPC-Läufe wurden die Säulen mit 1 CV des entsprechenden Puffers

äquilibriert, die Probe (1 - 5 mL) aufgetragen und mit 0.3 - 1 mL/min Flussgeschwindigkeit

eluiert. Die Fraktionsgröße betrug im Elutionsbereich 3 - 5 mL.

3.4.3 Reinigung der Urocanase

Reinigung der Urocanase mittels Anionenaustauschchromatographie

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 40 mL Uro-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 5 sek Schall, 10 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt.

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Anionenaustauschchromatographie (Q-Sepharose-FF-Säule) unterworfen, die Detektion

erfolgte durch Absorptionsmessung bei 280 nm und 330 nm, dem Absorptionsmaximum des

NAD + -Cofaktors. Die Elution erfolgte durch graduelle Erhöhung der Salz-Konzentration

(Programm I). Urocanasehaltige Fraktionen wurden mittels SDS-PAGE identifiziert und

63


3 Methoden

vereinigt. Verunreinigungen wurden über eine zweistufige Ammoniumsulfatfällung

abgetrennt. Dazu wurde zunächst fein gemörsertes Ammoniumsulfat bis zu einer 45%igen

Sättigung (277 g/L Ammoniumsulfat) langsam zugegeben und für mehrere Stunden bei 4°C

schwach gerührt. Anschließend wurde der Ansatz bei 43000*g und 4°C eine Stunde lang

zentrifugiert und der urocanasehaltige Überstand abgenommen. Die Ammoniumsulfatkonzentration

im Überstand wurde dann auf 65% Sättigung erhöht (Zugabe von 132 g/L

Ammoniumsulfat), wieder einige Stunden gerührt und wie zuvor abzentrifugiert. Das

urocanasehaltige Pellet wurde in 2-4 mL GPC-A-Puffer resuspendiert und zur Entfernung von

Schwebteilchen und großen Aggregaten 10 Minuten bei 16000*g zentrifugiert. Der Überstand

wurde als abschließender Reinigungsschritt einer GPC an einer HiLoad-26/60 Superdex-200

prep grade (Säule II) mit GPC-A-Puffer unterworfen (Abschnitt 3.4.2), die Detektion erfolgte

bei 280 nm. Säulenparameter und Pufferzusammensetzung sind in Abschnitt 3.4.1

zusammengefasst.

Tabelle 3.4.4

Programm I

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 2 CV 0 5

Probenauftrag 30 - 50 mL 0 2

Waschen 2 CV 0 5

Elution Gradient 1

Gradient 2

Gradient 3

1 CV

10 CV

1 CV

0 - 5

5 - 40

40 - 55

3.5

3.5

3.5

Nachwaschen 1 CV 100 3.5

Reinigung der Urocanase mittels Affinitätschromatographie

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 40 mL His-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 5 sek Schall, 10 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt.

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Affinitätschromatographie (Ni-Säule II) unterworfen. Die Detektion erfolgte durch

Absorptionsmessung bei 280 nm und 330 nm, wo der NAD + -Cofaktor absorbiert. Die Elution

erfolgte zunächst durch graduelle Erhöhung der Imidazolkonzentration (Programm II), später

64


3.4 Proteinreinigung

wurde dieser Gradient durch eine Stufenelution ersetzt (Programm III). Urocanasehaltige

Fraktionen wurden mittels SDS-PAGE identifiziert, vereinigt und aufkonzentriert (MWCO

50 kDa). Als abschließender Reinigungsschritt wurde eine GPC an einer HiLoad-26/60

Superdex-200 prep grade (Säule II) mit GPC-A-Puffer durchgeführt (Abschnitt 3.4.2), die

Detektion erfolgte bei 280 nm. Säulenparameter und Pufferzusammensetzung sind in

Abschnitt 3.4.1 zusammengefasst.

Tabelle 3.4.5

Programm II

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 3 CV 0 4

Probenauftrag 10 - 30 mL 0 1.5

Waschen

3 CV

4 CV

0

0

2

4

Elution Gradient 1

Gradient 2

6 CV

1 CV

0 - 30

30 - 100

3

3

Nachwaschen 5 CV 100 3

Tabelle 3.4.6

Programm III

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 3 CV 0 3

Probenauftrag 10 - 30 mL 0 1

Waschen 3 CV

4 CV

3CV

0

0

20

3

4

3

Elution 3 CV 100 3

3.4.4 Reinigung von PEX19

Reinigung von PEX19 als GST-Fusionsprotein

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 30 mL PBS pro L Kultur

resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter Eiskühlung

aufgeschlossen (1 min Gesamtschallzeit/10 mL, 1 sek Schall, 2 sek Pause). Die unlöslichen

Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt. Der

Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend auf eine mit PBS

65


3 Methoden

äquilibrierte GSTrap-Säule aufgetragen. Nach einem Waschschritt mit 50 mL PBS wurde über

Nacht auf der Säule mit Thrombin PEX19 von der GST abgespalten. Dazu wurden 300 U

Thrombin in 5 mL PBS wiederholt mit einer manuellen Pumpe über die Säule gespült. Die

Elution erfolgte mit insgesamt 10 mL PBS, die GST wurde mit 10 mL GSH-Puffer eluiert. Die

Eluate wurden mittels SDS-PAGE analysiert und PEX19-haltige Fraktionen mit einem

Konzentrator (MWCO 10 kDa) durch Zentrifugation bei 3000*g aufkonzentriert. Als

abschließender Reinigungsschritt erfolgte eine GPC (Abschnitt 3.4.2) an einer HiLoad-26/60

Superdex-75 prep grade mit GPC-A-Puffer, die Detektion erfolgte durch Absorptionsmessung

bei 280 nm. PEX19-haltige Fraktionen wurden mittels SDS-PAGE identifiziert und Fraktionen

mit reinem Protein vereinigt und wie oben aufkonzentriert. Säulenparameter und

Pufferzusammensetzung sind in Abschnitt 3.4.1 zusammengefasst.

Reinigung von PEX19 als His 6 -Fusionsprotein

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 10 mL His-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 1 sek Schall, 2 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt.

• mit Faktor Xa-Schnittstelle

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Affinitätschromatographie (Ni-Säule II) unterworfen. Waschen und Elution erfolgten durch

einen linearen Imidazolkonzentrationsgradienten (Programm IV). Die Detektion erfolgte hier

und bei allen folgenden Schritten durch Absorptionsmessung bei 280 nm. Proteinhaltige

Fraktionen wurden mittels SDS-PAGE analysiert und His 6 -PEX19-haltige Fraktionen mit

einem Konzentrator (MWCO 10 kDa) durch Zentrifugation bei 3000*g aufkonzentriert. Die

Proteinlösung wurde gegen 50 mM Tris (pH 8.0) dialysiert (100faches Volumen), mit 2x

Xa-Schneidepuffer versetzt (Endkonzentration 50 mM Tris, 100 mM NaCl, 5 mM CaCl 2 ,

pH 8.0) und über Nacht bei 4°C mit 2 U Faktor Xa/mg Protein inkubiert. Die Abtrennung von

Faktor Xa sowie ungeschnittenem Protein erfolgte durch eine zweite Affinitätschromatographie

an Ni-Säule II. Dazu wurde das Protein auf die mit His-A-Puffer äquilibrierte

66


3.4 Proteinreinigung

Säule aufgetragen, mit 10 mL His-A-Puffer nachgewaschen und anschließend mit 10 mL His-

B-Puffer eluiert. Das im Durchfluss (His-A-Puffer-Fraktionen) befindliche PEX19 wurde

aufkonzentriert und als abschließenden Reinigungsschritt einer GPC an einer HiLoad-26/60

Superdex-200 prep grade Säule (Säule I) mit GPC-A-Puffer unterworfen (Abschnitt 3.4.2).

PEX19-haltige Fraktionen wurden mittels SDS-PAGE identifiziert, Fraktionen mit reinem

Protein vereinigt und mit einem Konzentrator (MWCO 30 kDa) aufkonzentriert.

Säulenparameter und Pufferzusammensetzung sind in Abschnitt 3.4.1 zusammengefasst.

Tabelle 3.4.7

Programm IV

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 5 CV 0 3

Probenauftrag 10 - 30 mL 0 1

Waschen 11 CV 0 3

Elution 10 CV 0 – 40 3

Nachwaschen 2 CV 100 3

• mit TEV-Schnittstelle

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Affinitätschromatographie (Ni-Säule I) unterzogen, die Detektion erfolgte hier und bei allen

folgenden Schritten durch Absorptionsmessung bei 280 nm. Waschen und Elution erfolgten

mit einem Imidazol-Stufengradienten (Programm V). Proteinhaltige Fraktionen wurden mittels

SDS-PAGE analysiert und His 6 -TEV-PEX19-haltige Fraktionen mit einem Konzentrator

(MWCO 30 kDa) durch Zentrifugation bei 3000*g aufkonzentriert. Die Spaltung vom

Polyhistidinrest erfolgte mit 1 mg TEV-Protease/50 mg Fusionsprotein über Nacht bei 4°C bei

gleichzeitiger Dialyse (Dialyseschlauch MWCO 14 kDa) gegen His-A-Puffer (100faches

Volumen) zur Entfernung von Imidazol. Das geschnittene Protein wurde zur Abtrennung der

polyhistidinfusionierten TEV-Protease und des Polyhistidinrests erneut auf die mit His-A-

Puffer äquilibrierte Affinitätssäule (Ni-Säule I) aufgetragen, mit 80 mL His-A-Puffer und

anschließend mit 40 mL His-B-Puffer eluiert. Das im Durchfluss (His-A-Puffer-Fraktionen)

befindliche PEX19 wurde aufkonzentriert und als abschließendem Reinigungsschritt einer

GPC an einer HiLoad-26/60 Superdex-200 prep grade Säule (Säule II) mit GPC-A-Puffer

unterworfen (Abschnitt 3.4.2). PEX19-haltige Fraktionen wurden mittels SDS-PAGE

67


3 Methoden

identifiziert, Fraktionen mit reinem Protein vereinigt und mit einem Konzentrator (MWCO 30

kDa) aufkonzentriert. Säulenparameter und Pufferzusammensetzung sind in Abschnitt 3.4.1

zusammengefasst.

Tabelle 3.4.8

Programm V

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 2 CV 0 4

Probenauftrag 30 - 50 mL 0 2

Waschen 6 CV 8 4

Elution 2 CV 50 4

Nachwaschen 3 CV 100 4

3.4.5 Reinigung von PEX19 76-271 als His 6 -Fusionsprotein

Die Reinigung von PEX19 76-271 erfolgte analog zum Volllängenprotein (Abschnitt 3.4.4),

allerdings mit einer leichten Variation der Affinitätschromatographie (Ni-Säule I, Programm

VI).

Tabelle 3.4.9

Programm VI

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 2 CV 0 5

Probenauftrag 30 - 50 mL 0 2

Waschen 11 CV 8 5

Elution 15 CV 0 – 50 4

Nachwaschen 2 CV 100 5

3.4.6 Reinigung von PEX3 34-373 als Thioredoxin-His 6 -Fusionsprotein

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 15 mL His-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 1 sek Schall, 2 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt.

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Affinitätschromatographie (Ni-Säule I) unterworfen, die Detektion erfolgte hier und bei allen

68


3.4 Proteinreinigung

folgenden Schritten durch Absorptionsmessung bei 280 nm. Waschen und Elution erfolgten

durch schrittweise Erhöhung der Imidazolkonzentration (Programm VII). PEX3 34-373 -

Fusionsprotein-haltige Fraktionen wurden mit einem Konzentrator (MWCO 30 kDa) durch

Zentrifugation bei 3000*g aufkonzentriert. Die Spaltung vom Thioredoxin-His 6 -Rest erfolgte

mit 1 mg TEV-Protease/50 mg Fusionsprotein über Nacht bei 4°C bei gleichzeitiger Dialyse

(Dialyseschlauch MWCO 14 kDa) gegen His-A-Puffer (100faches Volumen) zur Entfernung

von Imidazol. Das geschnittene Protein wurde zur Abtrennung der polyhistidinfusionierten

TEV-Protease und des Thioredoxin-His 6 -Rests erneut auf die mit His-A-Puffer äquilibrierte

Affinitätssäule (Ni-Säule I) aufgetragen und mit 40 mL His-A-Puffer und anschließend mit

60 mL His-B-Puffer eluiert. Das im Durchfluss (His-A-Puffer-Fraktionen) befindliche

PEX3 34-373 wurde aufkonzentriert, mit MonoQ-A-Puffer 1:10 verdünnt und als abschließenden

Reinigungsschritt einer Anionenaustauschchromatographie an einer MonoQ-Säule

unterworfen. Die Elution erfolgte durch eine graduelle Erhöhung der Salzkonzentration

(MonoQ-B-Puffer, Programm VIII). PEX3 34-373 -haltige Fraktionen wurden mittels SDS-PAGE

analysiert, Fraktionen mit reinem Protein vereinigt und mit einem Konzentrator (MWCO

30 kDa) aufkonzentriert. Säulenparameter und Pufferzusammensetzung sind in Abschnitt 3.4.1

zusammengefasst.

Tabelle 3.4.10

Programm VII

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 3 CV 0 5

Probenauftrag 30 - 50 mL 0 2

Waschen 1 3 CV 0 5

Waschen 2 7 CV 10 5

Elution 3 CV 50 3

Nachwaschen 2 CV 100 5

Tabelle 3.4.11

Programm VIII

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 5 CV 0 1

Probenauftrag 10 - 15 mL 0 0.5

Waschen 10 CV 0 1

Elution 75 CV 0 - 100 1

Nachwaschen 5 CV 100 1

69


3 Methoden

3.4.7 Reinigung der TEV-Protease

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 12 mL TEV-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 5 sek Schall, 10 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (45 min, 4°C und 43000*g) abgetrennt.

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend über eine

Affinitätschromatographie (Ni-Säule III) gereinigt, die Detektion erfolgte durch

Absorptionsmessung bei 280 nm. Die Elution erfolgte durch graduelle Erhöhung der

Imidazolkonzentration durch Beimischen von TEV-B-Puffer (Programm IX). Fraktionen, die

TEV-Protease enthielten, wurden mittels SDS-PAGE identifiziert und vereinigt. Für die

anschließende Kationenaustauschchromatographie wurde die Proteinlösung mit dem

vierfachen Volumen TEV-A-Puffer verdünnt. Die IEC erfolgte an einer Resource S-Säule mit

einem Gradienten von TEV-A-Puffer gegen TEV-C-Puffer gemäß Programm X. Die

proteasehaltigen Fraktionen wurden auf 1 mg/mL und 20% (v/v) Glycerin eingestellt und in

Aliquots bei -80°C gelagert. Säulenparameter und Pufferzusammensetzung sind in Abschnitt

3.4.1 zusammengefasst. Die Ergebnisse der Reinigung sind in Anhang V zu finden.

Tabelle 3.4.12

Programm IX

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 2 CV 0 2

Probenauftrag 30-50 mL 0 2

Waschen 3 CV 0 2

Elution 3 CV 0 - 50 2

Nachwaschen 2 CV 100 2

Tabelle 3.4.13

Programm X

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 2 CV 0 3

Probenauftrag 100-150 mL 0 3

Waschen 3 CV 0 3

Elution 6 CV 0 - 50 3

Nachwaschen 2 CV 100 3

70


3.4 Proteinreinigung

3.4.8 Reinigung von DHPH

Die gemäß Abschnitt 3.1.3 gewonnenen Bakterien wurden in 20 mL His-A-Puffer pro L

Kultur resuspendiert, 10 U Benzonase/mL Lysat zugegeben und mittels Ultraschall unter

Eiskühlung aufgeschlossen (1 min Gesamtschallzeit/10 mL, 1 sek Schall, 2 sek Pause). Die

unlöslichen Bestandteile wurden durch Zentrifugation (30 min, 4°C und 43000*g) abgetrennt.

Der Überstand wurde durch eine 0.45 µm-Membran filtriert und anschließend einer

Affinitätschromatographie (Ni-Säule I) unterworfen. Die Detektion erfolgte hier und bei allen

folgenden Schritten durch Absorptionsmessung bei 280 nm und 450 nm, wo der FAD-

Cofaktor absorbiert. Waschen und Elution erfolgten mit einem Imidazolkonzentrationsgradienten

(Programm XI). DHPH-haltige Fraktionen wurden mit einem Konzentrator

(MWCO 30 kDa) durch Zentrifugation bei 3000*g aufkonzentriert und für mehrere Tage bei

4°C inkubiert. Dabei ausgefallenes Protein wurde durch Zentrifugation (16000*g, 30 min,

4°C) abgetrennt, der Überstand mit MonoQ-A2-Puffer 1:10 verdünnt und als abschließenden

Reinigungsschritt einer Anionenaustauschchromatographie an einer MonoQ-Säule

unterworfen. Die Elution erfolgte durch eine graduelle Erhöhung der Salzkonzentration

(MonoQ-B2-Puffer, Programm XII). DHPH-haltige Fraktionen wurden mittels SDS-PAGE

analysiert, Fraktionen mit reinem Protein vereinigt und mit einem Konzentrator (MWCO

30 kDa) aufkonzentriert. Säulenparameter und Pufferzusammensetzung sind in Abschnitt 3.4.1

zusammengefasst.

Tabelle 3.4.14

Programm XI

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 1.5 CV 0 5

Probenauftrag 30 – 50 mL 0 3

Waschen 10 CV 0 5

Elution 6 CV 0 - 100 4

Nachwaschen 2 CV 100 5

Tabelle 3.4.15

Programm XII

Schritt Volumen %B Flussgeschwindigkeit

[mL/min]

Äquilibrierung 5 CV 0 1

Probenauftrag 0.3 - 1 mL 0 0.3

Waschen 5 CV 0 1

Gradient 1

Gradient 2

5 CV

15 CV

0 - 50

50 - 100

1

1

Nachwaschen 5 CV 100 1

71


3 Methoden

3.5 Röntgenkristallographische Methoden

3.5.1 Kristallisation

Für die Kristallisation wurden die Proteine aufkonzentriert und gegebenenfalls dialysiert. Die

Parameter der eingesetzten Proteinlösungen sind in Tabelle 3.5.1 zusammengefasst.

Tabelle 3.5.1 Übersicht über Proteinlösungen für Kristallisationsversuche

Protein Konzentration Ausgangspuffer

MTX 10 mg/mL 5 mM Tris, pH 8.5 (HCl)

DHPH 8 mg/mL 40 mM HEPES, 100 mM NaCl, 10% (v/v)

Glycerin, pH 7.4 (NaOH)

Urocanase 10 mg/mL 10 mM Tris, 0.1% β-ME, pH 7.0 (HCl)

PEX19 10 - 400 mg/mL 10 mM Tris, 0.1% β-ME, pH 8.0 (HCl)

PEX3 34-373 4 mg/mL 10 mM Tris, 0.1% β-ME, pH 8.0 (HCl)

Komplex PEX19

PEX3

4 - 32 mg/mL

2 - 16 mg/mL

10 mM Tris, 0.1% β-ME, pH 8.0 (HCl)

10 mM Tris, 0.1% β-ME, pH 8.0 (HCl)

aus GPC 30-50 mg/mL 10 mM Tris, 0.1% β-ME, pH 8.0 (HCl)

Sämtliche Kristallisationsversuche wurden mittels Gasphasendiffusion durchgeführt. Zum

Auffinden von initialen Kristallisationsbedingungen wurde die sitting drop-Methode

verwendet. Für diese Screens wurden kommerzielle sparse matrix screens eingesetzt, die auf

einer statistischen Analyse erfolgreicher Kristallisationsbedingungen beruhen. Dazu wurden in

96er-Platten (Hampton Research) je 70 µL der Kristallisationsbedingungen als Reservoir

vorgelegt und auf den dafür vorgesehenen Absätzen je 1 µL der Proteinlösung mit 1 µL

Reservoirlösung ohne Mischen zusammenpipettiert. Die Boxen wurden mit Crystal Clear

Tape abgedichtet und in der Regel bei 20°C (abweichend auch bei 4°C oder 37°C) gelagert.

Wurden initiale Kristallisationsbedingungen gefunden, so wurden diese durch Verfeinerung

von pH-Wert, Fällungsmittelkonzentration und Salzkonzentration verfeinert. Auch das

Verhältnis von Proteinlösung und Reservoirpuffer im Ansatz wurde variiert. Zusätzlich wurde

die Zugabe von Additiven und Detergenzien nach Anleitung des Herstellers (Hampton

Research), aber im halb so großen Ansatz getestet. Weiterhin wurde die Kristallisation im Gel

72


3.5 Röntgenkristallographische Methoden

durch Zugabe von 0.4% (w/v) low melting Agarose (Konzentration in der verwendeten

Proteinlösung) eingesetzt. Alle Verfeinerungsansätze wurden mittels der hanging drop-

Methode in Linbro-Kultur-Boxen aus der Zellkultur mit 24 Kammern und silikonisierten

Deckplättchen durchgeführt, die mit Silikonöl abgedichtet wurden. Das maximale

Tropfenvolumen betrug 6 µL, äquilibriert wurde gegen ein Reservoir mit 500 µL

Kristallisationspuffer.

Zur Verbesserung der Kristallqualität wurde außerdem das microseeding-Verfahren eingesetzt.

Dazu wurden mittels eines Pferdehaares Kristalle in einem Tropfen zerstört und Keime in

einen frisch angesetzten Kristallisationstropfen überführt. Dadurch kann auch in Bedingungen,

bei denen die labile Phase (noch) nicht erreicht wurde, Kristallwachstum stattfinden, sofern sie

in die metastabile Phase gelangen. Sofern es gelingt, nur wenige Keime zu überführen, können

so wenige große Kristalle erhalten werden.

Kokristallisations- und Tränkversuche

Zum Einbringen von Substrat in das aktive Zentrum von DHPH wurden Kokristallisationsund

Tränkversuche durchgeführt. Für Kokristallisationsversuche wurde das Protein mit dem

entsprechenden Substrat in der gewünschten Konzentration (10facher molarer Überschuss)

gemischt, mindestens eine Stunde bei 4°C inkubiert und anschließend für

Kristallisationsversuche eingesetzt. Für Tränkversuche wurde eine 20 - 50 mM Lösung direkt

zu einem Kristalle enthaltenen Tropfen pipettiert, dabei wurden maximal 10% des

Tropfenvolumens hinzupipettiert. Die Tropfen wurden zwischen einer Stunde und 2 Tagen

bei 20°C inkubiert. Folgende Stammlösungen wurden verwendet:

2,6-Dihydroxypyridin: 1 M in DMSO

2,3-Dihydroxypyridin: 0.1 M in DMSO

2,6-Dimethoxypyridin: 100% (v/v), entspricht 7 M

NAD + : 100 mM in Wasser

NADH: 20 mM in Wasser

Zum Soaken von Schwermetallen wurden diese entweder als kleine Körnchen oder als

gesättigte Lösungen zu den Tropfen hinzugegeben. Für Schwermetallsoaks der PEX3-PEX19-

Komplexkristalle wurden Tantal, Gold und Platin eingesetzt. Die Kristalle wurden in

73


3 Methoden

regelmäßigen Abständen unter dem Mikroskop auf morphologisch sichtbare Schäden

untersucht und zwischen 10 min und 24 Stunden bei 20°C inkubiert.

Cryo-Schutz und Montage von Kristallen in cryo-loops

Da sämtliche Messungen zum Schutz vor Strahlenschäden bei 100 K durchgeführt wurden,

wurde zunächst für alle Kristalle verschiedener Kristallisationsbedingungen ein Cryoreagenz

zur Vermeidung von Eiskristallen gesucht. Dabei wurden Glycerin, Methylpentandiol (MPD),

niedermolekulare PEG-Substanzen, Alkohole und Zucker getestet. Für sämtliche zur

Strukturlösung verwendeten Kristalle erwies sich Glycerin als geeignetes Cryomittel. Eine

schrittweise Erhöhung der Glycerinkonzentration führte dabei bei keinem Kristall zu einem

verbesserten Diffraktionsvermögen. Vielmehr war besonders bei MTX-Kristallen eine

möglichst kurze Inkubation im Cryopuffer vonnöten, um Schäden an den Kristallen zu

minimieren.

Für die Überführung der Proteinkristalle in ihren jeweiligen Cryopuffer wurden diese mit

cryo-loops (Hampton Research) aus ihrem Tropfen gefischt, in einen Tropfen mit Cryopuffer

überführt und für kurze Zeit inkubiert. Anschließend wurden sie mit den cryo-loops aus dem

Cryopuffer gefischt und direkt in flüssigen Stickstoff schockgefroren. Bis zur Messung am

Synchrotron wurden die Kristalle in flüssigem Stickstoff aufbewahrt.

Für DHPH (Kristallisationsbedingung V) war das Erstellen eines Cryoprotokolls nicht nötig,

da es bereits unter Cryobedingungen kristallisierte. Die Kristalle wurden direkt aus den

Tropfen gefischt und schockgefroren.

Tabelle 3.5.2 Cryoprotokolle für vermessene Proteinkristalle

Protein Cryoschutzmittel * Inkubationszeit

Urocanase 35% (v/v) Glycerin 1 – 5 min

PEX3, Bed. I [111] 25% (v/v) Glycerin 1 – 5 min

PEX3, Bed. II [111] 35% (v/v) Glycerin 1 – 5 min

PEX3-PEX19-Komplex 35% (v/v) Glycerin 1 – 10 min

MTX, Bed. I und II 35% (v/v) Glycerin < 1min

DHPH, Bed. I 30% (v/v) MPD < 1 min

* Anteil an Cryoschutzmittel im Kristallisationspuffer

74


3.5 Röntgenkristallographische Methoden

3.5.2 Datensammlung und -prozessierung sowie vorläufige Analysen

Datensammlung

Sämtliche Daten wurden am SLS (beamlines PX06 und PX10) sowie am BESSY (beamlines

BL14.1 und BL14.2) gesammelt. Dazu wurden die Kristalle in 0.5°- Schritten (MTX) bzw.

1°-Schritten (alle anderen) gedreht und dabei jeweils ein image aufgenommen. Die

Belichtungszeit betrug zwischen einer (SLS) und acht (BESSY) Sekunden. Für die Messung

nativer Datensätze wurde bei einer Wellenlänge von ca. 1 Å (ca. 12.4 keV) gemessen. Für die

Durchführung von MAD-Messungen wurde zunächst ein Fluoreszenzscan durchgeführt und

anhand dessen die geeigneten Wellenlängen für die Aufnahmen der peak-, inflection- und

high remote-Datensätze bestimmt (Abschnitt 3.5.3).

Prozessierung, Skalierung und Reduktion der Daten

Sämtliche im Laufe dieser Arbeit gesammelten Daten wurden mittels XDS [112] prozessiert.

Dabei wurden zunächst mögliche Raumgruppen des Kristalls bestimmt und die Reflexe

entsprechend indiziert. Da XDS nur die möglichen Bravais-Typen ermittelt, denen in der

Regel mehrere Raumgruppen zugeordnet werden können, musste die Entscheidung für die

richtige Raumgruppe nach Integration und Skalierung der Daten in den möglichen

Raumgruppen gefällt werden. Dazu wurden die Statistiken der möglichen Raumgruppen eines

Bravais-Gitters anhand von R merge-I (Gleichung 3.5.2) und dem Signal-Rausch-Verhältnis (I/σ)

bewertet. Zur Detektion von Schraubachsen wurden systematische Auslöschungen analysiert.

Die indizierten und integrierten Reflexintensitäten wurden nach Feststellung der endgültigen

Raumgruppe mittels der im XDS-Paket enthaltenen Programme XSCALE und XDSCONV

skaliert und reduziert. Bei nativen Datensätzen wurden dabei neben den

symmetrieverwandten Reflexen auch die Friedel-Paare (Gleichung 3.5.6) zusammengefasst.

Die zur Bewertung der Datenquellen üblichen statistischen Qualitätskriterien – R sym-I

(Gleichung 3.5.1), R merge-I (Gleichung 3.5.2), I/σ, Multiplizität und Vollständigkeit – wurden

XSCALE entnommen. Auch der Wilson-B-Faktor wird von XSCALE ermittelt. Waren

Raumgruppe und Zellparameter bekannt, so wurden die Daten mit dem Programm APRV

[113] ausgewertet. Dieses führt die einzelnen Schritte der Programme XDS, XSCALE und

XDSCONV automatisch durch und optimiert sie.

75


3 Methoden

Die Daten wurden mittels phenix.xtriage [114] auf Verzwilligung, Eisringe oder sonstige

Unregelmäßigkeiten untersucht.

R

merge−

I

R

sym−

I

=

1 ⎛


2 ⎝

=

hkl

∑∑

hkl

∑∑

hkl

n

n

hkl

∑∑

hkl i=

1

hkl i=

1

n

i=

1

I

I

I

( hkl) − I ( hkl)

n

hkl

∑∑

hkl i=

1

I

i

( hkl)

( hkl) − I( hkl)

i∈P

i

n

i∈Q

hkl

( hkl) + ∑∑ ( )

⎟ i∈P

I hkl

i∈Q

hkl i=

1 ⎠


Gleichung 3.5.1

Gleichung 3.5.2

mit I(hkl) i = Intensität des iten Reflexes

〈I(hkl)〉 = mittlere Intensität aller Reflexe

Q, P = zwei Teilsets des Datensatzes

Umgang mit verzwillingten Daten

Verzwilligung ist eine Störung im Kristallwachstum, bei der der Kristall aus verschiedenen

Teilen besteht, die eine unterschiedliche Orientierung zueinander aufweisen. Generell werden

zwei verschiedene Arten der Verzwilligung unterschieden. Bei der epitaxialen Verzwilligung

überlagern die Kristallgitter in weniger als drei Dimensionen, so dass das Diffraktionsbild

mehr als zwei Diffraktionsmuster aufweist. Die epitaxiale Verzwilligung ist daher am

Reflektionsmuster erkennbar. Die merohedrale Verzwilligung ist dagegen nicht am

Diffraktionsmuster erkennbar, weil die Kristallgitter der verschiedenen Subkristalle in allen

drei Dimensionen überlappen. Dies kann auftreten, wenn die Rotationssymmetrie des

Kristallgitters größer ist als die Rotationssymmetrie der Raumgruppe. Am häufigsten tritt die

hemihedrale Verzwilligung auf, bei der zwei verschiedene Orientierungen im Kristall

vorhanden sind. Durch die Verzwilligung besteht jeder gemessene Reflex aus den Beiträgen

beider Kristallgitter und die Intensität entspricht eigentlich einer gewichteten Summe zweier

kristallographisch verschiedener Intensitäten I(hkl) und I(h ′ k ′ l ′) der Zwillingsreflexe. Das

fraktionelle Volumen des Kristalls, das durch ein Muster eingenommen wird, wird als

Verzwilligungsgrad α bezeichnet. Für die gemessene Intensität I gilt dann:

I = α ⋅ I( khl)

+ (1 −α)

⋅(

h'

k'

l')

Gleichung 3.5.3

76


3.5 Röntgenkristallographische Methoden

Ist α fast 0.5, so wird von einem perfekten Zwilling gesprochen. Die Intensitäten lassen sich

dann nicht mehr auseinander rechnen und die Daten scheinen zu einer höheren

Symmetriegruppe zu gehören, als dies tatsächlich der Fall ist. Dies kann festgestellt werden,

indem die Wilson-Statistik der Reflexe betrachtet wird. Dies geschieht beispielsweise beim

H-Test, der das Verhältnis 〈I 2 〉/〈I〉 2 betrachtet. Dieses ist 1.5 für perfekt verzwillingte

(azentrische) Daten und 2.0 für unverzwillingte (azentrische) Reflexe [115]. Die Berechnung

des Verzwilligungsfaktors wurde in dieser Arbeit mittels phenix.xtriage [114] durchgeführt.

Ist α deutlich von 0.5 verschieden (partielle Verzwilligung), so lassen sich bei genauer

Bestimmung von α die tatsächlichen Intensitäten berechnen. Dafür wurde in der vorliegenden

Arbeit das Programm DETWIN (ccp4-suite [116]) genutzt.

Bestimmung von Lösungsmittelgehalt und Anzahl der Protomere in der ASU

Eine statistische Untersuchung bekannter Kristallstrukturen zeigt, dass Proteinkristalle

zwischen 27 und 80% Solvens enthalten [117]. Dieses Wissen ist häufig ausreichend, um die

Anzahl von Monomeren in der asymmetrischen Einheit vorherzusagen, sofern Zellparameter

und Raumgruppe bekannt sind. Dazu wird der Packungsparameter oder Matthews-Koeffizient

V M für verschiedene Anzahl n an Molekülen in der asymmetrischen Einheit berechnet

(Gleichung 3.5.4). Solche Werte für n, in denen sich V M zwischen 1.7 und 3.5 Å 3 /Da bewegt,

gelten als sehr wahrscheinlich und entsprechen laut Gleichung 3.5.5 einem Solvensgehalt

zwischen 27 und 65%. Die meisten Proteinkristalle besitzen einen V M um 2.2 Å 3 /Da und

damit einen Solvensgehalt von 43%. Daher sind Werte für n, die zu einem V M nahe dem

Maximum führen, wahrscheinlicher als solche, die extreme Packungen bedeuten würden.

Mögliche Werte für n und den Matthews-Koeffizienten wurden mit MATTHEWS_COEFF

(ccp4-suite [116]) ermittelt.

V

V

M

solv

Vz

=

n ⋅ z ⋅ M

r

1.23

= 1−

V

M

Gleichung 3.5.4

Gleichung 3.5.5

mit V Z = Volumen der Elementarzelle

n = Anzahl Moleküle pro asymmetrischer Einheit

z = Anzahl asymmetrischer Einheiten pro Elementarzelle

M r = molekulare Masse

= Solvensgehalt, fraktionelles Solvensvolumen

V solv

77


3 Methoden

Einen weiteren Anhaltspunkt zur Anzahl der Moleküle in der asymmetrischen Einheit liefert

häufig die Analyse der Selbstrotationsfunktionen. Dazu wird die Patterson-Funktion eines

Datensatzes um eine Achse mit einem bestimmten Winkel κ gedreht und auf sich selbst

abgebildet. Die Lage der Achse wird durch χ und ω gegeben. Liefert diese

Selbstrotationsfunktion bei κ=360/n ein Maximum, so liegt eine n-zählige Symmetrieachse

vor. Neben den kristallographischen Symmetrieachsen können so auch nichtkristallographische

Symmetrien (NCS) gefunden werden. Liegt bei mehreren Monomeren in

der kristallographischen Einheit eine nichtkristallographische Symmetrie vor, die neben der

Rotationskomponente auch eine Translationskomponente enthält, so kann diese nicht über die

Analyse der Selbstrotationsfunktionen ermittelt werden. Selbstrotationsfunktionen wurden

mittels MOLREP (ccp4-suite [116]) berechnet.

3.5.3 Phasierung

Molekularer Ersatz

Die Methode des molekularen Ersatzes (molecular replacement, MR) kann zur Phasierung

genutzt werden, wenn die Struktur des Proteins, eines Teil des Proteins oder eines homologen

Proteins bereits bekannt ist. Dabei erfolgt über eine dreidimensionale Rotationssuche mit

anschließender dreidimensionaler Translationssuche die Platzierung des Suchmodells in der

Einheitszelle. In der vorliegenden Arbeit wurde das Programm PHASER verwendet [118], das

auf der maximum likelihood-Methode basiert. Bei diesem werden gute Lösungen durch einen

Z-Score der Translationssuche von über 6.0 angezeigt.

Der molekulare Ersatz konnte für die Aufklärung der Urocanase-Tetramerstruktur sowie der

MTX-Holotoxin-Struktur genutzt werden. Für die Urocanase wurde als Suchmodell die

Kette A der durch D. Kessler gelösten Struktur (pdb-code 1uwl) verwendet [27] und nach vier

Monomeren in der asymmetrischen Einheit gesucht. Für MTX konnte zum einen die Struktur

der katalytischen Domäne [84] für die Suche verwendet werden, zum anderen wurde für die

ricinähnlichen Domänen ein Suchmodell mittels der Server FFAS03 [119] und SCWRL [120]

erstellt. Der FFAS03-Server kann durch Erstellen eines Profils auch bei geringer Homologie

die Zuordnung zu einer Proteinfamilie vornehmen und liefert, sofern für diese Proteinfamilie

Strukturinformationen vorhanden sind, ein Templat. Dieses kann mittels des SCWRL-Servers

weiter verbessert werden. Dieser ersetzt die Seitenketten des Templats durch die der

78


3.5 Röntgenkristallographische Methoden

gesuchten Aminosäuresequenz und kalkuliert das Energieminimum für die möglichen

Rotamerstellungen der Seitenketten. Für jede der vier vorhergesagten ricinähnlichen

Domänen wurde auf diese Weise ein „mixed model“ erstellt, bei dem zum Templat

konservierte Aminosäurereste beibehalten und alle anderen durch Serin ersetzt werden. Für

die Suche mittels PHASER wurde nach zwei katalytischen Domänen sowie acht

ricinähnlichen Domänen gesucht, wobei die Option „add superimposed pdb-file to the

ensemble“ für die vier erstellten Modelle verwendet wurde.

Multiwavelength anomalous diffraction (MAD)

Eine weitere Methode, die zur Phasierung genutzt werden kann, beruht auf der anomalen

Streuung von Röntgenstrahlen durch Schweratome. Die Elektronen der K- und L-Schale

werden angeregt, sofern die Wellenlänge der eingesetzten Strahlung in der Nähe der

Absorptionskanten dieser Elektronen liegt. Sie emittieren bei der Rückkehr in den

Grundzustand Strahlung, die eine veränderte Phasenbeziehung zur eingesetzten Strahlung und

eine geringere Intensität besitzt. Dies führt dazu, dass das Friedelsche Gesetz (Gleichung

3.5.6) seine Gültigkeit verliert. Die Intensitätsunterschiede der Friedelpaare ( h,

k,

l) /( h,

k,

l)

können zur Phasierung genutzt werden.

I ( h,

k,

l)

= I(

h,

k,

l)

( λ ) ''( λ)

f = f0 + f ' + f

Gleichung 3.5.6

Gleichung 3.5.7

mit f 0 = wellenlängenunabhängiger (normaler) Streufaktor

f ′ (λ) = reeller Anteil der anomalen Streuung

f ′ (λ)

I ( h,

k,

l)

I ( h,

k,

l)

= imaginärer Anteil der anomalen Streuung

= Intensität des Reflexes h, k, l

= Intensität des Reflexes -h, -k, -l

Die Strukturfaktoren erhalten durch die anomale Streuung einen wellenlängenabhängigen

anomalen Anteil f ′ (λ)+f ′′ (λ) (Gleichung 3.5.7). Für die Phasierung muss dieser Anteil, der

nur etwa 3% ausmacht, möglichst genau bestimmt werden. Dies gelingt, indem am Maximum

der f ′′ -Kurve (peak) und am Minimum der f ′ -Kurve (inflection point) gemessen wird. Als

dritter Datensatz wird eine Wellenlänge, die weit von der Absorptionskante entfernt liegt,

gewählt (high oder low energy remote).

79


3 Methoden

Die Strukturen von PEX3 und DHPH wurden durch die MAD-Methode gelöst. Als

Schwermetallion wurde Selen gewählt, das sich in Form von Selenomethionin leicht in

Proteine inkorporieren lässt [121] und den Vorteil besitzt, dass sich dadurch in der Regel die

Kristallisiereigenschaften des Proteins kaum ändern. Die Inkorporation von Selenomethionin

erfolgte durch Kultivierung auxotropher Bakterien in selenomethioninhaltigem Medium wie

unter Absatz 3.1.4 beschrieben. Da die genaue Lage der Absorptionskante von der Umgebung

im Kristall abhängt, wurde diese zunächst durch die Aufnahme eines Fluoreszenzspektrums

ermittelt. Die Messungen bei den drei Wellenlängen (peak, inflection und high energy remote)

wurden jeweils an einem einzigen Kristall durchgeführt. Sämtliche Daten wurden auf den

peak-Datensatz skaliert. Zur Suche und Verfeinerung der Schweratompositionen wurde

autoSHARP bzw. SHARP [122] genutzt. Die Qualität der Schweratomverfeinerung wurde

anhand von R cullis (sollte unter 0.8 liegen), figure of merit (FOM, sollte über 0.5 liegen) und

der phasing power (sollte größer als 1.0 sein) verfolgt. Zusätzlich wurden die gefundenen

Schweratompositionen anhand der durch SHARP berechneten residual maps überprüft. Bei

diesen weisen positive oder negative Maxima auf Fehler der Schweratomparameter hin.

3.5.4 Dichtemodifikation

Da die initial erhaltenen Phasen meist noch relativ ungenau sind und zu einer stark

verrauschten Elektronendichtekarte führen, deren Qualität für den Modellbau deshalb noch

nicht ausreicht, wird durch verschiedene Arten der Dichtemodifikation versucht, zunächst

bessere Phasen zu erzielen. Dabei wurde auf die Programme RESOLVE [123] sowie DM und

SOLOMON, wie sie in autoSHARP [122] implementiert sind, zurückgegriffen. Während DM

und SOLOMON auf einer iterativen Verbesserung der Dichte im Realraum und

anschließender Anpassung der Phasen im reziproken Raum basieren, wird bei RESOLVE die

maximum likelihood-Methode angewendet und dadurch eine strikte Trennung von

Messwerten und a priori-Informationen gewährleistet [124]. Zu den a priori-Informationen,

die bei der Dichtemodifikation ausgenutzt werden, gehören die Eigenschaften des Solvens

[125, 126], die Verteilung von Elektronendichte [123], nichtkristallographische Symmetrie

[126, 127] sowie die Eigenschaften von Sekundärstrukturelementen [128] und das

Vorhandensein lokaler Muster in der Elektronendichte [128, 129].

80


3.5 Röntgenkristallographische Methoden

Für die Lösungen der Strukturen mittels molekularen Ersatzes wurden die initialen Phasen

durch RESOLVE weiter verbessert. Dies galt auch für die Phasierung mittels MAD, wo die

erhaltenen Phasen zunächst durch Dichtemodifikation mittels DM und Solomon, wie sie in

autoSHARP implementiert sind, verbessert wurden. Zusätzlich wurde eine Modifikation

mittels RESOLVE durchgeführt und alle erhaltenen Elektronendichtekarten für den

Modellbau verwendet.

3.5.5 Modellbau

Automatisierter Modellbau

Zwei der am häufigsten verwendeten Programme zum automatischen Modellbau sind

ARP/wARP [130] und RESOLVE [131, 132]. Obwohl die Elektronendichtekarte für

Urocanase nach Dichtemodifikation mittels RESOLVE bereits sehr gut war, reichte sie für den

automatischen Bau mittels ARP/wARP nicht aus. Dies galt auch für die anderen Proteine,

deren Daten jedoch durchweg eine sehr viel schlechtere Auflösung aufwiesen und für die

deshalb der automatische Modellbau mittels ARP/wARP auch nicht zu erwarten war. Dagegen

konnten bei allen Strukturen zumindest Teile des Modells mit RESOLVE gebaut werden, das

im Gegensatz zu ARP/wARP mit der Erkennung von Sekundärstrukturelementen und deren

iterativen Verlängerung durch eine Bibliothek von Fragmenten arbeitet. Der Modellbau

mittels RESOLVE ist auch im PHENIX AutoBuild wizard [114, 133] enthalten, der iterativ

Modellbau, Dichtemodifikation und Verfeinerung durchführt.

Manueller Modellbau

Für den manuellen Modellbau wurde das interaktive Grafikprogramm COOT [134]

verwendet. Er erfolgte im Wechsel mit der Verfeinerung und Modifikation des Modells. Zum

manuellen Bau wurden die folgenden Elektronendichtekarten verwendet:

Lag noch kein Modell vor, so wurden (F obs )-Elektronendichtekarten verwendet, die mit FOM

(figure of merit) gewichtet wurden. Die Phasen stammten direkt aus der Dichtemodifikation.

Sobald ein Modell vorlag, konnten (2F obs -F calc )-Elektronendichtekarten berechnet werden, die

81


3 Methoden

die Elektronendichte des Modells zeigen und die bei einer Konturhöhe von 1-1.5 σ angezeigt

wurden. Wegen des starken Modelleinflusses (model bias) wurden jedoch in der Regel

σ A -gewichtete (2mF obs -DF calc )-Elektronendichtekarten verwendet, wie sie REFMAC [135]

berechnet. Differenz-Fourierkarten (F obs -F calc ) wurden verwendet, um Unterschiede zwischen

dem Modell und der tatsächlichen Struktur zu detektieren. Auch hier wurden σ A -gewichtete

(mF obs -DF calc )-Elektronendichtekarten verwendet und bei einem Konturniveau von ± 3σ

angezeigt, um fehlende oder falsch gebaute Teile der Struktur zu identifizieren.

Einbau von Wassermolekülen und Liganden

Moleküle aus der Kristallisationslösung sowie Cofaktoren wurden mittels COOT [134]

manuell gebaut. Wassermoleküle wurden für das Urocanase-Modell mittels ARP/wARP [130]

gebaut und mittels COOT und REFMAC [135] verfeinert, bei allen anderen Proteinmodellen

wurde lediglich COOT verwendet. Dabei wurden sowohl in der gewichteten (2F obs -F calc )- als

auch in der gewichteten (F obs -F calc )-Elektronendichte bei einem Konturniveau von 1 σ bzw.

3 σ gesucht. Wassermoleküle, die nach der anschließenden Verfeinerung B-Faktoren von über

80 - 100 Å 2 aufwiesen, keine Wasserstoffbrücken zum Protein oder anderen Liganden oder

Wassermolekülen ausbilden konnten oder deren Position weniger als 0.9 σ-Elektronendichte

aufwiesen, wurden entfernt. Es wurden mehrere Zyklen mit Einfügen von Wassermolekülen,

Verfeinerung mittel REFMAC sowie anschließender Analyse der Wassermoleküle und

gegebenenfalls Entfernen falsch platzierter Moleküle durchgeführt.

Konnte Elektronendichte nicht durch den Einbau von Wasser befriedigend erklärt werden, so

wurde analysiert, ob das Einbauen von Molekülen der Kristallisationslösung zu einem

besseren Modell führte. Dazu wurden Acetat, MPD und Glycerin mittels COOT in die

entsprechende Elektronendichte gebaut, das Modell mittels REFMAC verfeinert und die

resultierenden Elektronendichtekarten analysiert. Die Cofaktoren FAD und NAD + wurden

ebenfalls mit COOT eingebaut und wie andere Liganden verfeinert.

82


3.5 Röntgenkristallographische Methoden

3.5.6 Verfeinerung der Strukurmodelle

Beseitigung von model bias

Zur Minimierung des Modelleinflusses (model bias) wurden zwei Methoden angewandt. Zum

einen kann der Einfluss des Modells bei der Berechnung der (2F obs -F calc )-

Elektronendichtekarten dadurch minimiert werden, dass eine prime-and-switch-

Elektronendichtekarte mittels RESOLVE berechnet wird [123]. Dabei wird der Einfluss des

Modells durch eine Wahrscheinlichkeitsbetrachtung der Elektronendichtekarte beseitigt. Zum

anderen kann das Modell selbst durch ein simulated annealing verändert werden. Simulated

annealing wurde mit CNS [136] oder mit phenix.refine [114] durchgeführt. Dabei wird eine

Molekulardynamikrechnung unter langsamen „Abkühlen“ des Modells von Starttemperaturen

von 2500-5000 K aus durchgeführt.

Verfeinerung mittels REFMAC

Für die Verfeinerung der erstellten Strukturmodelle wurde REFMAC [135] verwendet.

REFMAC minimiert die Atomkoordinaten sowie den B-Faktor, damit sie die experimentellen

Daten bestmöglich erklären. Die Verfeinerung beruht auf der maximum-likelihood-Methode.

REFMAC ermöglicht unter anderem die Gewichtung geometrischer Parameter im Vergleich

zu den experimentellen Daten, erlaubt die Einführung unterschiedlich starker NCS-restraints

und verfügt über verschiedene Arten der Solvenskorrektur. Es verfügt außerdem über die

Option, eine TLS-Verfeinerung (translation, libration, screw rotation) durchzuführen. Diese

dient der Einbeziehung der anisotropen Verschiebung der Proteinatome in das Modell. Bei

niedrigen Auflösungen ist in der Regel das Observablen/Parameter-Verhältnis nicht

ausreichend groß, um eine anisotrope Verfeinerung der B-Faktoren des Modells zu erlauben.

Bei der TLS-Verfeinerung [137] werden Verschiebungen ganzer Atomgruppen

berücksichtigt, die als TLS-Gruppen bezeichnet werden. Pro TLS-Gruppe werden 20 neue

Parameter definiert. Für MTX wurden die einzelnen Domänen als TLS-Gruppen definiert, für

alle anderen Proteine jeweils ein Monomer. Die isotropen und anisotropen Anteile des

B-Faktors konnten mittels TLSANL und BAVERAGE (ccp4-suite [116] berechnet werden.

Der Fortschritt der Verfeinerung wurde anhand der Elektronendichtekarten sowie anhand der

R-Faktoren beobachtet. R cryst ist ein Maß für die Übereinstimmung zwischen dem

83


3 Methoden

Strukturmodell und den Observablen F obs (Gleichung 3.5.8). Da sich jedoch gezeigt hat, dass

auch falsche Modelle einen guten R cryst liefern können, wird bei der Verfeinerung ein zufällig

ausgewählter Teil (1-10%) der Reflexe, der so genannte Testdatensatz, nicht in die

Verfeinerung mit einbezogen, sondern nur zur Validierung des Modells genutzt [138]. Dabei

wird R free (Gleichung 3.5.9) in Analogie zu R cryst berechnet. Eine große Differenz zwischen

R cryst und R free weist auf overfitting, das Modellieren experimentellen Rauschens, hin.

R

cryst

=


hkl

F

obs

( hkl)

− k ⋅ F


hkl

F

obs

( hkl)

calc

( hkl)

Gleichung 3.5.8

R

free

=


hkl∈T

F

obs

( hkl)

− k ⋅ F


hkl∈T

F

obs

( hkl)

calc

( hkl)

Gleichung 3.5.9

mit F obs (hkl) = gemessene Strukturfaktoramplitude des Reflexes h, k, l

F calc (hkl) = anhand des Modells berechnete Strukturfaktoramplitude des Reflexes h, k, l

k = auflösungsabhängiger Skalierungsfaktor

3.5.7 Validierung von Proteinstrukturen

Um die Qualität der Proteinstrukturen zu beurteilen, wurden zum einen die

kristallographischen R-Faktoren R cryst und R free (Gleichung 3.5.8 und Gleichung 3.5.9)

herangezogen, zum anderen wurden Bindungslängen und -winkel der Aminosäurereste mit

Standardwerten verglichen. Für die R-Faktoren wurden die Werte aus REFMAC [135]

übernommen, da hiermit der jeweils letzte Verfeinerungsschritt unternommen wurde. Beim

Vergleich von Bindungslängen und -winkeln wurden die Torsionswinkel des Proteinrückgrats

mittels RAMPAGE [139] überprüft. Für die Seitenketten wurde die Rotamerstellung mittels

COOT überprüft, das die Rotamerbibliothek nach Dunbrack & Cohen [134] verwendet, sowie

durch MOLPROBITY [140] validiert. Für die Kontrolle von Bindungslängen und -winkeln

wurden die mittleren Werte laut Verfeinerung mit REFMAC [135] herangezogen. Da diese

Parameter jedoch bei der Verfeinerung als Zielfunktion, die unterschiedlich stark gewichtet

werden kann, enthalten sind, ist ihre Aussage als Qualitätskriterium beschränkt. Die

Bindungslängen und -winkel sämtlicher Aminosäurereste wurden zusätzlich mit

84


3.5 Röntgenkristallographische Methoden

WHATCHECK ([141], implementiert im BIOTECH-Server (http://biotech.ebi.ac.uk)) und

MOLPROBITY [139] analysiert, ebenso wie interne räumliche Konflikte durch zu kurze

Abstände von Aminosäureresten. Wassermoleküle wurden ebenfalls mit WHATCHECK

daraufhin kontrolliert, dass sie Wasserstoffbrücken zum Protein oder anderen

Wassermolekülen oder Liganden ausbilden können.

Bei Strukturen, die mittels molecular replacement gelöst wurden, wurde zudem eine

Dichtekorrelation des fertigen Modells und der zugehörigen gewichteten (2F obs -F calc )-

Elektronendichte mittels OVERLAPMAP [116] berechnet und analysiert. Für die Darstellung

der Dichtekorrelation wurde diese durch Mittelwertbildung manuell geglättet. Dazu wurden

für die Ermittlung des Wertes für Aminosäurerest x alle Dichtekorrelationswerte der

Aminosäurereste x-2 bis x+2 gemittelt.

Proteindatenbank

Die Koordinaten der Strukturen der tetrameren Urocanase (2v7g), der beiden MTX-

Holotoxin-Modelle (2vsa (P3), 2vse (H3)) sowie der Cysteinmutante C323S von DHPH

(2vou) wurden in der RCSB-Proteindatenbank (www.pdb.org) abgelegt.

3.5.8 Strukturanalyse und -darstellung

Sekundärstruktur

Die Analyse der Sekundärstrukturelemente wurde für sämtliche Monomere der

asymmetrischen Einheit mit DSSP [142] und STRIDE [143] durchgeführt und manuell

überprüft. Bei den Strukturmodellen von MTX und Urocanase wurde außerdem darauf

geachtet, mit den bereits vorher veröffentlichten Strukturen, die eine gleiche oder bessere

Auflösung aufwiesen, konform zu gehen. Sekundärstrukturvorhersagen sowie

Oberflächenwahrscheinlichkeiten für PEX3 und PEX19 wurden mittels PredictProtein [144]

erstellt.

85


3 Methoden

Berechnung von Interaktionsflächen

Die Quartärstruktur von Proteinen sowie die Ausbildung von Kontakten im Kristall wurde

mittels PISA [3] analysiert. Die Berechnung der modellierten Interaktionsflächen von

Urocanase erfolgte davon abweichend mit NACCESS [145]. PISA berechnet zusätzlich die

Energie ∆G i , die durch die Ausbildung der Kontaktfläche frei wird. Dabei entspricht ∆G i der

Differenz der Solvatisierungsenergien der einzelnen Untereinheiten und des Komplexes

(www.ebi.ac.uk/msd-srv/prot_int/cgi-bin/piserver), berücksichtigt aber nicht den Beitrag von

Wasserstoffbrücken (0.6-1.5 kcal/mol) und Salzbrücken (0.9-1.25 kcal/mol).

Vergleich mit anderen Proteinen

Die Suche nach Proteinen mit ähnlicher Aminosäuresequenz wurde mittels PSI-BLAST [146]

durchgeführt. Sequenzalignments wurden mit CLUSTAL W [147] erstellt und mittels

GeneDoc (www.psc.edu/biomed/genedoc) analysiert.

Strukturverwandte Proteine wurden mit DALI [147] und SSM [148] identifiziert, wobei die

Suche mit DALI die besseren Ergebnisse erzielte. Mit der BLAST-Suche in der RCSB-

Datenbank gefundene Sequenzhomologe wurden mittels DALIlite [147] auf

Strukturähnlichkeit hin überprüft. Zur Berechnung der mittleren quadratischen Abweichung

(rmsd) der C α -Positionen wurden LSQMAN [149] und LSQKAB (ccp4-suite [116]) verwendet.

Dabei berücksichtigt LSQMAN nur diejenigen Aminosäurereste, die mit einer maximalen

C α -Distanz von 3.5 Å überlagert werden können. Auch für die Überlagerung von

strukturverwandten Proteinen sowie zum Erstellen strukturbasierter Sequenzalignments

wurden LSQKAB und LSQMAN verwendet, wobei für die Überlagerung vorrangig

β-Faltblätter herangezogen wurden. Strukturbasierte Sequenzalignments wurden dabei stets

manuell kontrolliert und vor allem in Loopbereichen modifiziert. Dabei galten

Aminosäurereste nur dann als überlagert, wenn dies für mindestens einen benachbarten

Aminosäurerest ebenfalls zutraf. Aminosäurereste, die in konformationell verschiedenen

Loopbereichen zufällig eine ähnliche Position einnahmen, wurden somit ausgeschlossen.

Identische Aminosäurereste, deren Position laut LSQMAN konserviert ist, wurden in Prozent

der insgesamt überlagerten Aminosäurereste angegeben.

86


3.5 Röntgenkristallographische Methoden

Für die RBL (Ricin B-like) -Domänen von MTX wurde ferner eine Suche nach Proteinen mit

ricinähnlichen Domänen mittels des INTERPRO-Servers (www.ebi.ac.uk/interpro)

durchgeführt. Dabei wurden die accession numbers (UniProtKB/TrEMBL,

www.expasy.org/sprot) aller Proteine mit einer RicinB-ähnlichen Domäne (IPR008997)

aufgelistet und manuell die Anzahl der Ricin B-ähnlichen Domänen gezählt.

Ligandenmodelle

Parameter und Modelle von untypischen Liganden wie 2,6-DHP, 2,3-DHP und 2,6-DMP

sowie Peroxyflavin wurden mittels PRODRG [150] berechnet.

Abbildungen

Zur Abbildung von Elektronendichten wurden Elektronendichtekarten im O-Format mit

REFMAC [135] berechnet. Für die Erstellung von Mono- und Stereoabbildungen der

Strukturmodelle oder Teilen der Strukturmodelle wurden die Programme POVScript+ [151]

und POVray (www.povray.org) verwendet. Für die Darstellung von Reaktionsgleichungen

oder -mechanismen wurde IsisDraw benutzt. Für Vektorkarten wurde ApE

(www.biology.utah.edu/jorgensen/wayned/ape/) verwendet.

87


4 Ergebnisse und Diskussion

4 Ergebnisse und Diskussion

4.1 Proteinkontakte

4.1.1 Reinigung der Wildtyp-Urocanase

Reinigung der Wildtyp-Urocanase mittels Anionenaustauschchromatographie

Urocanase wurde in der vorliegenden Arbeit weitgehend so gereinigt, wie bereits von

D. Kessler et al. [27] beschrieben. Das Reinigungsprotokoll besteht aus einer

Anionenaustauschchromatographie, einer zweistufigen Ammoniumsulfatfällung und einer

abschließenden GPC. Bei schlecht exprimierenden Mutanten konnte die geringe

Proteinmenge durch diese Methode nicht zufrieden stellend gereinigt werden, daher wurde in

diesen Fällen das Protein als Polyhistidinfusionsprotein produziert und für die Reinigung auf

eine Affinitätschromatographie mit anschließender GPC zurückgegriffen.

E. coli BL21(DE3)-Bakterien wurde mit dem Plasmid pT7-7.Uro transformiert und eine

Übernachtkultur hergestellt. Mit dieser Kultur wurde frisches, mit NAD + supplementiertes

LBA-Medium angeimpft und ca. 13 Stunden bei 37°C kultiviert. Nach der Zellernte wurde

das Bakterienpellet resuspendiert, mittels Ultraschall aufgeschlossen und abzentrifugiert.

Absorption [mAU]

1600

1400

1200

1000

800

600

400

200

0

A 280nm

A 330nm

(10fach vergrößert)

Leitfähigkeit [mS/cm]

% B

0 100 200 300 400 500 600

Volumen [mL]

100

90

80

70

60

50

40

30

20

10

0

Leitfähigkeit [mS/cm] // %B

Abbildung 4.1.1

Chromatogramm der Anionenaustauschchromatographie von Urocanase

Urocanasehaltige Fraktionen sind mit einem Balken markiert

88


4.1 Proteinkontakte

Der Überstand wurde filtriert und einer Anionenaustauschchromatographie an

Q-Sepharose FF unterworfen. Die Detektion der Urocanase erfolgte durch UV-Absorption bei

280 nm und 330 nm. Ein typisches Chromatogramm der Anionenaustauschchromatographie

ist in Abbildung 4.1.1 zu sehen. Urocanase-haltige Fraktionen (in Abbildung 4.1.1 durch

einen Balken gekennzeichnet) wurden vereinigt und Verunreinigungen durch eine

Ammoniumsulfatfällung mit 45% Sättigung abgetrennt. Die im Überstand enthaltene

Urocanase wurde durch Erhöhung des Ammoniumsulfatgehalts auf 65% Sättigung gefällt,

abzentrifugiert und in GPC-Puffer resuspendiert. Als abschließender Reinigungsschritt

erfolgte eine GPC auf einer HiLoad-26/60 Superdex-200 prep grade Säule (Säule II,

Abbildung 4.1.2 oder Säule I, Daten nicht gezeigt).

600

A 280nm

500

Absorption [mAU]

400

300

200

100

0

0 50 100 150 200 250 300

Volumen [mL]

Abbildung 4.1.2 Chromatogramm der GPC von gereinigter Urocanase

Wildtyp-Urocanase eluierte bei 207 ml (oder 180 ml, Säule I), was einer apparenten

Molekularmasse von 101 kDa (bzw. 140 kDa, Säule I) entspricht (Anhang IV), und damit im

Mittel gut mit der theoretischen Molekularmasse des Urocanasedimers von 2*60'780 Da

übereinstimmt. Eine analytische SDS-PAGE zeigt den Reinigungsverlauf (Abbildung 4.1.3).

89


4 Ergebnisse und Diskussion

Abbildung 4.1.3 Analytische SDS-PAGE zur Dokumentation des Reinigungsverlaufs der Urocanase

Reinigung der Wildtyp-Urocanase als Polyhistidinfusionsprotein

Da viele der unten vorgestellten „Fuss-Fuss“-Mutanten nur in sehr geringem Maße

exprimierten und die produzierte Proteinmenge für eine zufrieden stellende Aufreinigung

durch obiges Reinigungsschema nicht ausreichte, wurde für diese Mutanten auf eine

Affinitätschromatographie zurückgegriffen. Dazu wurde in das Plasmid der jeweiligen

Mutanten die Gensequenz für einen Octahistidinrest C-terminal mit Hilfe der QuikChange TM -

Methode eingefügt. Auch für die Wildtyp-Urocanase wurde ein solches Expressionsplasmid

hergestellt, um damit das Aufreinigungsschema zu etablieren sowie einen eventuellen

Einfluss des Polyhistidinrests auf den Oligomerisierungsgrad ausschließen zu können.

Die Produktion des Polyhistidinfusionsproteins der Urocanase erfolgte analog der Variante

ohne Affinitätstag. Nach Aufschluss und Filtration wurde das Protein jedoch davon

abweichend über eine Affinitätschromatographie an einer HiTrap Chelating Sepharose-Säule

(Ni-Säule II) isoliert. Dazu wurde zunächst mittels eines linearen zweistufigen

Imidazolkonzentrationsgradienten eluiert (Abbildung 4.1.4 A), um festzustellen, bei welcher

Konzentration die Elution erfolgte. Der lineare Gradient wurde dann durch einen

Stufengradienten ersetzt (Abbildung 4.1.4 B). Die Detektion der Urocanase erfolgte durch

UV-Absorption bei 280 nm und 330 nm.

90


4.1 Proteinkontakte

A

B

4000

3500

3000

A 280nm

A 330nm

(5fach vergrößert)

% B

100

80

4000

3500

3000

A 280nm

A 330nm

(5fach vergrößert)

% B

100

80

Absorption [mAU]

2500

2000

1500

60

40

%B

Absorption [mAU]

2500

2000

1500

60

40

%B

1000

20

1000

20

500

500

0

0

0 20 40 60 80 100 120

Volumen [mL]

0

0 10 20 30 40 50 60 70 80

Volumen [mL]

0

Abbildung 4.1.4

Affinitätschromatographie von His 8 -Urocanase (C198S)

A: Affinitätschromatographie mittels eines linearen Gradienten

B: Affinitätschromatographie mittels eines Stufengradienten

Urocanasehaltige Fraktionen sind mit einem Balken markiert.

Urocanasehaltige Fraktionen wurden vereint (in Abbildung 4.1.4 durch einen Balken

markiert), gegebenenfalls aufkonzentriert und mittels GPC (Säule I) analysiert (Abbildung

4.1.5 A). Das Elutionsverhalten unterschied sich nicht wesentlich von dem des Proteins ohne

Polyhistidintag. Eine analytische SDS-PAGE zeigt die gute Selektivität und starke

Anreicherung durch die Affinitätschromatographie (Abbildung 4.1.5 B).

A

70 A 280nm

B

60

Absorption [mAU]

50

40

30

20

10

0

0 50 100 150 200 250

Volumen [mL]

Abbildung 4.1.5

Reinigung der Urocanase als Polyhistidinfusionsprotein

A: Gelpermeationschromatographie von His 8 -Urocanase (C198S)

B: SDS-PAGE-Analyse von Fraktionen aus der His 8 -Urocanase (C198S)-Reinigung

91


4 Ergebnisse und Diskussion

4.1.2 Allgemeine Konzeption der Mutationen

Die Struktur der Urocanase war bei einer Auflösung von 1.2 Å bekannt [27]. Urocanase ist

ein Homodimer mit C 2 -Symmetrie. Dies bedeutet, dass jede auf Genebene eingeführte

Mutation zwei Äquivalente auf Proteinebene hat, also dass beim Erzeugen einer

Kontaktfläche diese in jeder Untereinheit einmal auftritt. Soll eine unbegrenzte Anlagerung

von Dimeren aneinander, also die Ausbildung von Fasern und unspezifischen Aggregaten,

verhindert und die Erzeugung eines definierten Tetramers erreicht werden, so müssen

sämtliche erzeugte Kontaktflächen durch die Tetramerbildung abgedeckt sein. Dies kann

unter Erhalt der C 2 -Symmetrie erzielt werden, so dass die Bildung eines Tetramers durch

„Kopf-Kopf“- oder „Fuss-Fuss“-Kontakte erreicht werden kann (Abbildung 4.1.6 A und B).

A

C 2 C 2

B

Abbildung 4.1.6

Mögliche Tetramerbildung der Urocanase mit C 2 -Symmetrie

A. „Kopf-Kopf“-Anordnung

B. „Fuss-Fuss“-Anordnung

Zur Planung der Interaktionsstellen wurden zwei Moleküle Urocanase unter Verwendung des

Programms O [152] in silico manuell angenähert. Im ersten Schritt wurden die zwei Moleküle

in „Kopf-Kopf“ oder „Fuss-Fuss“-Orientierung in Winkelinkrementen von 15° gegeneinander

gedreht und in jeder Position soweit angenähert, bis der minimale Abstand zwischen zwei

Atomen des Proteinrückgrats 3 Å erreicht hatte. Die entstehende Kontaktfläche wurde mit

92


4.1 Proteinkontakte

dem Programm NACCESS berechnet. Für die relativen Winkel zwischen den Dimeren, für

die sich die größten Kontaktflächen ergaben, wurden die Winkelinkremente auf 3 - 5°

verfeinert. Die hierbei entstehenden größten Kontaktflächen wurden genauer untersucht.

Die folgenden Kriterien wurden bewertet:

• Atome, die nicht an Wasserstoffbrücken oder ionischen Wechselwirkungen beteiligt

sind, sollten sich nicht näher kommen als 3 Å.

• Oberflächenladungen ohne Gegenpart sollten vermieden werden.

• Ionische Wechselwirkungen zwischen den Oberflächen und Wasserstoffbrücken

sollten von hydrophoben Regionen umgeben sein.

• Die Interaktionsfläche sollte keine Löcher oder Einstülpungen haben.

• Kleine, hydrophobe Aminosäurereste (Val, Leu und Ile) sind solchen mit größeren

Seitenketten vorzuziehen, da sie weniger flexible Wechselwirkungen ausbilden.

• Insgesamt sollte die Interaktionsfläche einen hydrophoberen Charakter bekommen.

4.1.3 „Kopf-Kopf“-Mutanten

Planung der Mutationen

Unter Verwendung des Programms O [152] wurden zwei Urocanasedimere (AB und CD) in

silico manuell mit der NAD + -Bindedomäne angenähert und die C 2 -Achsen überlagert.

Anschließend wurden die Moleküle in Winkelinkrementen von 15° gegeneinander um die

C 2 -Achse gedreht und wie oben beschrieben angenähert. Für die Bestimmung der relativen

Winkel zwischen den Dimeren wurden die Aminosäurereste Lys253 der Ketten A und D

sowie der Mittelpunkt zwischen den Dimeren auf der C 2 -Achse herangezogen. Die

entstehende Kontaktfläche wurde mittels des Programms NACCESS berechnet (Abbildung

4.1.7A). Der Bereich mit einem relativen Winkel von 135° zeigte die mit Abstand größte

Kontaktfläche. Daher wurde im Bereich von 120° bis 150° die Kontaktfläche in

Winkelinkrementen von 5° wie oben ermittelt (Abbildung 4.1.7 B).

93


4 Ergebnisse und Diskussion

A

B

1600

Kontaktfläche [Å 2 ]

1600

1400

1200

1000

800

600

400

Kontaktfläche [Å 2 ]

1400

1200

1000

800

600

400

200

200

0

15 30 45 60 75 90 105 120 135 150 165 180

relativer Winkel [°]

0

120 125 130 135 140 145 150

relativer Winkel [°]

Abbildung 4.1.7

Kontaktfläche bei Annäherung der Urocanase in „Kopf-Kopf“-Ausrichtung

A: Winkelbereich von 0-180° in 15° Inkrementen

B: Winkelbereich von 120-150° in 5° Inkrementen

Die besten Ergebnisse wurden im Winkelbereich um 135° erzielt. In diesem Bereich wurden,

geleitet durch die in Abschnitt 4.1.2 eingeführten Regeln, Mutationen für die Erzeugung eines

Kontaktes geplant.

• Sofern es zu sterischen Konflikten zwischen Seitenketten kam, wurde zunächst versucht,

ob sich diese durch andere Rotamerstellungen der Aminosäurereste beseitigen ließen.

• Gln301 muss zu Ala mutiert werden, da diese Reste von beiden Dimeren sich sterisch

gegenseitig behindern.

• Glu291 wird zu Ile mutiert, da es eine Ladung trägt, die im Interface keinen Gegenpart

findet und für die auch keine Gegenladung eingeführt werden kann.

• Um Löcher in der Oberfläche einzuebnen und die Interaktionsfläche hydrophober zu

gestalten, wurde zusätzlich zu den oben genannten Mutationen noch je einer der folgenden

Aminosäurereste mutiert:

o Ala277 zu Ile

o Val305 zu Leu

o Gln308 zu Ile

Insgesamt wurden somit vier Mutanten hergestellt und untersucht, nämlich die Doppelmutante

URO (Q301A, E291I) und die drei Dreifachmutanten URO (Q301A, E291I, A277I),

94


4.1 Proteinkontakte

URO (Q301A, E291I, V305L) und URO (Q301A, E291I, Q308I). Sämtliche Mutationen

wurden mittels QuikChange TM auf Genebene eingeführt. Als Ausgangsplasmid diente

pT7-7.URO, das das Gen für die Urocanase-Kristallisationsmutante URO (C198S) enthält.

Dieser Aminosäurerest ist weit von der geplanten Kontaktfläche entfernt und hat daher keinen

Einfluss. Die Mutation ist in allen Urocanase-Konstrukten enthalten, ohne dass dies im

Weiteren aufgeführt wird. Abbildung 4.1.8 zeigt die Proteinoberflächen, die als

Ausgangspunkt zur Planung von Mutationen für die „Kopf-Kopf“-Interaktion dienten.

Abbildung 4.1.8

Stereodarstellung der Kontaktfläche als Ausgangspunkt für die Planung einer „Kopf-

Kopf“-Interaktion der Urocanase bei einem Winkel von 135°

Zu sehen ist die Kontaktfläche zwischen zwei Untereinheiten (hellblau und orange). Die

Aminosäurereste, für die Mutationen geplant wurden, sind als ball-and-stick gezeigt und

bezeichnet.

Expression, Reinigung und Analyse der „Kopf-Kopf“-Mutanten

Die Expression und Reinigung der „Kopf-Kopf“-Mutanten erfolgte mittels Anionenaustausch,

Ammoniumsulfatfällung und GPC wie für den Wildtyp unter Abschnitt 4.1.1 beschrieben. Da

sich die Mutanten URO (Q301A, E291I), URO (Q301A, E291I, V305L) und URO

(Q301A, E291I, Q308I) im Elutionsverhalten auf der GPC nicht vom Wildtyp unterschieden,

wird hier auf eine detaillierte Beschreibung der Reinigung verzichtet. Allerdings ist

anzumerken, dass bei diesen Mutanten eine schlechtere Expression vorlag.

Die Reinigung für die Mutante URO (Q301A, E291I, A277I) verlief ebenfalls wie für den

Wildtyp beschrieben. Abbildung 4.1.19 zeigt die Anionenaustauschchromatographie und die

zugehörige SDS-PAGE für diese Mutante.

95


4 Ergebnisse und Diskussion

Absorption [mAU]

A

3000

2500

2000

1500

1000

500

A 280nm

A 330nm

(10fach vergrößert)

Leitfähigkeit [mS/cm]

% B

100

90

80

70

60

50

40

30

20

10

Leitfähigkeit [mS/cm] // %B

B

0

0 100 200 300 400 500 600

Volumen [mL]

0

Abbildung 4.1.9

Anionenaustauschchromatographie von URO (Q301A, E291I, A277I)

A: Chromatogramm des Q-Sepharose-Laufes

B: SDS-PAGE-Analyse von Fraktionen aus der Anionenaustauschchromatographie

Die Mutante URO (Q301A, E291I, A277I) wies jedoch ein vom Wildtyp verschiedenes

Elutionsverhalten bei der GPC auf (Abbildung 4.1.10). Das Chromatogramm dieser Mutante

zeigt ein Absorptionsmaximum bei 185 mL (Säule II), was einer apparenten relativen

Molekularmasse von 198 kDa entspricht (Anhang IV) und damit genau der doppelten Größe

des Wildtypproteins (Abschnitt 4.1.1), also dem Oligomerisierungsgrad eines Tetramers.

600

Mutante URO (Q301A, E291I, A277I)

Wildtyp

500

Absorption [mAU]

400

300

200

100

0

50 100 150 200 250

Volumen [mL]

Abbildung 4.1.10 Vergleich der GPC-Chromatogramme von Wildtyp-Urocanase und der

Mutanten URO (Q301A, E291I, A277I)

96


4.1 Proteinkontakte

Urocanasehaltige Fraktionen (in Abbildung 4.1.10 durch einen schwarzen Balken

gekennzeichnet) wurden vereint, aufkonzentriert und rechromatographiert. Das Elutionsprofil

(Abbildung 4.1.11) zeigte nach der Rechromatographie ein einziges Absorptionsmaximum bei

185 mL (Säule II), was auf eine stabile Tetramerbildung der Urocanase hinweist.

400

A 280nm

350

300

Absorption [mAU]

250

200

150

100

50

0

50 100 150 200 250

Volumen [mAU]

Abbildung 4.1.11 Rechromatographie von URO (Q301A, E291I, A277I)

Abbildung 4.1.12 zeigt die Analyse des Reinigungsverlaufs durch SDS-PAGE. Wie der

Wildtyp konnte auch die Mutante URO (Q301A, E291I, A277I) in hoher Ausbeute mit großer

Reinheit gewonnen werden.

Abbildung 4.1.12 SDS-PAGE zur Darstellung des Reinigungsverlaufs von URO (Q301A, E291I, A277I)

97


4 Ergebnisse und Diskussion

Zur Verifizierung des Oligomerisierungsgrades wurden weiterhin eine Dynamische

Lichtstreuungsmessung sowie eine Native PAGE durchgeführt. Für beide Analyseverfahren

wurde der Wildtyp als Vergleich herangezogen. Bei der Dynamischen Lichtstreuung wurden

für jedes Protein zwei Werte aus je 20 Messungen ermittelt (Tabelle 4.1.1). Für das

Wildtypprotein ergab sich im Mittel eine relative Molekularmasse von 120 kDa, für die

Mutante URO (Q301A, E291I, A277I) von ca. 240 kDa. Beide Werte stimmen sehr gut mit

dem Wert für eine dimere bzw. tetramere Urocanase überein.

Tabelle 4.1.1 DLS-Messung für Wildtyp-Urocanase und URO (Q301A, E291I, A277I)

Wildtyp

Messung 1

Messung 2

Mittelwert

URO (Q301A, E291I, A277I)

Messung 1

Messung 2

Mittelwert

Hydrodynamischer

Radius [nm]

4.75

4.45

5.90

6.46

Relative

Molekularmasse [kDa]

129

111

120

214

265

239.5

Für die Native PAGE wurde das Laufverhalten der Mutante URO (Q301A, E291I, A277I) im

Vergleich zum Laufverhalten des Wildtyps untersucht. Urocanase besitzt einen Überschuss

von 69 negativ gegenüber 55 positiv geladenen Aminosäureresten, so dass sich die Mutation

E291I nicht wesentlich auf das Ladungs-/Masseverhältnis auswirkt und dieses als identisch

angenommen werden kann. Abbildung 4.1.13 zeigt, dass der Wildtyp im Gel eine höhere

elektrophoretische Mobilität als die Mutante URO (Q301A, E291I, A277I) besitzt. Da es sich

um das gleiche Protein mit identischem Ladungs/Masseverhältnis handelt, kann hieraus ein

höherer Oligomerisierungsgrad für die Mutante URO (Q301A, E291I, A277I) abgeleitet

werden.

Abbildung 4.1.13

Native PAGE von URO (Q301A, E291I, A277I) im

Vergleich zum Wildtyp-Protein

98


4.1 Proteinkontakte

Da alle Analyseverfahren auf eine tetramere Urocanase hinwiesen, wurde diese Mutante

kristallographisch untersucht (Abschnitt 4.1.5 ff). Weiterhin wurde ein Aktivitätstest

durchgeführt, um eine eventuelle Auswirkung einer Kontaktbildung der NAD + -

Bindungsdomänen zu überprüfen. Dazu wurde die Abnahme der Urocanat-Konzentration

spektroskopisch bei 277 nm verfolgt. Die Mutante URO (Q301A, E291I, A277I) zeigte

keinerlei Aktivität, während der Wildtyp eine Aktivität von 2.5 U/mg aufwies, was mit dem

durch D. Kessler ermittelten Wert von 3.4 U/mg [17] gut übereinstimmt. Die fehlende

Aktivität der Mutante weist darauf hin, dass die Tetramerisierung wirklich über die NAD + -

Bindungsdomäne erfolgt, so dass diese unbeweglich wird und kein Substrat ins aktive

Zentrum gelangen kann.

4.1.4 „Fuss-Fuss“-Mutanten

Unter Verwendung des Programms O [152] wurden zwei Urocanasedimere (AB und CD) in

silico manuell mit der Kerndomäne angenähert und die C 2 -Achsen überlagert. Anschließend

wurden die Moleküle in Winkelinkrementen von 15° gegeneinander um die C 2 -Achse

gedreht. Für die relativen Winkel zwischen den Dimeren wurden die Aminosäurereste

Asp512 der Ketten A und D sowie der Mittelpunkt zwischen den Dimeren auf der C 2 -Achse

herangezogen. Bei der Annäherung der Dimere wurde klar, dass ein minimaler Abstand von

3 Å zwischen den Atomen des Proteinrückgrats noch zu unannehmbar vielen sterischen

Überlagerungen der Seitenketten führen würde. Daher wurden die beiden Dimere abweichend

von der Planung der „Kopf-Kopf“-Mutanten in jeder Position soweit angenähert, bis der

minimale Abstand zwischen zwei C β -Atomen 3 Å erreicht hatte. Die entstehende

Kontaktfläche wurde mittels des Programms NACCESS berechnet (Abbildung 4.1.14 A). Der

Winkelbereich zwischen 40° und 70°, der eine relativ große Kontaktfläche aufweist, wurde in

3°-Schritten genauer untersucht. Abbildung 4.1.14 B zeigt, dass sich die Größe der

Kontaktfläche über den Winkelbereich von 43° bis 70° kaum ändert, und eine genauere

Untersuchung der Kontaktfläche ergab, dass immer dieselben Aminosäurereste zu sterischen

Konflikten führen. Eine Übersicht über diese Reste gibt Tabelle 4.1.2, wobei nicht jeder

Konflikt in jedem Winkelbereich auftrat.

99


4 Ergebnisse und Diskussion

A

Kontaktfläche [Å 2 ]

1600

1400

1200

1000

800

600

400

Abbildung 4.1.14

Kontaktfläche bei Annäherung der Urocanase in

„Fuss-Fuss“-Orientierung

A: Winkelbereich von 0-180° in 15°

Inkrementen

B: Winkelbereich von 40-70° in 3° Inkrementen

200

0

15 30 45 60 75 90 105 120 135 150 165 180

relativer Winkel [°]

B

2000

Kontaktfläche [Å 2 ]

1800

1600

1400

1200

1000

800

600

400

200

0

40 43 46 49 52 55 58 61 64 67 70

relativer Winkel [°]

Abbildung 4.1.15 zeigt die Proteinoberflächen, die als Ausgangspunkt zur Planung von

Mutationen für eine „Fuss-Fuss“-Interaktion dienten.

Abbildung 4.1.15

Stereodarstellung der Kontaktfläche als Ausgangspunkt für die Planung einer „Fuss-

Fuss“-Interaktion der Urocanase bei einem Winkel von 55°

Aminosäurereste, für die Mutationen geplant wurden, sind eingezeichnet und beschriftet.

Dimer 1 ist gelb-rot (Ketten A, B) und Dimer 2 blau-grün (Ketten C, D) dargestellt.

100


4.1 Proteinkontakte

Tabelle 4.1.2 Sterische Konflikte im „Fuss-Fuss“-Interface

D78 K93 T94 T511 D512 E513 E516

D78

K93

T94

T511 Konflikt

D512 Konflikt

E513 Konflikt Konflikt

E516 Konflikt Konflikt

Da über einen weiten Bereich dieselben Aminosäurereste in sterische Konflikte involviert

waren und nie weniger als drei solcher räumlichen Überlagerungen auftraten, wurde das

Hauptaugenmerk auf die Vermeidung dieser Konflikte gelegt. Einzelne Ladungen waren nicht

vorhanden und auch größere Lücken traten nicht auf. Der sterische Konflikt zwischen den

beiden Glutamaten an Position 516 konnte durch Rotamerbildung entschärft werden. Daher

wurden zunächst die Aminosäurereste Asp78, Lys93, Asp512 und Glu513 durch kleine,

hydrophobe Aminosäuren ersetzt (Tabelle 4.1.3).

Tabelle 4.1.3 Erzeugte „Fuss-Fuss“-Mutanten

D78 K93 D51 E513 D78 K93 D512 E513

URO A A I URO V A I

URO A A V URO V A V

URO A I I URO V I I

URO A I V URO V I V

URO A V I URO V V I

URO A V V URO V V V

URO A A A I URO V A A I

URO A A A V URO V A A V

URO A A I I URO V A I I

URO A A I V URO V A I V

URO A A V I URO V A V I

URO A A V V URO V A V V

Bei diesen Mutanten ergaben sich große Probleme mit der Expression und mit der Löslichkeit

des Proteins, so dass sich nach dem Aufschluss nur wenig Urocanase im Überstand befand.

Auf Grund der geringen Proteinmengen konnten die Urocanasemutanten mit Hilfe des

etablierten Protokolls nicht ausreichend gereinigt werden. Daher wurde zum einen auf

Genebene die Sequenz für ein Octahistidinpeptid C-terminal an das Urocanasegen mit obigen

101


4 Ergebnisse und Diskussion

Mutationen angefügt. Zum anderen wurden zur Erhöhung der Löslichkeit nicht nur kleine,

hydrophobe Reste für die Planung der Kontaktfläche, sondern auch weniger hydrophobe

verwendet. Im Einzelnen wurde für Glu516 durch Mutation zu Leucin versucht, einen

hydrophoben Kontakt herzustellen, und durch Mutation zu Glutamin, Wasserstoffbrücken zu

bilden. Mit der Einführung von Serin, Threonin und Asparagin an den Positionen 78, 512 und

513 wurde versucht, die Löslichkeit des Proteins bei gleichzeitiger Bildung von Wasserstoffbrücken

zu erhöhen. Auf eine Mutation von Lys93 wurde bei der Planung der Kontaktfläche

diesmal verzichtet, weil es durch Rotamerbildung aus der Kontaktfläche entfernt werden

kann. Tabelle 4.1.4 gibt einen Überblick über die zusätzlichen erzeugten Mutanten.

Tabelle 4.1.4

„Fuss-Fuss“-Mutanten mit Octahistidinrest

D78 D512 E513 E516 D78 D512 E513 E516

URO_HIS 8 A S V L URO_HIS 8 S S V L

URO_HIS 8 A S T Q URO_HIS 8 S S T Q

URO_HIS 8 A A T Q URO_HIS 8 S A T Q

URO_HIS 8 A A V L URO_HIS 8 S A V L

URO_HIS 8 A A V Q URO_HIS 8 S A V Q

URO_HIS 8 A V V Q URO_HIS 8 S V V Q

URO_HIS 8 A V N Q URO_HIS 8 S V N Q

URO_HIS 8 A A T L URO_HIS 8 S A T L

URO_HIS 8 A V T Q URO_HIS 8 S V T Q

URO_HIS 8 A V V L URO_HIS 8 S V V L

URO_HIS 8 A V T L URO_HIS 8 S V T L

URO_HIS 8 A S N L URO_HIS 8 S S N L

URO_HIS 8 A S N Q URO_HIS 8 S S N Q

URO_HIS 8 A S T L URO_HIS 8 S S T L

URO_HIS 8 A V N L URO_HIS 8 S V N L

URO_HIS 8 A S V Q URO_HIS 8 S S V Q

URO_HIS 8 A A N L URO_HIS 8 S A N L

URO_HIS 8 A A N Q URO_HIS 8 S A N Q

Sämtliche Mutationen wurden mittels QuikChange TM auf Genebene eingeführt. Als

Ausgangsplasmid diente pT7-7.URO_HIS 8 , das das Gen für die Urocanase-

Kristallisationsmutante URO (C198S) als Polyhistidinfusionsprotein enthält. Das zu Serin

mutierte Cys198 ist weit von der geplanten Kontaktfläche entfernt und hat daher keinen

Einfluss. Die Mutation ist in allen Urocanase-Konstrukten enthalten, ohne dass dies im

Weiteren aufgeführt wird.

102


4.1 Proteinkontakte

Tabelle 4.1.5 Überblick über die Ergebnisse der „Fuss-Fuss“-Mutanten

D78 K93 D512 E513 E516 Exp. Lösl. Oligomerenstatus

URO(_HIS8) A A I (+) + Dimer URO_HIS8

URO(_HIS8) A A V + + Aggregat + Dimer URO_HIS8

URO(_HIS8) A I I - - - URO_HIS8

URO(_HIS8) A I V + - - URO_HIS8

URO(_HIS8) A V I + - - URO_HIS8

URO(_HIS8) A V V - - - URO_HIS8

URO(_HIS8) A A A I + - - URO_HIS8

URO(_HIS8) A A A V + + Dimer URO_HIS8

URO(_HIS8) A A I I + - - URO_HIS8

URO(_HIS8) A A I V + (+) Aggregat + Dimer URO_HIS8

URO(_HIS8) A A V I + - - URO_HIS8

URO(_HIS8) A A V V + - - URO_HIS8

URO(_HIS8) V A I + + Dimer URO_HIS8

URO(_HIS8) V A V + (+) Dimer URO_HIS8

URO(_HIS8) V I I + - - URO_HIS8

URO(_HIS8) V I V + - - URO_HIS8

URO(_HIS8) V V I - - - URO_HIS8

URO(_HIS8) V V V (+) - - URO_HIS8

URO(_HIS8) V A A I + - - URO_HIS8

URO(_HIS8) V A A V + - - URO_HIS8

URO(_HIS8) V A I I + + Dimer URO_HIS8

URO(_HIS8) V A I V + (+) Dimer URO_HIS8

URO(_HIS8) V A V I + + Dimer URO_HIS8

URO(_HIS8) V A V V (+) - - URO_HIS8

URO_HIS8 A S V L - - - URO_HIS8

URO_HIS8 A S T Q + (+) Aggregat + Dimer URO_HIS8

URO_HIS8 A A T Q + (+) Aggregat + Dimer URO_HIS8

URO_HIS8 A A V L + - - URO_HIS8

URO_HIS8 A A V Q + (+) Aggregat + Dimer URO_HIS8

A V V Q + - - URO_HIS8

URO_HIS8

(_HIS8) = Mutante wurde mit und ohne HIS8-tag untersucht

Exp. = Expression, Lösl. = Löslichkeit, + = exprimiert/ist löslich, (+) = exprimiert wenig/teilweise löslich, - = keine Expression/unlöslich

Die Expression und die Löslichkeit wurden mittels SDS-PAGE von Proben vor und nach dem Aufschluss untersucht.

D78

A

A

A

A

A

A

A

A

A

A

A

A

S

S

S

S

S

S

S

S

S

S

S

S

S

S

S

S

S

S

K93

D512

V

A

V

V

V

S

S

S

V

S

A

A

S

S

A

A

A

V

V

A

V

V

V

S

S

S

V

S

A

A

E513

N

T

T

V

T

N

N

T

N

V

N

N

V

T

T

V

V

V

N

T

T

V

T

N

N

T

N

V

N

N

E516

Q

L

Q

L

L

L

Q

L

L

Q

L

Q

L

Q

Q

L

Q

Q

Q

L

Q

L

L

L

Q

L

L

Q

L

Q

Exp.

+

+

+

+

-

(+)

(+)

(+)

-

(+)

(+)

+

(+)

+

+

+

+

+

+

+

+

-

(+)

+

+

+

(+)

+

+

+

Lösl.

-

(+)

(+)

(+)

-

(+)

+

+

+

+

+

+

+

+

-

(+)

+

(+)

+

(+)

+

+

-

-

-

-

-

-

-

-

Oligomerenstatus

-

Aggregat + Dimer

Aggregat + Dimer

Aggregat + Dimer

-

Aggregat + Dimer

Dimer

Dimer

Dimer

Dimer

Dimer

Dimer

Dimer

Dimer

-

Aggregat + Dimer

Dimer

Aggregat + Dimer

Dimer

Aggregat + Dimer

Dimer

Dimer

-

-

-

-

-

-

-

-

103


4 Ergebnisse und Diskussion

Expression, Reinigung und Analyse der „Fuss-Fuss“-Mutanten

Die Herstellung der „Fuss-Fuss“-Mutanten brachte erhebliche Schwierigkeiten mit sich, so

dass die Analyse der Mutanten nicht zufrieden stellend durchgeführt werden konnte. Die

Mutanten zeigten größtenteils eine sehr geringe lösliche Expression, die auch durch

Veränderung der Expressionsbedingungen nicht verbessert werden konnte. Der Versuch, die

Ausbeute und Reinheit des Proteins durch Affinitätschromatographie zu erhöhen, gelang nur

bedingt – die Reinheit war zwar in der Regel sehr gut, die Ausbeute allerdings immer noch zu

gering, um potentiell in kleinen Mengen vorliegendes Tetramer zu detektieren. Allerdings

liegt die Vermutung nahe, dass die starke Reduktion der Produktion löslichen Proteins im

Vergleich zum Wildtyp darauf zurückzuführen ist, dass durch die Einführung der Mutationen

eine stark hydrophobe Oberfläche erzeugt wurde, die aber nicht wie gewünscht einen

spezifischen Kontakt ausbildet, so dass das Protein anfällig für Aggregation ist. Tabelle 4.1.5

fasst die Ergebnisse für die „Fuss-Fuss“-Mutanten zusammen.

4.1.5 Kristallisation der Tetramermutante

Die „Kopf-Kopf“-Mutante URO (Q301A E291I A277I), im Folgenden als Tetramermutante

bezeichnet, wurde nach der Reinigung gegen 10 mM Tris-HCl (pH 7.0), 0.1% (v/v)

β-Mercaptoethanol dialysiert und auf 10 mg/mL aufkonzentriert. Die Suche nach initialen

Kristallisationsbedingungen wurde mit der sitting drop Methode und den gängigen

kommerziellen Screens gemäß Abschnitt 3.5.1 durchgeführt. Es fanden sich mehrere initiale

Kristallisationsbedingungen, die sämtlich bezüglich pH, Fällungsmittelkonzentration und

Salzkonzentration mittels der hanging drop Methode verfeinert wurden. Zusätzlich wurden

Tropfengröße und Proteinkonzentration variiert. Die initialen und verfeinerten

Kristallisationsbedingungen sowie die zugehörigen Kristalle sind in Tabelle 4.1.7

zusammengefasst. Alle Kristalle wuchsen innerhalb von 1-3 Tagen.

Die Kristalle wurden auf ihre Röntgentauglichkeit hin überprüft. Dazu wurde als

Cryoschutzmittel Glycerin verwendet. Die besten Ergebnisse wurden für die Kristalle der in

Tabelle 4.1.6 gegebenen Kristallisationsbedingung (Kristallisationsbedingung I) erhalten, die

am SLS (Villigen, Schweiz) bis 2 Å streuten.

104


4.1 Proteinkontakte

Tabelle 4.1.6 Kristallisationsbedingung I der Urocanase-Tetramermutante

Parameter

Wert

Reservoirpuffer a 0.1 M NaCacodylat, pH 6.9, 10% (w/v) PEG-8000,

0.2 M MgAc 2 , 20% (v/v) Glycerin

Kristallisationsmethode hanging drop

Vorsättigung

50% (v/v) der Reservoirkonzentration

Proteinkonzentration a 10 mg/mL

Kristallisationspuffer 10 mM Tris-HCl, pH 7.0, 0.1% (v/v) β-Mercaptoethanol

Tropfengröße 4 µL

Temperatur 20°C

a Die Angaben beziehen sich auf die Konzentrationen vor Ansetzen des Kristallisationstropfens

Tabelle 4.1.7

Initiale Kristallisationsbedingungen der Tetramermutante und

Ergebnisse der Verfeinerung

Initiale Bedingung

I Crystal Screen Cryo 18

0.08 M NaCacodylat, pH 6.5

16% (w/v) PEG-8000

0.16 M MgAc 2

20% (v/v) Glycerin

Verfeinerte Bedingung

0.1 M NaCacodylat, pH 6.9

10% (w/v) PEG-8000

0.2 M MgAc 2

20% (v/v) Glycerin

II

JBS 2, A4

0.1 M MES, pH 6.5

10% (w/v) PEG-4000

0.2 M MgCl 2

0.1 M MES, pH 6.3

12% (w/v) PEG-4000

0.2 M MgCl 2

III

JBS 2, B6

0.1 M Tris-HCl, pH 8.5

20% w/v PEG-4000

0.2 M CaCl 2

0.1 M Tris-HCl, pH 8.3

19% w/v PEG-4000

0.2 M CaCl 2

IV

JBS 4, B5

0.1 M Tris-HCl, pH 8.5

28% w/v PEG-6000

0.5 M LiCl

0.1 M Tris-HCl, pH 9.1

24% w/v PEG-6000

0.25 M LiCl

V Crystal Screen Cryo 46

0.08 M NaCacodylat, pH 6.5

14.4% (w/v) PEG-8000

0.16 M CaAc 2

20% (v/v) Glycerin

VI Crystal Screen, 6

0.1 M Tris, pH 8.5

0.2 M MgCl 2

30% (w/v) PEG-4000

0.1 M NaCacodylat, pH 6.6

10% (w/v) PEG-8000

0.16 M CaAc 2

20% (v/v) Glycerin

0.1 M Tris-HCl, pH 8.9

0.2 M MgCl 2

22% (w/v) PEG-4000

Der Balken in der oberen rechten Ecke der Kristallbilder entspricht einer Länge von 100 µm.

105


4 Ergebnisse und Diskussion

4.1.6 Datensammlung

Zur Präparation der Kristalle der in Tabelle 4.1.6 gegebenen Kristallisationsbedingung I für

die Vermessung am Synchrotron wurden die Kristalle in Cryopuffer (0.1 M NaCacodylat,

pH 6.9, 10% (w/v) PEG-8000, 0.2 M MgAc 2 , 35% (v/v) Glycerin) überführt und anschließend

direkt in flüssigem Stickstoff schockgefroren. Die Kristalle wurden am SLS an der beamline

PX06 vermessen. In der folgenden Tabelle 4.1.8 sind die Parameter und die Statistiken des für

die Urocanase-Tetramermutante (C198S, Q301A, E291I, A277I) aufgenommenen

Datensatzes zusammengefasst.

Tabelle 4.1.8

Parameter und Statistiken des Datensatzes der Tetramermutante

Kristallform I

beamline

PX06

Wellenlänge λ [Å] 0.8853

Detektor

MarCCD

Raumgruppe P2 1 2 1 2 1

Zellparameter a, b, c [Å] 68.07, 154.32, 216.39

Auflösungsbereich [Å] a 28.8 - 2.0 (2.06 - 2.0)

Anzahl unabhängiger Reflexe a 149793 (11675)

Vollständigkeit [%] a 96.9 (90.0)

Multiplizität a 6.3 (5.9)

R sym-I [%] a 9.4 (33.1)

R merge [%] 7.3 (22.7)

I/σ a 14.7 (6.6)

Wilson B-Faktor [Å 2 ] 29.4

Anzahl Monomere/ASU 4

Matthews-Parameter [Å 3 Da -1 ] 2.3

Lösungsmittelgehalt [%] 47

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale.

Die Analyse des Matthews-Parameters und des Lösungsmittelgehaltes ergab zwischen 2 und 5

Monomeren in der asymmetrischen Einheit. Unter der Annahme, dass die Tetramermutante

auch unter der Kristallisationsbedingung als Tetramer vorliegt, kann auf 4 Monomere

beziehungsweise ein Tetramer in der asymmetrischen Einheit geschlossen werden.

106


4.1 Proteinkontakte

Selbstrotation

Die Betrachtung der stereographischen Projektion der Selbstrotationsfunktion bei κ=180°

zeigt zwei der senkrecht zueinander stehenden kristallographischen C 2 -Achsen sowie zwei

weitere, nichtkristallographische C 2 -Achsen, die 30° gegen die kristallographischen Achsen

verkippt sind und einen Winkel von 120° einschließen. Dies lässt darauf schließen, dass nicht

das erwartete D 2 -symmetrische Tetramer in der asymmetrischen Einheit zu finden ist.

Abbildung 4.1.16

Stereographische Darstellung der Selbstrotationsfunktion von Urocanase bei κ=180°

Die Suche wurde bei einem Suchradius von 37 Å und 3.5 Å Auflösung durchgeführt. Die

Konturlinien beginnen bei einer Signalhöhe von 6 σ und haben eine Schrittweite von

0.5 σ.

4.1.7 Strukturlösung

Phasierung und Modellbau

Die Phasierung der Urocanasemutante URO (C198S, Q301A, E291I, A277I) erfolgte durch

molekularen Ersatz mit dem Programm PHASER. Als Suchmodell wurde die Kette A der

durch D. Kessler gelösten Struktur (pdb-code 1uwl) verwendet [27]. Vier Monomere konnten

mit hohen Z-Scores (Tabelle 4.1.9) in der asymmetrischen Einheit platziert werden.

107


4 Ergebnisse und Diskussion

Eine Analyse der initialen Dichte zeigte, dass zwei der Monomere gut mit dem Modell

übereinstimmten, während bei den anderen beiden eine Konformationsänderung stattgefunden

hatte. Obwohl die initiale Dichte bereits sehr gut interpretierbar war, ließ sich das Modell

nicht durch automatische Programme bauen. Zur Beseitigung des model bias wurde ein

prime-and-switch mit RESOLVE durchgeführt. Anschließend wurde das Modell mit

RESOLVE neu gebaut. Zugleich wurde das alte Modell durch ein simulated annealing mittels

CNS verfeinert. Die beiden entstandenen Modelle wurden manuell zu einem einzigen Modell

zusammengefügt, das durch mehrere Runden Verfeinerung mittels REFMAC und manuellem

Bau mittels COOT verfeinert wurde. Für den Bau der NAD + -Moleküle wurde das NAD + aus

der Urocanasestruktur (pdb-code 1uwl) verwendet und mit COOT und REFMAC verfeinert.

Wassermoleküle wurden mittels ARP/wARP gebaut und mit COOT verfeinert. In den letzten

Zyklen wurde zusätzlich eine TLS-Verfeinerung mit den einzelnen Monomeren als TLS-

Gruppen durchgeführt. Das fertige Modell enthält die Aminosäurereste 5-557 aller vier Ketten

sowie vier NAD + -Moleküle (Abbildung 4.1.20).

Tabelle 4.1.9

Ergebnisse des molekularen Ersatzes mittels PHASER

Monomer Z-Score Rotation

Z-Score Translation

1 9.4 18.2

2 10.5 36.5

3 5.7 29.9

4 6.5 30.4

Qualität des Modells

Die Qualität des Strukturmodells für das Urocanasetetramer wurde während der Verfeinerung

anhand der R-Faktoren sowie der Abweichung von geometrischen Daten validiert

(Abschnitt 3.5.7). Die Qualitätskriterien und ihre Werte sind in Tabelle 4.1.10 gegeben. Die

Struktur weist sehr gute R-Faktoren auf und zeigt auch nur geringe Abweichungen von

Standardbindungslängen und –winkeln. Diese Werte sind auf die Tatsache zurückzuführen,

dass für die Phasierung ein Modell verwendet wurde, das bei einer sehr hohen Auflösung

(1.76 Å) erstellt wurde. Die Werte aller dihedraler Hauptkettentorsionswinkel φ und ψ

befinden sich im erlaubten Bereichen des Ramachandran-Diagramms und sogar zu fast 98%

im energetisch günstigen Bereich (Abbildung 4.1.17). Weiterhin befinden sich alle Ergebnisse

der mit dem BIOTECH-Server durchgeführten Analysen innerhalb gängiger Toleranzgrenzen.

108


4.1 Proteinkontakte

Tabelle 4.1.10

Verfeinerungsstatistik von Urocanase C198S Q301A E291I A277I

Auflösungsbereich [Å] 28.8 - 2.0

Anzahl unabhängiger Reflexe 149’793

Zahl der Reflexe im test set 7’490

R cryst [%] 15.6

R free [%] 18.0

strukturierte Bereiche 5-557

Anzahl von Nichtproteinmolekülen

NAD +

Wasser

Glycerin

Acetat

rms-Abweichung

Bindungslänge [Å]

Bindungswinkel [°]

Mittlere B-Faktoren [Å 2 ] (Kette A/B/C/D)

Hauptkettenatome

Seitenkettenatome

4

1310

9

7

0.008

1.130

19.5/ 20.1/ 22.6/ 26.2

20.7/ 21.4/ 24.1/ 27.5

Wassermoleküle 33.6

Ramachandran-Torsionswinkel

energetisch günstiger Bereich [%]

97.8

erlaubter Bereich [%]

2.2

verbotener Bereich [%]

0.0

TLS-Gruppen (alle Ketten) 5-577

Abbildung 4.1.17

Ramachandran-Diagramme für das

Modell der Urocanase-Tetramermutante

Glycinreste sind durch Kreuze, Proline

durch Dreiecke und alle anderen

Aminosäurereste durch Quadrate eingezeichnet.

Reste, die im energetisch

günstigen Bereich liegen, sind schwarz und

Reste, die im erlaubten Bereich liegen, sind

orange gekennzeichnet. Die Farbgebung

des Hintergrundes ist so gestaltet, dass der

dunkelste Farbton den energetisch

günstigen Bereich markiert.

A. Ramachandran-Diagramm aller

Aminosäurereste

B. Ramachandran-Diagramm der Glycine

C. Ramachandran-Diagramm für Aminosäurereste,

die direkt vor Prolin liegen

D. Ramachandran-Diagramm für Proline

109


4 Ergebnisse und Diskussion

Analyse der Temperaturfaktoren

Abbildung 4.1.18 zeigt den Verlauf der B-Faktoren sowie die Dichtekorrelation entlang der

Hauptkette für die vier Monomere der asymmetrischen Einheit. Zur besseren

Übersichtlichkeit wurden die B-Faktoren der Hauptkettenatome für die jeweils zwei

strukturgleichen Monomere A und B sowie C und D gemittelt. Diese Ketten weisen

untereinander einen fast gleichen Verlauf der B-Faktoren auf. Für die Darstellung der

Dichtekorrelation wurden die Werte für Kette A und B ebenfalls gemittelt, während auf eine

Mittlung für Kette C und D wegen des unterschiedlichen Verlaufs verzichtet wurde. Die

Ketten C und D zeigen dabei insgesamt etwas höhere B-Faktoren als Ketten A und B. Diese

sind vor allem für Kette D auf die sehr viel kleineren Kristallkontakte zurückzuführen

(Tabelle 4.1.11) und spiegeln sich auch in den höheren Wilson-B-Faktoren für diese

Monomere wieder (Tabelle 4.1.10). Die Dichtekorrelation beträgt im Mittel für die Ketten A

und B 0.96, für Kette C 0.95 und für Kette D 0.94. Für Kette D sind auch die niedrigsten

Werte mit ca. 0.7 zu beobachten, was in Übereinstimmung mit den höheren B-Faktoren und

den kleineren Kristallkontakten steht.

50

0 100 200 300 400 500

45

0,9

B-Faktor [Å 2 ]

40

35

30

25

20

α

15

α α

β

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19

123 4 5 6 7 8 9 10 11 12 13 14 15 16/16' 17 18

0 100 200 300 400 500

Sequenzposition

0,8

0,7

0,6

0,5

Dichtekorrelation

Abbildung 4.1.18

Darstellung der gemittelten B-Faktoren des Modells für die Tetramermutante sowie

der Dichtekorrelation

Die B-Faktoren (unten) der strukturgleichen Monomere A und B (schwarz) sowie C und D

(grau) wurden gemittelt und gegen die Sequenzposition aufgetragen. Die gemittelte

Dichtekorrelation (oben) der Ketten A und B ist schwarz, die Dichtekorrelation für Kette

C grau und die für Kette D hellgrau aufgetragen. Zusätzlich sind die zugehörigen

Sekundärstrukturelemente des Modells wie in Abbildung 4.1.19 gezeigt.

110


4.1 Proteinkontakte

4.1.8 Strukturbeschreibung

Sekundärstruktur

Die Analyse der Sekundärstruktur des Urocanase-Tetramermodells wurde mit Hilfe der

Programme DSSP und STRIDE vorgenommen und manuell überprüft. Da die einzelnen

Monomere keine gravierenden Unterschiede aufweisen, wurde lediglich eine Kette dargestellt

(Abbildung 4.1.19). Das Modell enthält 19 α-Helices und 18 β-Stränge. Auf die

Nummerierung von 3 10 -Helices wurde verzichtet. Die Zuweisung der Sekundärstrukturelemente

stimmt mit dem Dimermodell [17] bis auf Helix α19 am C-Terminus überein, deren

Aminosäurereste im Dimermodell fehlen.

. . . . . . . 80

ASS mtdnNKYRDVEIRAPRGNKLTAKSWLTEAPLRMLMNNLDPQVAENPKELVVYGGIGRAARNWECYDKIVETLTRLEDDET

DSSP HHHHHHHHHHHHHT TTT 333TEEETTTEE HHHHHHHHHHHHH TTEE

STRIDE TTT TTTT HHHHHHHHHHHHHHTTTTTT 333 EEETTTEETTT HHHHHHHHHHHHH TTTEE


α1 β1 β2 β3 α2

. . . . . . . 160

ASS LLVQSGKPVGVFKTHSNAPRVLIANSNLVPHWANWEHFNELDAKGLAMYGQMTAGSWIYIGSQGIVQGTYETFVEAGRQH

DSSP EEEETTEEEEEEE TT EEEEE 333 HHHHHHHHHTT TTTTTTT TTHHHHHHHHHHHHHHHHHH

STRIDE EEEETTEEEE EE TTTTTTEEEEETT 333TTHHHHHHHHHH TTTTTTT HHHHHHHHHHHHHHHHHHH


β4 β5 β6 α3 α4

. . . . . . . 240

ASS YGGSLKGKWVLTAGLGGMGGAQPLAATLAGACSLNIECQQSRIDFRLETRYVDEQATDLDDALVRIAKYTAEGKAISIAL

DSSP HTT TT EEEEE TTTTHHHHHHHHHT EEEEEE HHHHHHHHHTT EE HHHHHHHHHHHHHTT EEEE

STRIDE HTTTTTTTEEEEE TTTTHHHHHHHHHH EEEEEE HHHHHHHHHHTTTTEE HHHHHHHHHHHHHH EEEE


β7 α5 β8 α6 β9 α7 β10

. . . . . . . 320

ASS HGNAVEILPELVKRGVRPDMVTDQTSAHDPLNGYLPAGWTWEQYRDRAQTEPAAVVKAAKQSMAVHVQAMLDFQKQGVPT

DSSP E HHHHHHHHHHHT EE TT TTT TT HHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHTT

STRIDE E HHHHHHHHHHH TTEE TTTTTTTT TTTT HHHHHHHHHH HHHHHHHHHHHHH HHHHHHHHHHHH


α8 β11 α9 α10

. . . . . . . 400

ASS FDYGNNIRQMAKEEGVANAFDFPGFVPAYIRPLFCRGVGPFRWAALSGEAEDIYKTDAKVKELIPDDAHLHRWLDMARER

DSSP HHHHHHHTT TT333 HHHHHTHHHHTTT EEEEEEETT HHHHHHHHHHHHHH TT HHHHHHHHHHHHH

STRIDE HHHHHHHH TTTTTTTT HHHHHHHHHH H TEEEEETTT HHHHHHHHHHHHHHTTTTHHHHHHHHHHHH


β12 α11 β13 α12 β14 α13 α14

. . . . . . . 480

ASS ISFQGLPARICWVGLGLRAKLGLAFNEMVRSGELSAPVVIGRDHLDSGSVSSPNRETEAMRDGSDAVSDWPLLNALLNTA

DSSP EEEEEE TTHHHHHHHHHHHHHHHT EEEEE TT EE TTTTTTT TT TT HHHHHHHHHHHH

STRIDE TTTTEEE TTTHHHHHHHHHHHHHHHTTTT EEEEETTTTTTTEETTTTTTTTTTTTTTT HHHHHHHHHHHHH


β15 α15 β16 β16’ α16

. . . . . . . 557

ASS GGATWVSLHHGGGVGMGFSQHSGMVIVCDGTDEAAERIARVLTNDPGTGVMRHADAGYDIAIDCAKEQGLDLPMITG

DSSP HT EEEEEE TTT TT EEEEEEEEE HHHHHHHHHHHHHHHHHHHHHHHHTT HHHHHHHHHHT HHHH

STRIDE H TTEEEEEETTTTTTTT EEEEEEEEE HHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHH TTTTT


β17 β18 α17 α18 α19

Abbildung 4.1.19 Zuordnung der Sekundärstrukturelemente der A-Kette mittels DSSP und STRIDE

ASS gibt die Aminosäuresequenz an, die darauffolgenden Zeilen die Ergebnisse der

Programme DSSP und STRIDE (H = α-Helix, E = β-Strang, T = turn, 3 = 3 10 -Helix). Die

letzten beiden Zeilen enthalten die Zuordnung zu den Sekundärstrukturelementen und ihre

Nummerierung. Reste, die in der Struktur fehlen, sind als Kleinbuchstaben gegeben.

111


4 Ergebnisse und Diskussion

Tertiärstruktur und Hinweise auf die Funktionsweise der Urocanase

Das Strukturmodell der Tetramermutante (Abbildung 4.1.20) zeigt, dass eine Urocanase-

Untereinheit, wie bereits von Kessler et al. [27] beschrieben, aus einer Kerndomäne und einer

NAD + -Bindedomäne besteht (vgl. Abschnitt 1.1.3).

B

D

C

A

Abbildung 4.1.20

Darstellung der Urocanase-Tetramermutante als Bändermodell

Die vier Monomere sind in rot-hellrot (A), gelb-orange (B), grün-türkis (C) und blauhellblau

(D) dargestellt. Die NAD + -Bindedomänen sind jeweils farblich abgesetzt (hellrot,

orange, türkis und hellblau). NAD + ist als ball-and-stick-Modell gezeigt.

Die Ketten A und C sowie B und D bilden ein Dimer aus. Eine Überlagerung der bereits

bekannten Dimerstruktur mit einer Hälfte (Ketten A und C) des Tetramers zeigt, dass die

Dimerstruktur im Wesentlichen erhalten geblieben ist (Abbildung 4.1.21). Die Ketten A und

B sind mit einem rmsd von 0.23 Å sogar praktisch identisch mit einer Monomereinheit des

Wildtyp-Dimers. In den Ketten C und D des Tetramers hat dagegen eine Verschiebung der

NAD + -Bindedomäne gegen die Kerndomäne stattgefunden. Die Struktur der einzelnen

Domänen ist dabei weitgehend erhalten geblieben. Abbildung 4.1.21 zeigt, dass die

Kerndomänen von Tetramer- und Wildtypmodell mit einem rmsd von 0.42 Å gut

übereinander liegen. Ebenso lassen sich die NAD + -Bindedomänen der beiden Strukturen gut

überlagern (Abbildung 4.1.22) und weisen einen rmsd von 0.42 Å auf.

112


4.1 Proteinkontakte

Abbildung 4.1.21 Stereodarstellung der Überlagerung einer Dimereinheit des Tetramermodells mit der

Dimerstruktur

Das Modell der Dimerstruktur ist rot, das des Tetramers blau gezeigt. Cys198 ist als balland-stick-Modell

in den entsprechenden Farben für alle vier Ketten dargestellt.

Abbildung 4.1.22 Stereodarstellung der Überlagerung der NAD + -Bindedomänen aus Dimer- (Kette B)

und Tetramermodell (Kette C)

Das Modell der Dimerstruktur ist rot, das des Tetramers blau gezeigt. Die N- und

C-terminalen Aminosäurereste sind nummeriert.

Insgesamt haben sich aber die NAD + -Bindedomänen in den Ketten C und D von den

Kerndomänen abgehoben, das Enzym “klappt auf”. Diese Bewegung wird durch Helix α4

(AS 143-161) hervorgerufen. Die Helices selbst unterscheiden sich mit einem rmsd von 1.45

Å zwar relativ wenig, allerdings wird durch eine Veränderung des Winkels C α (S142)-

C α (G141) im davor liegenden turn um 7.5° eine Auslenkung der Helix hervorgerufen, die am

anderen Ende bei Tyr161 8.4 Å beträgt.

Die Bewegung der NAD + -Bindedomäne ist vermutlich nicht durch den Tetramerkontakt

künstlich erzeugt, vielmehr stabilisiert die Ausbildung des Kontaktes eine natürlich

vorkommende Konformation der Urocanase. Es war bereits anhand des von Kessler et al. [27]

erstellten Modells vermutet worden, dass eine Bewegung der NAD + -Domäne für die Funktion

des Enzyms nötig sein muss, damit das Substrat Zugang zum aktiven Zentrum haben kann.

113


4 Ergebnisse und Diskussion

Zudem kann nur eine solche Bewegung den Einfluss der Mutation C198S auf die

Kristallisierbarkeit des Proteins zufrieden stellend erklären [27]. In einer weiteren, noch

unveröffentlichten Struktur der Urocanase aus Bacillus stearothermophilus (pdb-code 1x87)

ist die NAD + -Bindungsdomäne mit dem gebundenen NAD + völlig von der Kerndomäne

weggeklappt. Im Modell der Tetramermutante lässt sich nun gut erkennen, dass eine solche

Öffnung stattfindet, diese den Zugang zum aktiven Zentrum ermöglicht und zudem Cys198

stärker dem Lösungsmittel zugänglich macht und die Ausbildung von Disulfidbrücken

ermöglicht (Abbildung 4.1.21). Auf der anderen Seite kann durch die Ausbildung des

Tetramers die NAD + -Domäne nicht weiter aufklappen, und das Enzym zeigt keine Aktivität

(Abschnitt 4.1.3).

Quartärstruktur und Kristallpackung

Das Modell der Urocanase-Mutante URO (A277I, E291I, Q301A) zeigt, dass die Einführung

der drei Mutationen auf Genebene zu einem Urocanase-Tetramer auf Proteinebene geführt

hat. Das Tetramer besteht aus zwei Dimeren (A-C und B-D), dessen Monomere jeweils über

die Kerndomäne den bereits bekannten starken Kontakt mit 3230 Å 2 ausbilden. Die beiden

Dimere bilden in einer “Kopf-Kopf”-Anordnung (Abbildung 4.1.6) über die NAD + -

Bindedomäne ein Tetramer. Dieser Kontakt beträgt zwischen je zwei Ketten (A und D sowie

B und C) etwa 790 Å 2 und im Tetramer zusammen fast 1600 Å 2 . Damit besitzt die

Kontaktfläche zwischen den Monomeren bereits durchschnittliche Größe, und der Kontakt im

Tetramer ist sogar überdurchschnittlich groß.

Das Tetramer weist jedoch nicht die geplante D 2 -Symmetrie auf. Dies ist auf die nicht

vorhersehbare Bewegung der NAD + -Domäne gegen die Kerndomäne in den Untereinheiten C

und D zurückzuführen. Diese Bewegung führt zu einer Verkippung der Dimere

gegeneinander. Abbildung 4.1.23 zeigt einen Vergleich der geplanten D 2 -Symmetrie mit der

tatsächlichen Anordnung der Monomere.

Eine Analyse der Kristallkontakte mittels PISA (Tabelle 4.1.11) zeigt, dass Kette D kaum an

der Ausbildung von Kristallkontakten beteiligt ist, während der Beitrag der anderen drei

Ketten relativ ähnlich ist. Zudem sind sämtliche Kontakte in einer Größenordnung, dass eine

Beeinflussung der Struktur durch sie unwahrscheinlich erscheint.

114


4.1 Proteinkontakte

Abbildung 4.1.23 Stereodarstellung zum Vergleich der geplanten D 2 -Symmetrie mit der tatsächlichen

Anordnung der Monomere im Modell der Tetramerstruktur

Die geplante Struktur ist rot, die tatsächliche Anordnung der Monomere blau dargestellt.

Zusätzlich sind die globalen C 2 -Achsen der geplanten D 2 -Symmetrie rot und die lokalen

C 2 -Achsen der tatsächlichen Anordnung blau eingezeichnet.

Tabelle 4.1.11 Kristallkontakte der Urocanase-Tetramermutante

Kontakt Symmetrieoperation

Größe

beteiligte Aminosäurereste

[Å 2 ] Kette 1 Kette 2

C - A -x-1, y-1/2, -z-1/2 389 158-162, 164, 166-168, 257,

259, 315-317, 389, 540

200, 204, 207-208, 210, 213-

217, 225, 228

B - A x, y, z 266 150, 158, 163, 166, 188, 386-

389, 392, 396

427, 430-432, 511-513, 515-

516

C - B x, y, z 244 78, 93, 430, 509-513 385-386, 539, 542-543, 546-

547, 555

B - B x-1/2, -y+1/2, -z 234 204, 214, 217, 221, 225, 228- 9-11, 13, 16, 19, 40, 47

229, 232, 234

C - D -x+1/2, -y, z-1/2 213 5, 123-126, 286, 289-290 257, 314-317, 341, 543, 546-

547

A - D -x+1/2, -y, z-1/2 111 461-462, 539 253-255, 257, 316

C - A -x, y-1/2, -z-1/2 80 207-208, 210, 213, 234, 371 162, 385-388, 547

B - B x-1, y, z 54 255, 257, 315-316 23, 74, 76, 79

A- B x-1, y, z 34 21, 73 430, 512

D - A -x, y-1/2, -z-1/2 28 19 254-255

115


4 Ergebnisse und Diskussion

4.1.9 Struktur der neu gebildeten Kontaktfläche

Abbildung 4.1.24 zeigt die Kontaktfläche zwischen den Monomeren A und D im Detail. Im

Durchschnitt sind 27 Aminosäurereste mit 80 Atomen pro Monomer am Kontakt beteiligt.

Abbildung 4.1.24

Stereodarstellung der Kontaktfläche der Ketten A und D

Die wichtigsten am Kontakt beteiligten Aminosäurereste sind als ball-and-stick-Modell

gezeigt, die mutierten Aminosäurereste sind bezeichnet.

Tabelle 4.1.12 führt alle Aminosäurereste auf, die mindestens 1% der Fläche der geplanten

oder tatsächlichen Kontaktfläche ausmachen. Bis auf kleinere Abweichungen sind die

Kontaktflächen A-D und B-C identisch. Es bilden sich vier Salzbrücken zwischen der

Aminogruppe von Lys297 und der Carboxylgruppe von Glu334, sowie vier

Wasserstoffbrücken zwischen der Hydroxylfunktion von Thr290 mit dem

Seitenkettenstickstoff von Gln308 sowie zwischen der Carbonylfunktion der Peptidbindung

bei Glu334 und dem Amidstickstoff von Ala294 aus (die beteiligten Aminosäurereste sind in

Tabelle 4.1.12 grün bzw. blau gekennzeichnet).

Die Tabelle zeigt, dass die Kontaktfläche in groben Zügen der Planung entspricht. Fast alle

der geplanten und insbesondere alle mutierten Aminosäurereste sind an Wechselwirkungen

beteiligt. Auch die Größenordnung des Beitrags zur Kontaktfläche stimmt bei vielen

Aminosäureresten gut zwischen Modell und experimenteller Struktur überein. Eine

Ausnahme ist Lys253, das im geplanten Kontakt einen großen Beitrag leistet, an der

tatsächlichen Kontaktfläche aber kaum beteiligt ist. Ebenso wurde für die Aminosäurereste

Glu250, Gln283, Asp286 und Asp312 ein Beitrag erwartet, tatsächlich bilden sie aber kaum

Wechselwirkungen. Dies ist darauf zurückzuführen, dass diese Aminosäurereste relativ weit

am Rand der geplanten Kontaktfläche liegen und durch die leichte Verschiebung im

tatsächlichen Interface zum Teil völlig aus der Kontaktfläche entfernt werden. Dagegen leistet

Glu282 in der geplanten Kontaktfläche, wo es ebenfalls am Rand zu liegen kommt, keinen

116


4.1 Proteinkontakte

Tabelle 4.1.12 Vergleich der geplanten und der tatsächlichen Kontaktflächen

Geplante Kontaktfläche

Kontaktfläche im Modell

Interface A - D Interface B - C Interface A - D Interface B - C

Kette A D B C A D B C

Größe [Å 2 ] 832 836 867 865 764 748 790 797

Anzahl Reste 27 26 25 27 25 26 26 26

Anzahl Atome 89 87 87 89 80 78 82 82

Glu246 5.4 6.3 22.0 18.7 0.6 1.0 0.2

Pro249 18.1 18.7 23.2 23.3 13.9 13.4 13.0 13.6

Glu250 9.8 13.1 19.2 15.8 1.1 1.1

Lys253 74.2 76.5 57.3 47.6 11.5 9.5

Ile277 45.0 45.1 49.8 52.0 50.9 47.4 61.4 60.0

Gly278 21.8 25.0 32.7 20.0 30.1 30.9 28.8 29.4

Trp279 38.7 39.0 37.3 37.4 32.1 28.4 36.0 37.3

Glu282 0.3 12.4 8.1

Gln283 31.5 33.3 43.7 41.1 3.8 3.5 5.1 3.7

Asp286 4.4 3.5 21.7 23.8

Arg287 93.8 97.0 58.5 65.2 59.0 56.4 56.4 53.9

Thr290 14.6 14.7 16.6 13.1 22.6 18.5 24.5 20.9

Ile291 47.7 46.4 56.9 57.0 83.3 82.8 85.1 87.9

Ala293 23.5 24.2 19.5 20.0 24.5 19.5 23.7 24.2

Ala294 49.7 49.4 49.5 49.5 44.0 48.0 44.3 47.3

Lys297 58.6 57.4 59.7 62.0 94.5 85.3 96.2 89.5

Ala298 17.8 21.3 19.6 17.1 12.7 15.0 18.6 17.6

Ala301 45.1 46.3 46.5 45.1 50.4 45.0 54.0 54.5

Ala304 14.0 14.5 11.5 11.6 13.5 13.6 13.0 13.3

Val305 63.9 64.5 69.9 68.5 47.4 51.7 50.5 52.0

Gln308 47.5 42.3 43.1 46.7 55.7 59.6 57.9 58.4

Asp312 13.2 13.8 17.9 14.8

Glu334 54.5 52.4 53.4 58.0 79.7 80.1 82.1 80.9

Gly335 24.8 19.9 26.3 31.7 20.3 20.4 22.3 20.6

Val336 9.2 8.2 10.2 11.4 8.5 7.1 7.4 5.7

* Aminosäurereste im Interface, die in keiner der Kontaktflächen mindestens 1% zur Fläche beitragen, wurden

nicht aufgeführt (Ala245, Val252, Pro292, Lys300, Ser302, Lys315, Glu333)

Die mutierten Aminosäurereste sind rot, Aminosäurereste, die Wasserstoff- oder Salzbrücken ausbilden, blau

und grün markiert.

117


4 Ergebnisse und Diskussion

Beitrag, während es im Modell für die Tetramermutante durch eine andere Rotamerstellung

der Seitenkette zum Interface beiträgt. Bis auf Lys253 sind die Unterschiede im Beitrag zur

Kontaktfläche aber relativ gering.

Abbildung 4.1.25 Stereodarstellung der Überlagerung der geplanten mit der tatsächlichen Kontaktfläche

Die Kontaktfläche des Strukturmodells für die Tetramermutante ist blau, das geplante

Interface rot gezeigt. Die wichtigsten am Interface beteiligten Aminosäurereste sind im

Detail eingezeichnet und in Tabelle 4.1.12 aufgelistet. Die mutierten Aminosäurereste sind

bezeichnet.

Abbildung 4.1.25 zeigt einen Vergleich des geplanten mit dem tatsächlichen Interface anhand

der Ketten A und D. Dazu wurden die A-Ketten überlagert und die Kontaktfläche zur Kette D

dargestellt. Die Abweichungen für die C α -Atome in der D-Kette in den Aminosäureresten

240-340 und damit in der Kontaktfläche betragen bei Überlagerung der A-Kette im Mittel

4.85 Å (rmsd) und maximal 8.2 Å. Die C α -Abstände für die einzelnen Aminosäurereste sind

in Abbildung 4.1.26 gezeigt.

10

9

8

7

∆C α

[Å]

6

5

4

3

2

1

0

240 260 280 300 320 340

Sequenznummer

Abbildung 4.1.26 C α -Abweichungen der D-Ketten zwischen geplanter und tatsächlicher Kontaktfläche

Aminosäurereste, die an der Kontaktfläche beteiligt sind, sind durch einen Balken markiert.

118


4.2 Die Peroxine PEX19 und PEX3

4.2 Die Peroxine PEX19 und PEX3

4.2.1 Reinigung von PEX19

PEX19 wurde zunächst als GST-Fusionsprotein gereinigt. Da in dem vom AK Dodt

(Physiologisch-Chemisches Institut, Universität Tübingen) erhaltenen Plasmid eine

Punktmutation enthalten war (P173S), wurde diese zunächst durch die QuikChange TM -

Methode beseitigt. GST-PEX19-Fusionsprotein konnte in E. coli BL21(DE3) in großen

Mengen produziert und über eine GSTrap-Säule aufgereinigt werden. Dabei wurde das

Fusionsprotein mit Thrombin auf der Säule geschnitten (Abschnitt 3.4.4). Abbildung 4.2.1

zeigt die Analyse der manuell eluierten Fraktionen durch eine SDS-PAGE.

Abbildung 4.2.1 SDS-PAGE zur Darstellung des Reinigungsverlaufes von PEX19

Neben PEX19 wurde dabei auch immer ein Abbauprodukt von PEX19 gebildet, das aber in

einer nachfolgenden GPC mit einer HiLoad-26/60 Superdex-75 prep grade Säule abgetrennt

werden konnte. Ein typisches Elutionsprofil der GPC sowie eine analytische SDS-PAGE der

proteinhaltigen Fraktionen sind in Abbildung 4.2.2 und Abbildung 4.2.3 dargestellt. PEX19

fand sich in den zugehörigen Fraktionen des Absorptionsmaximums bei 127 mL, was einer

relativen Molekularmasse von 137 kDa (Anhang IV) und damit einem tetrameren PEX19

(4*32.8 kDa) entspricht.

119


4 Ergebnisse und Diskussion

60

A 280nm

Absorption [mAU]

40

20

0

50 75 100 125 150 175 200

Volumen [mL]

Abbildung 4.2.2

Elutionsdiagramm einer GPC von PEX19 nach Aufreinigung durch GSTrap und

Spaltung durch Thrombin

Abbildung 4.2.3 SDS-PAGE von Fraktionen aus der in Abbildung 4.2.2 gezeigten GPC

Da die Entstehung des Abbauproduktes einen erheblichen Ausbeuteverlust darstellte, der auch

bei Schneiden in Lösung nach Elution des Proteins auftrat, und weil diese auch durch

Veränderung der Temperatur und der eingesetzten Proteaseaktivität nicht verhindert oder

zumindest vermindert werden konnte (Daten nicht gezeigt), wurde PEX19 in die Vektoren

pColdI (pColdI.PEX19) und pColdIV (pColdIV.PEX19) kloniert. Diese Vektoren sind durch

Kälteschock induzierbar, pColdI enthält zudem die Sequenz für einen durch Faktor Xa

abspaltbaren Histag. Da pColdIV.PEX19 keine Expression zeigte, wurde auf das Konstrukt

120


4.2 Die Peroxine PEX19 und PEX3

pColdI.PEX19 zurückgegriffen, das zu einer sehr hohen Expression führte. Das His 6 -

Fusionsprotein wurde in E. coli BL21(DE3) produziert und mittels Affinitätschromatographie

(Ni-Säule II) über einen Imidazolkonzentrationsgradienten gereinigt (Abbildung 4.2.4).

3500

3000

A 280nm

% B

100

90

80

Absorption [mAU]

2500

2000

1500

1000

500

70

60

50

40

30

20

10

%B

0

0

0 20 40 60 80 100 120

Volumen [mL]

Abbildung 4.2.4 Elutionsdiagramm der Affinitätsreinigung von His 6 -PEX19

Das Fusionsprotein wurde mit Faktor Xa gespalten, allerdings traten auch hier Abbauprodukte

auf. Daher wurde durch Variation von Spalttemperatur, -dauer und eingesetzter Protease-

Aktivität versucht, die Entstehung des Abbauproduktes zu vermindern. Die besten Ergebnisse

wurden bei der Spaltung mit 2 U Faktor Xa/mg Protein bei 4°C für 4 Stunden erreicht

(Abbildung 4.2.5), allerdings konnte die Entstehung von Abbauprodukten nicht völlig

verhindert werden.

Abbildung 4.2.5 SDS-PAGE der Optimierung der Faktor Xa-Spaltung von PEX19 bei 4°C

121


4 Ergebnisse und Diskussion

Die Banden der Abbauprodukte bei knapp 30 kDa und ca. 23 kDa wurden mittels Edman-

Abbau N-terminal ansequenziert. Dazu wurde das Gemisch mittels GPC an einer

HiLoad-26/60 Superdex-200 prep grade Säule (Säule I) aufgetrennt (Daten nicht gezeigt), die

Fraktionen mittels SDS-PAGE analysiert (Abbildung 4.2.6) und zusätzlich einer PAGE mit

anschließendem Transfer auf eine PVDF-Membran und Anfärbung mit Ponçeau S

unterworfen. Die N-terminale Sequenzierung wurde durch E. Schiltz durchgeführt. Das

Protein der Bande bei knapp 30 kDa eluierte in der GPC bei 185 mL, was einer apparenten

molekularen Masse von 116 kDa entspricht und wurde als PEX19 ab Val115 identifiziert. Das

Abbauprodukt, das in der SDS-PAGE bei ca. 23 kDa lief, eluierte in der GPC bei 200 mL,

was einer relativen Molekularmasse von 74 kDa entspricht. Die N-terminale Sequenzierung

wies dieses Protein als den N-terminalen Teil von PEX19 aus.

Abbildung 4.2.6

SDS-PAGE von Vollängen-PEX19 und

den beiden bei Spaltung mit Faktor Xa

entstandenen Abbauprodukten

Um die Entstehung von Abbauprodukt zu vermindern und um die hohen Kosten für

kommerziell erhältliche Proteasen wie Thrombin und Faktor Xa zu vermeiden, wurde die für

eine TEV-Schnittstelle codierende Sequenz in den Vektor pColdI.PEX19 kloniert. Das

entstandene Plasmid pColdI.TEV_PEX19 codiert für PEX19 mit einem N-terminalen

Polyhistidinrest, der vor einer Faktor Xa und einer TEV-Schnittstelle liegt. Dabei wurde das

Konstrukt so konzipiert, dass bei Spaltung mit TEV-Protease nur zwei zusätzliche

N-terminale Aminosäurereste (Gly-His) zur PEX19-Sequenz hinzukommen.

Die TEV-Protease konnte als Polyhistidinfusionsprotein selbst hergestellt werden (Abschnitt

3.4.7 und Anhang V).

122


4.2 Die Peroxine PEX19 und PEX3

pColdI.TEV_PEX19 wurde in E. coli BL21(DE3) produziert. Dazu wurde die Temperatur bei

einer OD 600 = 0.4 der Kultur auf 15°C gesenkt, zusätzlich nach einer halben Stunde mit 1 mM

IPTG induziert und anschließend die Kultur über Nacht bei 15°C geschüttelt. Als erster

Reinigungsschritt wurde eine Affinitätschromatographie (Ni-Säule I) durchgeführt. Die

Elution erfolgte hierbei über einen Stufengradienten (Abbildung 4.2.7).

3500

3000

A 280nm

% B

100

90

80

Absorption [mAU]

2500

2000

1500

1000

500

70

60

50

40

30

20

10

%B

0

0

0 50 100 150 200 250

Volumen [mL]

Abbildung 4.2.7

Elutionsdiagramm der Affinitätschromatographie von His 6 -TEV-PEX19

Zur Optimierung der Spaltung mit TEV-Protease wurden bei 3 verschiedenen Temperaturen

(4°C, RT, 37°C) und zwei verschiedenen Proteasekonzentrationen (5 µg TEV/mg PEX19 und

10 µg TEV/mg PEX19) 8 verschiedene Spaltdauern getestet. Bei 37°C wurde auch bei der

längsten Inkubation (ca. 24 Stunden) keine vollständige Spaltung erzielt, was auf eine

Zerstörung der TEV-Proteaseaktivität bei diesen Temperaturen zurückzuführen sein könnte.

Die Spaltung war auch bei niedrigeren Temperaturen und der kleineren Proteasemenge

unvollständig, dagegen wurde das Fusionsprotein sowohl bei Raumtemperatur als auch bei

4°C und Inkubation für 24 Stunden fast vollständig gespalten, wenn 10 µg TEV/mg PEX19

eingesetzt wurden. Bei Raumtemperatur war die Spaltung etwas vollständiger, aber da

gleichzeitig geringe Mengen eines Abbauproduktes entstanden, wurde auf die Spaltung bei

4°C über Nacht zurückgegriffen. Abbildung 4.2.8 zeigt im Vergleich den Abbau bei den

verschiedenen Temperaturen und Proteasekonzentrationen bei einer Inkubationszeit von ca.

24 Stunden.

123


4 Ergebnisse und Diskussion

Abbildung 4.2.8 SDS-PAGE von PEX19-Proben nach ca. 24-stündiger Spaltung mit TEV-Protease

Zur Entfernung der TEV-Protease sowie ungeschnittenen Fusionsproteins wurde eine zweite

Affinitätschromatographie durchgeführt. Da hierzu das Imidazol entfernt werden musste,

wurde die Spaltung mit der TEV-Protease bei gleichzeitiger Dialyse gegen HIS-A-Puffer

durchgeführt. Anschließend wurde das Proteingemisch erneut über die Ni-Säule (Ni-Säule I)

gegeben (Abbildung 4.2.9), wobei sich PEX19 im Durchfluss befand, während die TEV-

Protease und ungeschnittenes Fusionsprotein erst bei Erhöhung der Imidazolkonzentration

eluiert wurden.

1200

1000

A 280nm

% B

100

80

Absorption [mAU]

800

600

400

60

40

%B

200

20

0

0 20 40 60 80 100 120 140 160 180

Volumen [mL]

0

Abbildung 4.2.9

Chromatogramm der zweiten Affinitätschromatographie des gespaltenen His 6 -TEV-

PEX19 Fusionsproteins zur Abtrennung ungeschnittenen Proteins

PEX19 (in Abbildung 4.2.9 durch einen Balken markiert) wurde aufkonzentriert und als

abschließendem Reinigungsschritt einer GPC an einer HiLoad-26/60 Superdex prep grade

200-Säule (Säule I) unterworfen. PEX19 eluierte bei 178 mL, was einer apparenten Masse

124


4.2 Die Peroxine PEX19 und PEX3

von 148 kDa und damit etwa einem tetrameren PEX19 (4*32'800 Da) entspricht (Anhang IV).

Dieses Ergebnis stimmt mit dem als GST-Fusionsprotein gereinigten PEX19 überein.

Proteinhaltige Fraktionen wurden mittels SDS-PAGE auf ihre Reinheit hin überprüft und die

saubersten Fraktionen aufkonzentriert. Ein typisches Chromatogramm ist in Abbildung

4.2.10 A, die zugehörige SDS-PAGE in Abbildung 4.2.10 B zu sehen.

A

30

A 280nm

B

25

Absorption [mAU]

20

15

10

5

0

140 160 180 200 220 240

Volumen [mL]

Abbildung 4.2.10

Dokumentation der abschließenden Gelpermeationschromatographie von PEX19

A: Elutionsdiagramm des GPC-Laufs

B: SDS-PAGE Analyse der PEX19 enthaltenden Fraktionen

Abbildung 4.2.11 zeigt den Verlauf der Reinigung. PEX19 konnte in hochreiner Form

gewonnen werden. Die Ausbeute an sauberem Protein betrug bis zu 100 mg/L Kultur.

Abbildung 4.2.11 SDS-PAGE zur Dokumentation des Reinigungsverlaufes von PEX19

125


4 Ergebnisse und Diskussion

4.2.2 Kristallisationsversuche von PEX19

Für Kristallisationsansätze wurde PEX19 gegen 10 mM Tris-HCl, pH 8.0 mit 0.1% β-ME

dialysiert. Sämtliche vorhandene kommerziellen Screens (Abschnitt 2.1) wurden mit der

sitting drop-Methode angesetzt. Die Konzentration von PEX19 wurde von 10-400 mg/mL

variiert, weiterhin wurde der Zusatz von 20% (v/v) Isopropanol zum Protein (40 mg/mL) und

die Kristallisation bei 4°C (40 mg/mL PEX19) erprobt. Zudem wurde das Protein in einem

durch das EMBL Hamburg angebotenen Screening mittels eines Roboters eingesetzt. Trotz

dieser umfangreichen Kristallisationsversuche konnte keine Kristallisationsbedingung

ausfindig gemacht werden. Dies ist vermutlich darauf zurückzuführen, dass PEX19 nur sehr

wenige Sekundärstrukturelemente wie α-Helices und β-Faltblätter, dagegen aber zahlreiche

Loopregionen besitzt (Abbildung 4.2.12) und vermutlich eine sehr flexible Struktur aufweist.

Tabelle 4.2.1 fasst alle Kristallisationsversuche von PEX19-Konstrukten zusammen.

Abbildung 4.2.12 Sekundärstrukturvorhersage für PEX19

Die Sekundärstrukturvorhersage wurde mittels PredictProtein erstellt. Die Aminosäuresequenz

(AS) ist in der zweiten Zeile gegeben, Cysteine sind gelb, Methionine hellgrün

markiert. Die erste Zeile gibt die jeweilige Sequenznummer an. In der Sekundärstrukturvorhersage

(SSV) sind Loops fliederfarben und α-Helices orange hinterlegt. OV

(Oberflächenvorhersage) und WOV (Wahrscheinlichkeit der Oberflächenvorhersage) zeigen

weiterhin an, ob eine Aminosäure exponiert (e) oder verborgen (b, buried) ist.

126


4.2 Die Peroxine PEX19 und PEX3

4.2.3 Klonierung von PEX19 76-271 und Herstellung von Cysteinmutanten

Anhand der Sekundärstrukurvorhersage von PEX19 wurde eine verkürzte Sequenz (AS 76-

271) ohne die N- und C-Termini gewählt, die praktisch nur aus Loopbereichen bestehen. Das

Gen hierfür wurde mittels PCR amplifiziert und in pColdI kloniert. Dabei enthielt der

forward-Primer für die PCR die für eine TEV-Schnittstelle codierende Gensequenz, so dass

das fertige Plasmid pColdI.TEV_PEX19 76-271 für einen N-terminalen Polyhistidinrest codiert,

gefolgt von einer Faktor Xa- und einer TEV-Schnittstelle direkt vor dem Gen für PEX19.

Dabei wurde das Konstrukt so konzipiert, dass bei Spaltung mit TEV-Protease nur ein

zusätzliches N-terminales Glycin zur PEX19-Sequenz hinzukommt. PEX19 76-271 besitzt drei

Cysteine an den Positionen 128 sowie 226 und 229. Da Cysteine an der Oberfläche häufig die

Kristallisierbarkeit von Proteinen beeinträchtigen [14, 27], wurden zwei Mutanten –

PEX19 76-271 (C128S) und PEX19 76-271 (C226S, C229S) – mittels der QuikChange TM -Methode

hergestellt, in denen die Cysteine zu Serin mutiert wurden.

4.2.4 Reinigung von PEX19 76-271 und der Cysteinmutanten

Die Reinigung von PEX19 76-271 und der Mutanten PEX19 76-271 (C128S) und

PEX19 76-271 (C226S, C229S) wurde analog zur Reinigung des Volllängenproteins

durchgeführt. Im Folgenden ist beispielhaft die Reinigung von PEX19 76-271 anhand des

Elutionsdiagramms der Affinitätssäule (Abbildung 4.2.13), des GPC-Chromatogramms

(Abbildung 4.2.15) und der zugehörigen SDS-PAGEs (Abbildung 4.2.14 und Abbildung

4.2.16) gezeigt.

4000

3500

3000

A 280nm

% B

100

80

Absorption [mAU]

2500

2000

1500

60

40

% B

1000

500

20

0

0

0 50 100 150 200 250 300 350 400 450 500 550

Volumen [mL]

Abbildung 4.2.13 Chromatogramm der Affinitätschromatographie von PEX19 76-271

127


4 Ergebnisse und Diskussion

Abbildung 4.2.14 SDS-PAGE zur Dokumentation der Affinitätsreinigung von HisPEX19 76-271

Das Protein zeigte in der GPC ein Absorptionsmaximum bei 205 mL (Säule II), was einer

apparenten Molekularmasse von 108 kDa entspricht. Das Protein konnte mit hoher Reinheit

isoliert werden.

16

14

12

A 280nm

Abbildung 4.2.15

Chromatogramm der GPC von PEX19 76-271

Absorption [mAU]

10

8

6

4

2

0

100 120 140 160 180 200 220 240

Volumen [mL]

Abbildung 4.2.16

SDS-PAGE von Fraktionen aus der GPC

von PEX19 76-271

128


4.2 Die Peroxine PEX19 und PEX3

4.2.5 Kristallisationsversuche von PEX19 76-271 und der Cysteinmutanten

Für Kristallisationsansätze wurde PEX19 76-271 auf 100 mg/mL aufkonzentriert und gegen

10 mM Tris-HCl, pH 8.0 mit 0.1% β-ME dialysiert. Sämtliche vorhandenen kommerziellen

Screens (Abschnitt 2.1) wurden mit der sitting drop-Methode angesetzt. Mit den

Cysteinmutanten, deren Konzentration auf je 200 mg/mL eingestellt wurde, wurde analog

verfahren. Allerdings wurde auch mit dem verkürzten PEX19-Protein keine

Kristallisationsbedingung gefunden, und auch die Mutation der Cysteine konnte die

Kristallisierbarkeit nicht verbessern. Tabelle 4.2.1 fasst alle Kristallisationsversuche von

PEX19-Konstrukten zusammen.

Tabelle 4.2.1

Übersicht über Kristallisationsversuche von PEX19-Konstrukten

Protein Konzentration Zusätze/Temperatur* Verwendete Screens

GST-PEX19

10 mg/mL

PEX19 a)

10 mg/mL

PEX19 b) 10 mg/mL Crystal Screen I+II

PEX19 c)

10 mg/mL

25 mg/mL

Wizard Screen I+II

Wizard Screen Cryo I+II

40 mg/mL

40 mg/mL

20% (v/v) Isopropanol

4°C

Crystal Screen Cryo

Index I+II

50 mg/mL Membrane Factory

400 mg/ml Crystal Screen Lite

PEX19 76-271 100 mg/mL JBS 1-10

PEX19 76-271 (C128S)

200 mg/mL

PEX19 76-271 (C226S, C229S) 200 mg/mL

*) sofern abweichend von 20°C

a)

gereinigt als GST-Fusionsprotein, Spaltung durch Thrombin, N-terminale Sequenz GSGVP-M

b)

gereinigt als His 6 -Fusionsprotein, Spaltung durch Faktor Xa, N-terminale Sequenz H-M

c)

gereinigt als His 6 -TEV-Fusionsprotein, Spaltung durch TEV-Protease, N-terminale Sequenz GH-M

129


4 Ergebnisse und Diskussion

4.2.6 Klonierung und Reinigung von PEX3

PEX3 wurde in verschiedenen Längen in unterschiedliche Expressionsvektoren kloniert, um

eine Expression des Gens zu erzielen. Zunächst wurde die codierende Sequenz für das

Volllängenprotein in die Vektoren pT7-7, pColdI, pColdIV, pGEX4T-1 und pET32a kloniert.

Eine Expression konnte nur im Vektor pET32a festgestellt werden. Dieser Vektor enthält die

Sequenz für Thioredoxin gefolgt von einer Hexahistidinsequenz und der Sequenz für eine

Enterokinaseschnittstelle, zusätzlich befindet sich downstream der multiple cloning site eine

weitere Hexahistidinsequenz, die hier aber nicht genutzt, sondern durch ein Stopcodon von

der restlichen Sequenz getrennt wurde. Zusätzlich wurde die Sequenz für eine TEV-

Schnittstelle direkt N-terminal vor das PEX3-Gen kloniert. Das produzierte Volllängenprotein

erwies sich jedoch als unlöslich und konnte nur durch Zugabe von 4 mM Lauryldimethylamin-N-oxid

(LDAO) solubilisiert werden; andere Detergenzien sowie Veränderung

der Wachstumsbedingungen (Expressionsstamm, Wachstumsdauer und -temperatur, Medium)

oder der Aufschlussmethode (Ultraschall/ french press) zeigten keinen Einfluss (Abschnitt

3.3.8, Daten nicht gezeigt). Auch Rückfaltungsversuche (Abschnitt 3.3.9) zeigten keinen

Erfolg (Daten nicht gezeigt). Da die Ausbeute extrem gering war und die Aussichten auf eine

erfolgreiche Kristallisation durch Vorhandensein der N-terminalen Transmembranhelix

gemindert wurden, wurde die Arbeit mit diesem Konstrukt eingestellt.

4.2.7 Klonierung und Reinigung von PEX3 34-373

Da eine Reinigung von PEX3 34-373 als GST-Fusionsprotein bereits in der Literatur beschrieben

worden war [153], wurde dieses verkürzte Konstrukt mittels PCR hergestellt und in den

Vektor pET32a kloniert. Zusätzlich wurde die Sequenz für eine TEV-Schnittstelle direkt

N-terminal vor das PEX3-Gen eingefügt. Somit codierte der Vektor pET32a.TEV_PEX3 34-373

für Thioredoxin gefolgt von einer Hexahistidinsequenz und einer TEV-Schnittstelle vor dem

PEX3 34-373 -Gen. Die Expression und Löslichkeit des Thioredoxin-PEX3-Konstruktes wurden

wie für das Volllängenprotein optimiert. Am günstigsten erwies sich die Kultivierung in LB-

Medium mit Rosetta (DE3)-Zellen bei 18°C über Nacht und der Aufschluss mit Ultraschall

(Daten nicht gezeigt). Für die Reinigung wurde der Hexahistidinrest ausgenutzt und eine

Affinitätschromatographie an einer Ni-Säule durchgeführt. Die Elution erfolgte mit einer

130


4.2 Die Peroxine PEX19 und PEX3

graduellen Erhöhung der Imidazolkonzentration. Ein typisches Chromatogramm der

Affinitätssäule ist in Abbildung 4.2.17 zu sehen, Abbildung 4.2.18 zeigt die zugehörige SDS-

PAGE.

Absorption [mAU]

4000

3500

3000

2500

2000

1500

A 280nm

% B

100

80

60

40

% B

1000

500

20

0

0

0 50 100 150 200 250 300 350

Volumen [mL]

Abbildung 4.2.17 Elutionsprofil der Ni-Affinitätschromatographie von Trx-His-PEX3 34-373

Abbildung 4.2.18 SDS-PAGE zur Dokumentation der Affinitätsreinigung von Trx-His-PEX3 34-373

Zur Optimierung der Spaltung mit TEV-Protease wurden bei 3 verschiedenen Temperaturen

(4°C, RT, 37°C) und zwei verschiedenen Proteasekonzentrationen (5 µg TEV/mg

TrxPEX3 34-373 und 10 µg TEV/mg TrxPEX3 34-373 ) 8 verschiedene Spaltdauern getestet. Die

Spaltung war nie ganz vollständig und bei Raumtemperatur und 37°C fiel das Protein aus.

Daher wurde auf die Spaltung bei 4°C über Nacht zurückgegriffen, die eingesetzte

Proteasemenge schien keine bedeutende Rolle zu spielen. Abbildung 4.2.19 zeigt im

131


4 Ergebnisse und Diskussion

Vergleich das Resultat der Spaltung bei den verschiedenen Temperaturen und

Proteasekonzentrationen nach einer Inkubationszeit von ca. 24 Stunden. Das durch den

Verdau erhaltene Protein besaß N-terminal die Aminosäurereste Asp-Ile-Gly-Ser vor der

PEX3-Sequenz ab Aminosäurerest Gln34.

Abbildung 4.2.19 SDS-PAGE der Optimierung der Spaltung von Trx-His-PEX3 34-373 mit TEV-Protease

Zur Entfernung der TEV-Protease, des Thioredoxinrests sowie ungeschnittenen

Fusionsproteins wurde eine zweite Affinitätschromatographie durchgeführt. Da hierzu das

Imidazol entfernt werden musste, wurde die Spaltung mit der TEV-Protease bei gleichzeitiger

Dialyse durchgeführt. Anschließend wurde das Proteingemisch erneut über die Ni-Säule

gegeben (Abbildung 4.2.20), wobei sich PEX3 34-373 im Durchfluss befand, während die TEV-

Protease, der Thioredoxinrest und ungeschnittenes Fusionsprotein erst bei Erhöhung der

Imidazolkonzentration eluiert wurden.

1200

1000

A 280nm

% B

100

80

Absorption [mAU]

800

600

400

60

40

%B

200

20

0

0

0 20 40 60 80 100 120

Volumen [mL]

Abbildung 4.2.20 Affinitätschromatographie von gespaltenem Trx-His-PEX3 34-373 -Fusionsprotein

132


4.2 Die Peroxine PEX19 und PEX3

Als abschließender Reinigungsschritt wurde eine Anionenaustauschchromatographie an einer

MonoQ-Säule durchgeführt. Dazu wurden die PEX3 34-373 -haltigen Fraktionen aufkonzentriert,

1:10 mit salzfreiem Puffer verdünnt und auf die Säule aufgetragen. Die Elution erfolgte durch

graduelle Erhöhung der Salzkonzentration. Ein typisches Chromatogramm ist in Abbildung

4.2.21 A, die zugehörige SDS-PAGE in Abbildung 4.2.21 B zu sehen.

A

700

600

A 280nm

Leitfähigkeit [mS/cm]

% B

100

80

B

Absorption [mAU]

500

400

300

200

100

60

40

20

Leitfähigkeit [mS/cm] // %B

0

0 20 40 60 80 100

Volumen [mL]

0

Abbildung 4.2.21 MonoQ-Anionenaustauschchromatographie von PEX3 34-373

A: Chromatogramm des Säulenlaufes

B: SDS-PAGE der PEX3 34-373 -haltigen Fraktionen

Das Gel zeigt eine prominente Bande bei ca. 38 kDa, die PEX3 34-373 entspricht. Zudem trat

eine Bande bei ca. 80 kDa auf, und häufig bestand die Bande bei 38 kDa aus einer

Doppelbande (hier nicht zu sehen). Daher wurden alle drei Banden durch N-terminale

Sequenzierung analysiert. Es handelte sich bei allen drei Proteinen um PEX3 34-373 . Das

unterschiedliche Laufverhalten der beiden Spezies in der Doppelbande könnte auf eine leicht

unterschiedlich starke Denaturierung zurückzuführen sein. Die Bande bei ca. 80 kDa würde

einem Dimer entsprechen.

Zur Untersuchung des Oligomerisierungsgrades von PEX3 34-373 wurde eine GPC an einer

HiLoad-26/60 Superdex-200 prep grade Säule (Säule I) durchgeführt. PEX3 34-373 zeigt ein

Absorptionsmaximum bei 210 mL (Abbildung 4.2.22), was einer Molekularmasse von

57 kDa entspricht und damit zwischen den molekularen Massen für ein Monomer (38.2 kDa)

und ein Dimer (2*38.2 kDa) liegt. Da die durch eine GPC ermittelte Masse meist eher zu groß

133


4 Ergebnisse und Diskussion

ausfällt, wenn die Proteine keine kugelförmige Gestalt besitzen, wird anhand der GPC eher

auf einen monomeren Zustand von PEX3 34-373 geschlossen.

70

A 280nm

60

Absorption [mAU]

50

40

30

20

10

0

160 180 200 220 240

Volumen [mL]

Abbildung 4.2.22 Chromatogramm der GPC von PEX3 34-337

Abbildung 4.2.23 zeigt den Reinigungsverlauf von PEX3 34-373 . Bis auf die hier nur schwach

erkennbare Dimerbande ist das Protein sehr sauber. Die typische Ausbeute betrug 5 mg/L

Kultur.

Abbildung 4.2.23 SDS-PAGE zur Darstellung des Reinigungsverlaufs von PEX3 34-373

134


4.2 Die Peroxine PEX19 und PEX3

4.2.8 Kristallisationsversuche von PEX3 34-373

PEX3 34-373 wurde über Nacht gegen 10 mM Tris-HCl, pH 8.0 mit 0.1% β-ME dialysiert und

anschließend auf 8 - 10 mg/mL aufkonzentriert. Sämtliche vorhandene kommerziellen Screens

(Abschnitt 2.1) wurden mit der sitting drop-Methode angesetzt. Dabei bildeten sich in einigen

Bedingungen dünne Nadeln, die jedoch auch stets von Präzipitat begleitet wurden. Diese

wurden durch Änderung von Salzkonzentration, pH, Fällungsmittelkonzentration und durch

Zugabe von Additiven verfeinert. Allerdings konnte hierbei keine Verbesserung der

Kristallqualität erreicht werden. Durch F. Schmidt [111] wurde in dieses Konstrukt eine

Cysteinmutation (C235S) mittels QuikChange TM eingefügt und erneut ein Screening

durchgeführt, allerdings mit verminderter Konzentration (4 mg/mL). Hierbei fanden sich

Nadeln in denselben oder ähnlichen Bedingungen, die ebenfalls verfeinert wurden. Zwar

zeigte hier die Verfeinerung mehr Erfolg, aber die Größe der Kristalle von maximal

300 x 3 x 3 µm 3 reichte für eine röntgenographische Untersuchung nicht aus. Eine weitere

Verfeinerung steht aus.

4.2.9 Klonierung und Reinigung von PEX3 26-373

Eine Sekundärstrukturanalyse von PEX3 (Abbildung 4.2.24) zeigt, dass Gln34 voraussichtlich

mitten in einer α-Helix liegt. Daher wurde ein weiteres Konstrukt hergestellt, das die gesamte

α-Helix beinhaltet. Dazu wurde wiederum der Vektor pET32a verwendet, so dass das fertige

Plasmid pET32a.TEV_PEX3 26-373 für Thioredoxin, gefolgt von einem Hexahistidinrest, der

TEV-Schnittstelle und den Linker-Aminosäuren Gly (aus der TEV-Schnittstelle) und Asp

sowie PEX3 ab Aminosäurerest Val26 codiert.

Zusätzlich wurde eine Oberflächenanalyse für die in PEX3 enthaltenen Cysteine

durchgeführt. PEX3 besitzt 7 Cysteine an den Positionen 16, 65, 123, 235, 251, 283 und 337.

Davon wurden alle bis auf Cys123 als an der Oberfläche liegend vorhergesagt, und Cys16

befindet sich nicht im Konstrukt. Daher wurden fünf Cystein-Serin-Mutanten von PEX 26-373

mit Hilfe der QuikChange TM -Methode hergestellt: C65S, C235S, C251S, C283S und C337S.

Zwei dieser Mutanten (C235S und C251S) sowie der Wildtyp wurden durch F. Schmidt [111]

gereinigt und kristallisiert.

135


4 Ergebnisse und Diskussion

Abbildung 4.2.24 Sekundärstrukturvorhersage von PEX3

Die Sekundärstrukturvorhersage wurde mittels PredictProtein erstellt. Die Primärsequenz

(AS) ist in der zweiten Zeile gegeben, Cysteine sind gelb, Methionine hellgrün markiert. Die

erste Zeile gibt die jeweilige Sequenznummer an. In der Sekundärstrukturvorhersage (SSV)

sind Loops fliederfarben, α-Helices orange und β-Faltblätter hellblau hinterlegt. OV

(Oberflächenvorhersage) und WOV (Wahrscheinlichkeit der Oberflächenvorhersage) zeigen

weiterhin an, ob eine Aminosäure exponiert (e) oder verborgen (b, buried) ist.

4.2.10 Datensammlung

Zur Präparation der Kristalle für die Vermessung am Synchrotron wurden verschiedene

Cryoreagenzien getestet, von denen Glycerin die beste Wirkung zeigte. Die Kristalle wurden

direkt in den Cryopuffer überführt und anschließend in flüssigem Stickstoff schockgefroren

[111]. Die Datensammlung fand am SLS an den beamlines PX06 und PX10 sowie am

BESSY an den beamlines BL14.1 und BL14.2 statt. Die Kristalle des nativen Proteins

streuten bis zu einer Auflösung zwischen 3 und 4 Å. Viele Kristalle zeigten nur Diffraktion

bis ca. 8 Å, ihr Streuvermögen konnte jedoch teilweise durch Annealing von ca. 30 Sekunden

deutlich verbessert werden, so dass auch hier Datensätze mit einer Auflösung zwischen 3 und

4 Å aufgenommen werden konnten. Der beste Kristall zeigte am SLS eine Auflösung von

2.8 Å (Datensatz I). Der beste Kristall mit Selenomethionin-substituiertem Protein streute am

SLS bis ca. 3.5 Å. Für diesen Kristall wurde ein Fluoreszenzspektrum aufgenommen, um die

136


4.2 Die Peroxine PEX19 und PEX3

idealen Wellenlängen für die Messung der drei Datensätze (peak, inflection und high remote)

für die Phasierung durch MAD zu bestimmen (Daten nicht gezeigt). Die gemessenen Daten

wurden mittels XDS und XSCALE prozessiert. Die Indizierung wies auf eine hexagonale

Raumgruppe hin, wobei Raumgruppe C222 nur eine wenig schlechtere Statistik zeigte

(IDXREF, XDS). Der Vergleich der Statistiken sämtlicher hexagonaler sowie der Raumgruppe

C222 (Anhang VI, Tabelle 6.6.1) zeigte die besten Werte für Raumgruppe P622, wobei keine

Unterschiede zwischen zwei der möglichen Schraubachsen (P6 2 22 und P6 4 22) auftraten. Die

Betrachtung der stereographischen Projektionen der Selbstrotationsfunktionen (Abbildung

4.2.25) zeigt deutlich eine sechsfache Rotationsachse. Daher wurde die Strukturlösung

zunächst in den Raumgruppen P6 2 22 und P6 4 22 parallel angegangen. Tabelle 4.2.2 fasst die

Parameter und die Statistiken des MAD-Datensatzes zusammen. Die Analyse des Matthews-

Parameters und des Lösungsmittelgehalts wies zunächst auf zwei Monomere in der

asymmetrischen Einheit hin, während ein Monomer zwar theoretisch denkbar, aber relativ

unwahrscheinlich erschien.

Tabelle 4.2.2 Parameter und Statistiken des MAD-Datensatzes für PEX3 26-373

peak inflection high remote

beamline

PX06

Wellenlänge 0.9764 0.9798 0.9052

Detektor

MarCCD

Raumgruppe P6 2 22/P6 4 22

Zellparameter a, b, c [Å] 147.87, 147.87, 97.55

Auflösungsbereich [Å] a 78 - 3.5 (3.66 - 3.5)

Anzahl unabhängiger Reflexe a 15615 (1981) 15613 (1981) 15612 (1981)

Vollständigkeit [%] a 100.0 (100.0) 100.0 (100.0) 100.0 (100.0)

Multiplizität a 11.7 (11.7) 11.7 (11.7) 11.7 (11.7)

R sym-I [%] a 9.2 (44.0) 9.3 (44.9) 11.9 (65.5)

R merge-I [%] a 8.1 (27.1) 8.2 (27.5) 10.7 (39.5)

I/σ a 22.9 (5.9) 22.8 (5.7) 20.7 (4.1)

Wilson-B-Faktor [Å 2 ] 74.7 72.7 74.6

Anzahl Monomere/ASU 1 oder 2 1 oder 2 1 oder 2

Matthews-Parameter [Å 3 Da -1 ] 2.4 oder 4.7 2.4 oder 4.7 2.4 oder 4.7

Lösungsmittelgehalt 48 oder 74 48 oder 74 48 oder 74

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale

137


4 Ergebnisse und Diskussion

Abbildung 4.2.25

Stereographische Darstellung der Selbstrotationsfunktion von PEX3 26-373 bei κ=180°

Die Suche wurde bei einem Suchradius von 40 Å und 5 Å Auflösung durchgeführt. Die

Konturlinien beginnen bei einer Signalhöhe von 6 σ und haben eine Schrittweite von

0.5 σ.

4.2.11 Strukurlösung

Die Suche nach Selenpositionen wurden mittels autoSHARP anhand des MAD-Datensatzes

mit den drei Wellenlängen peak, inflection und high remote in den Raumgruppen P6 2 22 und

P6 4 22 durchgeführt. Dabei war nur die Phasierung in Raumgruppe P6 2 22 erfolgreich. Tabelle

4.2.3 zeigt die Phasierungstatistik für die Verfeinerung der Phasen mittels SHARP.

Tabelle 4.2.3 Phasierungsstatistik des SHARP-Laufs in Raumgruppe P6 2 22

Datensatz peak inflection* high remote*

Auflösungsbereich 20 – 3.5

phasing power

isomorph-zentrisch

isomorph-azentrisch

anomal-azentrisch

R cullis

isomorph-zentrisch

isomorph-azentrisch

anomal-azentrisch

0.000

0.000

1.182

0.000

0.000

0.794

0.943

0.777

0.519

0.496

0.520

0.956

FOM

zentrisch

0.333

azentrisch

0.236

* Datensätze wurden auf den peak-Datensatz skaliert

0.108

0.097

0.713

0.718

0.729

0.925

138


4.2 Die Peroxine PEX19 und PEX3

Die Schwermetallsuche führte zu 15 Positionen (Tabelle 4.2.4). Die anschließende

Dichtemodifikation mittels DM und SOLOMON, wie sie in autoSHARP implementiert sind,

ergab eine relativ gut interpretierbare Dichte, die für die Platzierung mehrerer Helices durch

ARP/wARP und den anschließenden manuellen Bau in COOT ausreichte. Dabei konnten

anhand der Selenomethionin-Positionen die Sequenz zugeordnet und große Teile des Modells

erstellt werden. Allerdings konnte nur ein Monomer pro ASU eindeutig identifiziert werden.

Um die sechszählige Achse herum fanden sich weitere Schwermetallpositionen sowie

Elektronendichte, die α-helikalem Protein entsprach (Abbildung 4.2.26). Diese Dichte reichte

aber für den Bau eines weiteren Monomers nicht aus. Zudem führte das Bauen von

Modellabschnitten stets zu sterischen Konflikten mit Symmetrieverwandten. Eine

Verfeinerung mit nur einem Monomer in der asymmetrischen Einheit führte zu hohen

R-Faktoren zwischen 45 und 50%.

Tabelle 4.2.4 Selen-Positionen für PEX3 26-373 in Raumgruppe P6 2 22

Selenposition Monomer AS-Position

1 90.458 25.229 14.366 A 238

2 66.873 25.508 18.868 A 295

3 87.125 28.889 1.878 A 72

4 71.528 22.412 4.146 A 81

5 100.060 32.746 15.818 A 270

6 136.290 14.365 8.466 -

7 128.867 4.450 8.366 -

8 86.631 23.089 14.278 A 124

9 82.685 37.554 19.311 A 351

10 96.186 24.078 8.753 A 239

11 23.007 5.879 4.055 -

12 23.025 1.558 4.280 -

13 16.482 12.110 6.431 -

14 20.778 17.583 5.415 -

15 85.216 41.160 -0.760 A 67

Die Analyse der gemessenen Daten mittels phenix.xtriage zeigte in allen Datensätzen einen

hohen Verzwilligungsgrad. Dabei zeigten der MAD-Datensatz (Tabelle 6.6.1) und der beste

native Datensatz (Datensatz I, 2.8 Å) einen Verzwilligungsgrad von über 0.45 (Anhang VI,

Tabelle 6.6.2), was ein Auseinanderrechnen der Intensitäten unmöglich macht.

139


4 Ergebnisse und Diskussion

Abbildung 4.2.26 Darstellung der Kristallpackung von PEX3 26-373 in P6 2 22

PEX3 26-373 ist als Bändermodell gezeigt. Über die 6 2 -Schraubachse symmetrieverwandte

Monomere sind gleichfarbig dargestellt. Die Selenpositionen sind als rote Kugeln gezeigt.

Die kristallographische Zelle ist eingezeichnet. Die zusätzliche Elektronendichte um die

kristallographische Achse ist für einen Ausschnitt gegeben.

Die Analyse sämtlicher gemessener Datensätze führte zur Identifikation eines Datensatzes II

mit einem Verzwilligungsgrad unter 0.4 und einer Auflösung von 3.3 Å (Anhang VI, Tabelle

6.6.3). Diese Daten wurden in allen hexagonalen Raumgruppen indiziert und

Verzwilligungsgrad und Zwillingsoperatoren mittels phenix.xtriage bestimmt. Anschließend

wurde versucht, die Intensitäten mittels DETWIN auseinanderzurechnen. Die Analyse der

entzwillingten Daten mittels phenix.xtriage zeigte, dass diese weiterhin einen beträchtlichen

Verzwilligungsgrad von etwa 0.18 besaßen, der sich auch durch Variation des

Verzwilligungsgrades für DETWIN nicht verringern ließ.

140


4.2 Die Peroxine PEX19 und PEX3

Der Datensatz I sowie der „entzwillingte“ Datensatz II wurden für die systematische Suche

nach der „richtigen“ Raumgruppe eingesetzt. Dazu wurde mittels PHASER in allen

Raumgruppen nach dem vorliegenden PEX3-Modell und bei erfolgreicher Platzierung

nacheinander nach weiteren Monomeren gesucht, bis sich keine mehr in der asymmetrischen

Einheit platzieren ließen. Die Qualität der Lösungen wurde anhand der Z-Scores für die

Rotations- und die Translationssuche sowie anhand der R-Faktoren nach einer Runde

Verfeinerung durch REFMAC bewertet (Daten nicht gezeigt). Dabei wurden in sämtlichen

Raumgruppen weniger Monomere gefunden als die Analyse des Matthews-Parameters

vermuten ließ. Die Packung der Monomere wies daher häufig große Löcher auf und die

Kristallkontakte waren extrem klein. Eine Ausnahme bildeten die Raumgruppen P3 1 21 und

P3 2 21, in denen jeweils drei Monomere platziert werden konnte, die allerdings sterische

Konflikte aufwiesen. Trotz der unterschiedlichen Packungsdichte wiesen die Modelle aller

Raumgruppen einen relativ ähnlichen R-Faktor auf, der keine Rückschlüsse auf die korrekte

Raumgruppe zuließ.

Die etwas bessere Packung der Raumgruppen P3 1 21 und P3 2 21 wurde zum Anlass

genommen, in diesen Raumgruppen mittels autoSHARP/SHARP neu zu phasieren. Dabei war

nur die Phasierung in Raumgruppe P3 2 21 erfolgreich. Die Phasierungsstatistiken (Anhang VI,

Tabelle 6.6.4) sind nur geringfügig besser als für die Phasierung in P6 2 22. Die Analyse der

dichtemodifizierten Elektronendichtekarte zeigte eine ähnliche Packung der Monomere wie

sie bereits in Raumgruppe P6 2 22 gefunden worden war und weicht vom Ergebnis der

PHASER-Lösung für diese Raumgruppe ab. Das in P6 2 22 erstellte Modell ließ sich an zwei

Positionen in der asymmetrischen Einheit platzieren. An der dreizähligen Achse fanden sich

ähnlich wie für Raumgruppe P6 2 22 zusätzliche Selenpositionen sowie Elektronendichte, die

auf ein helikales Protein hinwies. Die gefundenen Schwermetallpositionen (Anhang VI,

Tabelle 6.6.5) wurden mittels COOT manuell untersucht und der Aminosäuresequenz

zugeordnet. Anhand des Musters der Selenpositionen wurde versucht, unter den übrigen, um

die dreizählige Achse liegenden Selenpositionen ein drittes Monomer ausfindig zu machen.

Dabei gelang es zwar, die Selenpositionen zuzuordnen und ein drittes Monomer entsprechend

in die Dichte zu platzieren, dieses überlagerte allerdings mit seinen Symmetrieverwandten.

Eine Verfeinerung verlief wie in Raumgruppe P6 2 22 erfolglos.

141


4 Ergebnisse und Diskussion

Die zusätzliche Phasierung in Raumgruppe P3 2 21 konnte somit nicht zur Verbesserung des

initialen Modells herangezogen werden. Da jedoch sowohl in Raumgruppe P6 2 22 als auch

Raumgruppe P3 2 21 dieselbe Packung der ein bzw. zwei Monomere in der asymmetrischen

Einheit beobachtet wurde, die Elektronendichte für diese sehr gut war und sich die Werte der

Phasierungsstatistik im üblichen Rahmen befanden, wurde diese Packung als richtig

angenommen und im Folgenden für die Suche mittels PHASER in sämtlichen Raumgruppen

der nativen Datensätze verwendet. Diese Packung besteht in der Ausbildung einer

scheibenförmigen Anordnung durch Aneinanderlagerung zweier Monomere mit der langen

N-terminalen α-Helix. Dieses scheibenförmige Gebilde, aus dem die beiden α-Helices radial

herausragen, lagert sich zu Stapeln entlang einer zur drei- bzw. sechszähligen Achse

parallelen dreifachen Schraubachse zusammen. Diese Stapel stehen untereinander durch eine

sechsfache Schraubachse miteinander in Beziehung, die durch einen zentralen Hohlraum

verläuft. Dort befinden sich die zusätzliche Elektronendichte und die zusätzlichen

Schweratompositionen, deren Symmetrie für die unterschiedliche Gesamtsymmetrie

verantwortlich ist (Abbildung 4.2.26). Für die Suche mittels PHASER wurden die zwei in

P3 2 21 gut platzierbaren Monomere als Suchmodell verwendet und erneut sämtliche

möglichen hexagonalen Raumgruppen der Datensätze I und II (entzwillingt) durchsucht. Die

Qualität der gefundenen Lösungen wurde wie oben anhand der Z-Scores für die Rotationsund

Translationssuche, anhand der entstandenen Packung sowie der R-Faktoren eines

einmaligen Verfeinerungslaufs mittels REFMAC analysiert. Dabei war das Ergebnis in den

entzwillingten Datensätzen deutlich schlechter als für Datensatz I, für den Lösungen nur in

den Raumgruppen P6 2 , P3 2 und P3 2 21 gefunden wurden (Tabelle 4.2.5). Die weitere Suche

nach zusätzlichen Monomeren verlief erfolglos.

Tabelle 4.2.5 Ergebnis der Suche nach zwei PEX3-Monomeren in fixierter Anordnung

RG

durch PHASER platzierte „Dimere“

(Z-Score Rotation/Translation)

R-Faktoren

der Lösung

Nr. 1 Nr. 2 weitere R cryst /R free [%] FOM

P3 2 5.2/11.2 3.4/10.0 - 38/44 56

P3 2 21 4.0/9.1 - 40/46 50

P6 2 3.9/9.0 - 38/45 55

Die Z-Scores waren für alle drei Raumgruppen, in denen die Suche erfolgreich verlief,

deutlich besser als für die Suche nach einem einzelnen Monomer. Dies ist ein weiterer

Hinweis darauf, dass die angenommene Packung tatsächlich richtig ist.

142


4.2 Die Peroxine PEX19 und PEX3

Die anschließende Verfeinerung durch phenix.refine sowie manuellen Bau in COOT und

Verfeinerung durch REFMAC blieb allerdings auf Grund der Verzwilligung erfolglos, die

R-Faktoren wurden nicht besser als bei der initialen Lösung. Zudem trat praktisch keinerlei

Differenzdichte auf, so dass Modellkorrekturen nur anhand der (2F obs -F calc )-Dichte

vorgenommen werden konnten. Auf Grund der schlechten Daten war es auch nicht möglich,

die geometrischen Parameter des Modells zu optimieren, so dass die Verfeinerung schließlich

abgebrochen werden musste. Programme, die bei der Verfeinerung die Verzwilligung

berücksichtigen, benötigen entweder einen deutlich von 0.5 verschiedenen

Verzwilligungsgrad (z. B. CNS [136]) oder eine deutlich bessere Auflösung (z. B. SHELXL

[154]). Das Modell, bei dem die Verfeinerung schließlich abgebrochen wurde, enthält die

Aminosäurereste 29-216, 230-304 sowie 312-365 (Abbildung 4.2.28).

4.2.12 Strukturbeschreibung

Sekundärstrukturbeschreibung

Auf Grund der schlechten Geometrie des vorliegenden Modells mit mehr als 20% der

(φ/ψ)-Winkel außerhalb der erlaubten Bereiche des Ramachandran-Diagramms (Daten nicht

gezeigt) verlief die Sekundärstrukturbestimmung mit DSSP und STRIDE unbefriedigend.

Abbildung 4.2.27 zeigt daher eine grobe Zuordnung der Aminosäuresequenz zu den

Sekundärstrukturelementen nach manueller Inspektion des Modells. PEX3 26-373 ist demnach,

wie auch schon anhand der Sekundärstrukturvorhersage (Abbildung 4.2.24) ersichtlich war,

ein rein α-helikales Protein, das aus etwa 10 α-Helices besteht.

. . . . . . . . 110

vyiLGKYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKII


α1

. . . . . . . . 200

SFTRSTVAVYSTCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELITVIKQAVQKVLGSVSLKHSL


α2

α3

. . . . . . . . 290

SLLDLEQKLKEIRNLVeqhkssswinkdgSKPLLSHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSR


α4 α5 α6 α7

. . . . . . . . 373

LLDNMAEFFRPTEQdlqhgnsMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFstpqqlek


α8 α9 α10

Abbildung 4.2.27 Manuelle Zuordnung der Sekundärstrukturelemente

Aminosäuresequenz und Sequenzpositionen sind gegeben. Aminosäurereste, die im Modell

fehlen, sind durch Kleinbuchstaben markiert. Die beiden letzten Zeilen enthalten die

Zuordnung zu den Sekundärstrukturelementen und ihre Nummerierung.

143


4 Ergebnisse und Diskussion

Tertiärstruktur

Das vorläufige Modell für das PEX3 26-373 -Monomer ist in Abbildung 4.2.28 gezeigt.

PEX3 26-373 liegt als rein α-helikales Protein vor, bei dem sich die α-Helices zu einem großen

Bündel zusammenlagern. Besonders auffällig ist die N-terminale, gut 60 Aminosäurereste

lange Helix α1, die im Volllängen-Protein direkt mit der Transmembranhelix verbunden ist.

Die Suche nach Strukturhomologen mittels DALI blieb erfolglos, was vermutlich nicht auf die

schlechte Geometrie des Modells zurückzuführen ist, sondern vielmehr darauf hinweist, dass

PEX3 eine bisher nicht beobachtete Proteinfaltung besitzen könnte.

Abbildung 4.2.28

Stereodarstellung des vorläufigen Strukturmodells von PEX3 26-373 als Bändermodell

N- und C-Terminus sowie die einzelnen α-Helices gemäß Abbildung 4.2.27 sind

beschriftet. Die fehlenden Loops 216-230 und 304-312 sind durch dunkelblaue Punkte

verbunden. Die Aminosäurereste 120-134, die an der PEX19-Bindung beteiligt sein

sollen, sind rot markiert.

Die stark konservierten Aminosäurereste 120-134 (in Abbildung 4.2.28 rot markiert) sind als

Bindestelle für PEX19 vorgeschlagen worden, nachdem gezeigt wurde, dass sie in

Verbindung mit einer Kernlokalisierungssequenz PEX19 in den Zellkern transportieren [55].

Das vorliegende Modell muss allerdings Zweifel an der identifizierten Bindungsstelle

144


4.2 Die Peroxine PEX19 und PEX3

wecken, da sich die entsprechenden Aminosäurereste im Proteininneren befinden und ohne

eine größere Konformationsänderung nicht für PEX19 zugänglich sind. Da dieser Bereich

stark hydrophob ist, handelt es sich bei dem beobachteten Effekt vermutlich um eine

unspezifische Interaktion mit PEX19, das bekanntermaßen an hydrophobe Helices bindet

[30]. Die Interaktionsstelle zu PEX19 muss daher neu identifiziert werden. Die starke

Konservierung, die für diese Helix zwischen den PEX3-Proteinen verschiedener Spezies

beobachtet wurde, ist vermutlich auf die zentrale strukturelle Bedeutung dieses Bereiches

zurückzuführen.

Quartärstruktur

Eine Analyse der Kristallkontakte mittels PISA (Daten nicht gezeigt), die manuelle Analyse

der Packung im Kristall sowie die Ergebnisse der GPC [111] lassen alle auf einen monomeren

Status von PEX3 schließen.

4.2.13 Herstellung des PEX3-PEX19-Komplexes

PEX3 und PEX19 interagieren in vivo und in vitro miteinander [54]. Daher sollte versucht

werden, die beiden Proteine im Komplex zu kristallisieren und ihre Struktur aufzuklären.

Dafür wurde zunächst getestet, ob die rekombinant hergestellten Proteine miteinander

interagieren und wie das Verhältnis beider Proteine in einem potentiell gebildeten Komplex

ist. Hierfür wurden PEX3 34-373 und PEX19 wie unter Abschnitt 4.2.7 und 4.2.1 beschrieben

gereinigt und einer Gelpermeationschromatographie an einer HiLoad-16/60 Superdex-200

prep grade Säule unterworfen. Die peroxinhaltigen Fraktionen (in Abbildung 4.2.29 A durch

einen schwarzen bzw. blauen Balken markiert) wurden jeweils vereint, aufkonzentriert und

anschließend gemischt. Das Gemisch wurde dann erneut einer Gelpermeationschromatographie

an einer HiLoad-16/60 Superdex-200 prep grade Säule unterworfen

(Abbildung 4.2.29 A). Da PEX3 34-373 und PEX19 in einer SDS-PAGE praktisch identisch

laufen, ist diese für die Analyse der proteinhaltigen Fraktionen wenig aussagekräftig

(Abbildung 4.2.29 B).

145


4 Ergebnisse und Diskussion

70

60

PEX19

PEX3 34-373

PEX3 34-373 -PEX19-Gemisch

Absorption [mAU]

50

40

30

20

10

0

60 80 100

Volumen [mL]

Abbildung 4.2.29 Analyse eines PEX3 34-373 -PEX19-Gemisches mittels GPC

A: Chromatogramm der einzelnen Komponenten (schwarz, blau) und des Gemisches (rot)

B: SDS-PAGE der Fraktionen aus dem GPC-Lauf des Peroxingemisches (rot)

PEX19 zeigt ein Absorptionsmaximum bei 78 mL, was einer Molekularmasse von 126 kDa

und damit dem bereits beobachteten Tetramer entspricht. PEX3 34-373 eluiert bei 88 mL, was

einer Molekularmasse von 55 kDa und damit eher einem Monomer als einem Dimer

entspricht. Das Gemisch zeigt ein Absorptionsmaximum bei 88 mL durch nicht gebundenes

PEX3 34-373 und einen breiten Peak bei 74 mL, der eine leichte Schulter bei 78 mL besitzt, was

mit dem Elutionsvolumen von reinem PEX19 übereinstimmt. Der Peak bei 74 mL entspricht

einer Molekularmasse von 175 kDa. Bei Annahme eines tetrameren Zustandes von PEX19

und eines monomer vorliegenden PEX3 34-373 würde dies eine 1:1-Assoziation von PEX19-

Tetramer und PEX3 34-373 -Monomer bedeuten. Für Kristallisationsversuche wurde daher

PEX19 zunächst in vierfachen Überschuss eingesetzt. In Zusammenarbeit mit F. Schmidt

wurde die Zusammensetzung des Komplexes weiter untersucht, indem eine Native PAGE mit

unterschiedlichen Mischungsverhältnissen der beiden Proteine durchgeführt wurde. Dabei

konnte PEX19 immer als freies Monomer gefunden werden, wenn es im Vergleich zu PEX3

im Überschuss eingesetzt wurde (mündliche Mitteilung). Dies spricht für eine 1:1-

Zusammensetzung des Komplexes. Als Konsequenz davon muss der in der GPC beobachtete

tetramere Oligomerisierungsgrad von PEX19 (Abbildung 4.2.10) in Frage gestellt werden.

Sollte der für PEX19 beobachtete Absorptionspeak dem monomeren Protein entsprechen, so

würde das bedeuten, dass PEX19 eine extrem offene Struktur besitzt oder sogar teilweise

ungefaltet vorliegt, was die erfolglosen Kristallisationsversuche erklären würde.

146


4.2 Die Peroxine PEX19 und PEX3

Das Auftreten eines Absorptionsmaximums, das bei den einzelnen Proteinen nicht auftritt und

somit wahrscheinlich einem Komplex aus PEX3 34-373 und PEX19 entspricht, ist ein guter

Hinweis darauf, dass die beiden rekombinant hergestellten Proteine miteinander interagieren

und dass der Komplex hinreichend stabil für Kristallisationsversuche sein sollte. Bei einer

Rechromatographie nach einer Inkubation von mehreren Stunden bei 4°C konnte keine

nennenswerte Dissoziation des Komplexes festgestellt werden (Daten nicht gezeigt). Auch die

Native PAGE deutet auf eine stabile Assoziation der beiden rekombinant hergestellten

Peroxine hin.

4.2.14 Kristallisation des PEX19-PEX3 34-373 -Komplexes

Für Kristallisationsversuche wurden die gereinigten, gegen 10 mM Tris-HCl, pH 8.0,

0.1% (v/v) β-ME dialysierten Proteine in einem Verhältnis von 1:1 oder 4:1 (PEX19/PEX3)

gemischt. Mittels der sitting drop-Methode wurde unter der Verwendung kommerziell

erhältlicher sparse matrix screens nach initialen Kristallisationsbedingungen gesucht.

Alternativ wurde der Komplex mittels Gelpermeationschromatographie gereinigt und

rechromatographiert, gegen 10 mM Tris-HCl, pH 8.0, 0.1% β-ME dialysiert, auf 40 mg/mL

aufkonzentriert und für Screeningversuche eingesetzt, die allerdings erfolglos verliefen.

Tabelle 3.5.1 fasst die durchgeführten Kristallisationsversuche zusammen. Dabei wurde nur

mit dem 4:1-Proteingemisch eine Kristallisationsbedingung gefunden (Tabelle 4.2.6), die mit

derselben Proteinpräparation mittels der hanging drop-Methode bezüglich

Fällungsmittelkonzentration und pH verfeinert wurde. Dabei wuchsen die Kristalle innerhalb

einer Woche bis zu einer maximalen Größe von 10 x 20 x 200 µm 3 .

Eine weitere Verfeinerung der Kristalle konnte nicht durchgeführt werden, da es nicht gelang,

diese Kristalle zu reproduzieren. Bei den Reproduktionsversuchen wurden das Verhältnis der

Proteine zueinander, ihre Konzentration, die β-ME-Konzentration des Dialysepuffers und der

Ausgangs-pH-Wert variiert. Ferner wurde statt PEX3 34-373 auch das Konstrukt PEX3 26-373

eingesetzt. Da der Komplex über einen relativ breiten pH- und Fällungsmittelbereich

kristallisierte und auch bei den Screening-Versuchen nur bei einer Proteinpräparation eine

initiale Bedingung gefunden worden war, ist vermutlich die Proteinqualität die Ursache für

das Versagen der Reproduktionsversuche.

147


4 Ergebnisse und Diskussion

Tabelle 4.2.6 Kristallisationsbedingung des PEX19-PEX3-Komplexes

Parameter

Wert

Reservoirpuffer a 0.1 M NaCacodylat, pH 6.0-6.9,

30% (w/v) PEG-4000, 0.2 M MgCl 2

Kristallisationsmethode hanging drop

Vorsättigung

50% (v/v) der Reservoirkonzentration

Proteinkonzentration a 32 mg/mL PEX19

8 mg/mL PEX3 34-373 Gemisch

Kristallisationspuffer a 10 mM Tris-HCl, pH 8.0,

0.1% (v/v) β-Mercaptoethanol

Tropfengröße 2-5 µL

Temperatur 20°C

a Die Angaben beziehen sich auf die Konzentrationen vor Ansetzen des Kristallisationstropfens

100 µm

4.2.15 Datensammlung

Für die Vermessung der Komplex-Kristalle am Synchrotron wurden diese durch Inkubation in

Reservoirpuffer mit 35% (v/v) Glycerin gegen Eisbildung geschützt und anschließend direkt

in flüssigem Stickstoff schockgefroren. Die vermessenen Kristalle streuten am SLS bis zu

einer Auflösung zwischen 2.3 und 3.5 Å. Die Daten wurden mittels XDS und XSCALE

prozessiert. Sämtliche Kristalle gehören der Raumgruppe P1 an, sind aber wenig isomorph

zueinander. Die Statistiken für den besten Datensatz sind in Tabelle 4.2.7 zusammengefasst.

Auf Grund der Größe der Zelle (Tabelle 4.2.7) lassen sich maximal je ein Monomer PEX19

und PEX3 34-373 in der asymmetrischen Einheit unterbringen, was mit den Ergebnissen der

Nativen PAGE übereinstimmt. Allerdings kann nicht ausgeschlossen werden, dass sich nur

eines der beiden Peroxine im Kristall befindet. Auf Grund der kleinen Größe der Kristalle, der

geringen Verfügbarkeit von Kristallen und des sehr ähnlichen Laufverhaltens der beiden

Peroxine in einer SDS-PAGE (Abbildung 4.2.29 B) konnte auch nicht überprüft werden, ob

beide Proteine im Kristall enthalten waren. Eine Reproduktion der Kristalle gelang aber auch

nicht mit den einzelnen Peroxinen.

148


4.2 Die Peroxine PEX19 und PEX3

Da eine Reproduktion der Kristalle nicht gelang und somit eine Phasierung durch

Selenomethionin-substituiertes Protein nicht möglich war, wurde für die Phasierung versucht,

einige der vorhandenen Kristalle mit Schwermetallionen zu soaken (Abschnitt 3.5.1). Der

Erfolg der Soakversuche wurde am SLS mit Hilfe von Fluoreszensscans überprüft. Dabei

wurde nur für Tantal-gesoakte Kristalle ein Maximum an der Absorptionskante des Metalls

gefunden (Daten nicht gezeigt). Für diese Kristalle wurde versucht, einen MAD-Datensatz

aufzunehmen. Lediglich ein Kristall zeigte dabei Diffraktion unter 4 Å Auflösung, wies aber

so große Strahlenschäden auf, dass bereits der peak-Datensatz nicht vollständig aufgenommen

werden konnte. Da keine weiteren Kristalle vorhanden waren, konnten keine weiteren

Versuche zur Phasierung mit Schwermetallionen unternommen werden. Das für PEX3 26-373

erstellte Modell (Abschnitt 4.2.11) reichte für eine Phasierung durch PHASER ebenfalls nicht

aus.

Tabelle 4.2.7 Parameter und Statistiken des Datensatzes des PEX3-PEX19-Komplexes

Kristallform I

beamline

PX06

Wellenlänge λ [Å] 1.0000

Detektor

MarCCD

Raumgruppe

P1

Zellparameter a, b, c [Å]

α, β, γ [°]

47.85, 48.32, 59.53

99.23, 91.64, 114.80

Auflösungsbereich [Å] a 56.8 - 2.25 (2.4 - 2.25)

Anzahl unabhängiger Reflexe a 49463 (6419)

Vollständigkeit [%] a 95.8 (90.9)

Multiplizität a 2.3 (1.8)

R sym-I [%] a 16.1 (42.4)

R merge [%] a 28.9 (62.2)

I/σ a 2.3 (1.8)

Wilson B-Faktor [Å 2 ] 33.0

vermutete Anzahl Monomere/ASU b 1 PEX3 34-373 + 1 PEX19

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale.

b Da die Zusammensetzung der Kristalle nicht geklärt werden konnte, können hierüber

nur Vermutungen angestellt werden. Bei der angenommenen Zusammensetzung der

ASU beträgt der Matthews-Parameter 1.9 Å 3 Da -1 und der Lösungsmittelgehalt 35%.

149


4 Ergebnisse und Diskussion

4.3 Das Moskitozide Toxin (MTX)

4.3.1 Reinigung des MTX-Holotoxins

Die rekombinante Expression und Reinigung des MTX-Holotoxins aus Bacillus subtilis

SSII-1 erfolgte am Institut für Experimentelle und Klinische Pharmakologie und Toxikologie

der Universität Freiburg in Zusammenarbeit mit O. Wunderlich. MTX wurde ohne die

Signalsequenz (AS 1-29) als N-terminales GST-Fusionsprotein in E. coli produziert und an

eine Affinitätssäule gebunden. Das Holotoxin wurde durch proteolytischen Verdau mit

Thrombin von der GST abgespalten und nachfolgend eluiert. Das erhaltene Protein enthält die

Aminosäurereste 30-870 von MTX sowie drei zusätzliche N-terminale Aminosäuren und wird

im Weiteren als MTX 30-870 bezeichnet.

Als zusätzlicher Aufreinigungsschritt wurde eine GPC mit einer HiLoad-26/60 Superdex-200

prep grade Säule (Säule I) und GPC-C-Puffer durchgeführt. Ein typisches Elutionsprofil der

GPC ist in Abbildung 4.3.1 dargestellt.

80

A 280nm

Absorption [mAU]

60

40

20

0

0 50 100 150 200 250

Volumen [mL]

Abbildung 4.3.1 GPC von MTX-Holotoxin

Das Chromatogramm weist ein Absorptionsmaximum bei 212 mL auf, was einer apparenten

Molekularmasse von ca. 54 kDa entspricht (Anhang IV), während die theoretische

Molekularmasse von MTX 30-870 97.3 kDa beträgt. Diese deutliche Diskrepanz ist vermutlich

150


4.3 Das Moskitozide Toxin (MTX)

auf Wechselwirkungen zwischen den wahrscheinlich zuckerbindenden ricinähnlichen

Domänen und dem Säulenmaterial zurückzuführen. Die Analyse durch eine SDS-PAGE

(Abbildung 4.3.2) zeigt, dass das Absorptionsmaximum der GPC auf Protein mit einer

Molekularmasse von ca. 92 kDa zurückzuführen ist, was dem Holotoxin entspricht.

Abbildung 4.3.2 SDS-PAGE von Fraktionen aus der GPC von MTX-Holotoxin (Abbildung 4.3.1)

Neben der Bande für das MTX-Holotoxin bei ca. 92 kDa traten dabei auch stets eine Bande

bei ca. 66 kDa sowie leichte Banden um 30 kDa auf. Dabei könnte es sich um den C-

Terminus mit den ricinähnlichen Domänen bzw. um die katalytische Domäne handeln, die

durch unspezifische Proteolyse des Holotoxins durch Thrombin während der Reinigung

entstanden sein könnten. Da diese Verunreinigung keine Auswirkung auf die

Kristallisierbarkeit des Proteins zeigte, wurde auf eine genauere Analyse der Proteinbanden

sowie auf eine weitere Aufreinigung verzichtet.

MTX 30-870 -haltige Fraktionen (in Abbildung 4.3.1 durch einen Balken gekennzeichnet)

wurden vereinigt und über Nacht gegen 5 mM Tris-HCl, pH 8.5 dialysiert. Auf den Zusatz

von Reduktionsmittel während der Kristallisation konnte verzichtet werden, da MTX 30-870

keine Cysteine enthält.

151


4 Ergebnisse und Diskussion

4.3.2 Kristallisation von MTX-Holotoxin

Eine initiale Kristallisationsbedingung von MTX 30-870 war bereits von D. Reinert durch

Screening mit der sitting drop-Methode gefunden worden. MTX 30-870 bildet unter der

Kristallisationsbedingung des kommerziellen Screens JBS4, A3 (3% (w/v) PEG-6000, 0.1 M

Tris-HCl, pH 8.5, 0.1 M KCl, Kristallisatonsbedingung II) dünne, plattenförmige Kristalle der

Raumgruppe P3 (a=b=130.0 Å, c=68.8 Å) aus, die am SLS bis 2.9 Å streuten.

In der hier vorliegenden Arbeit wurde zunächst versucht, diese Kristallisationsbedingung

durch Ändern der Fällungsmittelkonzentration, des pH-Wertes und der Salzkonzentration zu

verfeinern. Ferner wurden microseeding-Experimente durchgeführt (Abschnitt 3.5.1) und

Tropfengröße und Proteinkonzentration variiert. Dazu wurde das Protein auf 10 mg/mL

aufkonzentriert und verschiedene Verfeinerungsscreens mit der hanging drop-Methode

angesetzt (Abschnitt 3.5.1). Dabei gelang es durch Erhöhung der KCl-Konzentration und

leichte Absenkung des pH-Wertes, deutlich größere und vor allem dickere Kristalle zu

erzeugen (Abbildung 4.3.3 A). Diese Kristalle wuchsen innerhalb von ein bis drei Wochen,

bei zusätzlichem microseeding innerhalb eines Tages, lösten sich aber ca. 2 Wochen nach

ihrer Entstehung wieder auf. Trotz größerer Kristalle konnte für diese Kristallform jedoch

keine verbesserte Auflösung erzielt werden. Daher wurde eine weitere Verbesserung der

Kristalle durch den Einsatz von Additiven angestrebt. Die meisten Zusätze verhinderten die

Kristallisation, n-Butanol und MPD allerdings beeinträchtigten das Kristallwachstum nicht,

sondern führten vielmehr zu optisch leicht veränderten Kristallen, die zwar nicht ganz so groß

wurden, dafür aber weniger plattenförmig (Abbildung 4.3.3 B), und die über mehrere Wochen

bis Monate stabil waren. Eine Verfeinerung der n-Butanol- bzw. MPD-Konzentration brachte

keine weitere Verbesserung der Kristalle, und nur der Einsatz von MPD (Tabelle 4.3.1) führte

auch zu einer verbesserten Auflösung.

A

B

100 µm 100 µm

Abbildung 4.3.3 Kristalle von MTX 30-870

A: Kristall aus Verfeinerungsscreen (Kristallisationsbedingung II)

B: Kristall mit Additiv MPD (Kristallisationsbedingung I)

152


4.3 Das Moskitozide Toxin (MTX)

Tabelle 4.3.1 Kristallisationsbedingung I für MTX 30-870

Parameter

Wert

Reservoirpuffer a

3% (w/v) PEG-6000, 0.1 M Tris-HCl, pH 8.3, 250 mM KCl,

4% (v/v) MPD

Kristallisationsmethode hanging drop

Vorsättigung

50% (v/v) der Reservoirkonzentration

Konzentration MTX 30-870 a 10 mg/mL

Kristallisationspuffer 5 mM Tris-HCl, pH 8.5

Tropfengröße 4 µL

Temperatur 20°C

a Die Angaben beziehen sich auf die Konzentrationen vor Ansetzen des Kristallisationstropfens

4.3.3 Datensammlung

Zur Präparation der Kristalle für die Vermessung am Synchrotron wurden verschiedene

Reagenzien als Kälteschutzmittel getestet, von denen Glycerin die beste Wirkung zeigte. Bei

Verwendung jedes getesteten Cryoreagenzes zeigten sich jedoch schnell Risse in den

Kristallen oder die Kristalle lösten sich ganz auf. Auch durch eine allmähliche Steigerung der

Cryoreagenz-Konzentration konnte dies nicht verhindert werden. Daher wurden die Kristalle

nur sehr kurz in den Cryopuffer (3% (w/v) PEG-6000, 0.1 M Tris-HCl, pH 8.3, 250 mM KCl,

4% (v/v) MPD, 35% (v/v) Glycerin) überführt und anschließend direkt in flüssigem Stickstoff

schockgefroren. Die Kristalle wurden am BESSY an der beamline BL14.2 auf ihre

Röntgentauglichkeit geprüft. Nur wenige Kristalle streuten besser als 3 Å, die beste erzielte

Auflösung betrug 2.5 Å. Die Daten wurden mittels XDS und XSCALE prozessiert. In Tabelle

4.3.2 sind die Parameter und die Statistik des für MTX 30-870 aufgenommenen Datensatzes

(Kristallform I) zusammengefasst und im Vergleich mit den Daten der Raumgruppe P3

(Kristallform II) gezeigt.

Die Analyse des Matthews-Parameters und des Lösungsmittelgehaltes ließ zunächst drei

Monomere in der asymmetrischen Einheit vermuten (Matthews-Parameter 2.27 Å 3 Da -1 ,

Lösungsmittelgehalt 46%). Die Betrachtung der stereographischen Projektionen der

Selbstrotationsfunktionen (Abbildung 4.3.4) half bei der Frage nach der Anzahl der

Monomere nicht weiter, so dass erst die Phasierung der Daten die Klärung brachte (Abschnitt

4.3.4). Die unvermutet geringe Anzahl der Monomere pro ASU und der damit verbundene

hohe Lösungsmittelanteil von 64% erklärt die geringe erzielte Auflösung. Bemerkenswert ist

153


4 Ergebnisse und Diskussion

außerdem, dass die Zugabe von MPD zwar zu einer anderen Raumgruppe führte, diese ist

jedoch mit der ursprünglichen Raumgruppe eng verwandt in Bezug auf Lösungsmittelgehalt

und Packung (Abbildung 4.3.13, Tabelle 4.3.8).

Tabelle 4.3.2 Parameter und Statistiken des Datensatzes für MTX 30-870

Kristallform I

Kristallform II

beamline BL14.2 PX06

Wellenlänge λ [Å] 0.9184 0.9184

Detektor MarCCD MarCCD

Raumgruppe H3 P3

Zellparameter a, b, c [Å] 130.96, 130.96, 396.06 129.97, 129.97, 68.82

Auflösungsbereich [Å] a 74.5 - 2.5 (2.58 - 2.5) 50 - 2.9 (3.0 - 2.9)

Anzahl unabhängiger Reflexe a 87’586 (7894) 29’077 (3331)

Vollständigkeit [%] a 99.9 (99.8) 99.9 (99.9)

Multiplizität a 7.1 (5.0) 5.7 (5.8)

R sym-I [%] a 8.4 (47.8) 10.7 (46.3)

R merge-I [%] 8.6 (38.0) 8.3 (33.1)

I/σ a 18.6 (3.3) 11.8 (4.0)

Wilson B-Faktor [Å 2 ] 47.8 59.5

Anzahl Monomere 2 1

Matthews-Parameter [Å 3 Da -1 ] 3.4 3.5

Lösungsmittelgehalt [%] 64 65

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale.

Abbildung 4.3.4

Stereographische Darstellung der Selbstrotationsfunktion von MTX 30-870 bei κ=180°

(Kristallform I)

Die Suche wurde bei einem Suchradius von 70 Å und 4 Å Auflösung durchgeführt. Die

Konturlinien beginnen bei einer Signalhöhe von 6 σ und haben eine Schrittweite von

0.5 σ. Neben den kristallographischen Achsen findet sich eine nichtkristallographische

zweizählige Achse, die zu den kristallographischen Achsen Winkel von 90°, 150° und 30°

einschließt.

154


4.3 Das Moskitozide Toxin (MTX)

4.3.4 Strukturlösung

Phasierung und Modellbau

Die Phasierung des MTX-Holotoxins erfolgte durch molekularen Ersatz mit dem Programm

PHASER. Als Suchmodell wurden die bereits bekannte Struktur der katalytischen Domäne

[84] sowie ein Modell für die ricinähnlichen Domänen (Abschnitt 3.5.3) verwendet. Dabei

wurde zunächst nach der katalytischen Domäne gesucht. Hierbei wurden zwei Moleküle mit

hohen Z-Scores (Tabelle 4.3.3) gefunden, für ein drittes Monomer ergab sich keine Lösung.

Daher wurde weiterhin nach acht ricinähnlichen Domänen gesucht, die ebenfalls mit guten

Z-Scores (Tabelle 4.3.3) platziert werden konnten.

Tabelle 4.3.3

Ergebnisse des molekularen Ersatzes mittels PHASER

Suchmodell Z-Score Rotation Z-Score Translation

katalytische Domäne 1 8.9 10.8

katalytische Domäne 1 6.8 17.4

ricinähnliche Domäne 1 3.2 15.1

ricinähnliche Domäne 2 2.9 21.6

ricinähnliche Domäne 3 2.9 18.1

ricinähnliche Domäne 4 3.2 16.7

ricinähnliche Domäne 5 3.4 15.6

ricinähnliche Domäne 6 3.6 16.2

ricinähnliche Domäne 7 3.1 22.7

ricinähnliche Domäne 8 3.2 9.3

Eine Analyse der initialen Dichte zeigte, dass keine weitere unerklärte Elektronendichte

vorhanden war und sich somit nur zwei MTX 30-870 -Moleküle in der asymmetrischen Einheit

befanden. Die Dichte konnte durch Anwendung des PHENIX AutoBuild wizards verbessert

werden, allerdings nicht ausreichend für einen automatischen Modellbau. Daher wurde mittels

COOT zunächst das C α -Rückgrat des Proteins gebaut. Dabei ergab sich die Schwierigkeit,

dass die Identität der ricinähnlichen Domänen auf Grund ihrer hohen Homologie und der

fehlenden Elektronendichte für die Verbindungen zwischen katalytischer Domäne und

ricinähnlichen Domänen nicht eindeutig geklärt werden konnte, und daher die Richtung der

Aminosäurekette unklar war. Da die ricinähnlichen Domänen außerdem wenig α-helikale

Segmente enthalten, konnten auch hier N- und C-Terminus nicht ausgemacht werden. Daher

wurde die Annahme getroffen, dass diejenige ricinähnliche Domäne, welche dem C-Terminus

155


4 Ergebnisse und Diskussion

der katalytischen Domäne am nächsten liegt, auch direkt auf diese folgt. Mit dieser Annahme

ließ sich ein fast durchgehendes C α -Rückgrat bauen und die Aminosäuresequenz in der

katalytischen sowie der C-terminalen ricinähnlichen Domäne zuordnen. Durch viele Runden

abwechselndes manuelles Bauen in COOT und der Verfeinerung der Struktur durch REFMAC

wurde die Dichte schließlich so verbessert (Abbildung 4.3.5), dass sich die gesamte

Aminosäuresequenz zuordnen ließ und auch Elektronendichte für die Übergänge zwischen

der katalytischer Domäne und der ersten Ricindomäne sowie zwischen den Ricindomänen

untereinander auftrat. Nach vollständigem Bau des Holotoxinmodells wurde ein simulated

annealing zur Beseitigung des model bias mittels phenix.refine durchgeführt. Die endgültige

Verfeinerung des Modells erfolgte wiederum mittels REFMAC sowie durch manuellen Bau in

COOT, wobei NCS-restraints für die beiden Moleküle in der asymmetrischen Einheit

verwendet wurden. Wassermoleküle wurden mittels COOT eingefügt. Zusätzlich wurde mit

REFMAC eine TLS-Verfeinerung mit der katalytischen Domäne (AS 31-295) und sämtlichen

ricinähnlichen Domänen (AS 296-441, AS 442-581, AS 582-724 und AS 725-867) als

individuelle TLS-Gruppen durchgeführt. Das fertige Modell (Abbildung 4.3.9) enthält zwei

Monomere mit den Aminosäureresten 31-866 des Holotoxins mit Ausnahme des flexiblen

Aktivierungsloops (AS 262-270) und eines Teils des ARTT-Loops (189-192).

A B C

Abbildung 4.3.5 Darstellung der Elektronendichte mit einem Ausschnitt des verfeinerten

Strukturmodells von MTX im Bereich der Aminosäurereste 261-265

A. nach molekularem Ersatz durch PHASER

B. nach Verfeinerung mittels phenix.refine

C. nach TLS-Verfeinerung mittel REFMAC

Die Elektronendichte ist jeweils bis zu einer maximalen Auflösung von 2.5 Å bei einem

Konturniveau von 1.5 σ dargestellt.

156


4.3 Das Moskitozide Toxin (MTX)

Analyse des P3-Datensatzes

Die initiale Phasierung des P3-Datensatzes fand durch D. Reinert statt. Dabei wurde zunächst

ein molekularer Ersatz mit dem Modell aus Kristallform I durchgeführt und das erhaltene

Modell anschließend durch D. Reinert verfeinert.

Eine Analyse des Datensatzes durch phenix.xtriage und DETWIN deutete auf eine

Verzwilligung mit dem Zwillingsoperator –h, -k, l und einem Verzwilligungsgrad von 0.22-

0.24 hin (H-Test, Abschnitt 3.5.2). Daraufhin wurden die Daten mit DETWIN entzwillingt,

was die R-Faktoren etwa um ein Prozent verbesserte. Abschließend wurde eine TLS-

Verfeinerung mittels REFMAC und denselben TLS-Gruppen wie für den H3-Datensatz

durchgeführt und Wassermoleküle mittels COOT eingebaut. Da die Struktur mit einem rmsd

von 0.42 Å und 0.41 Å zu den beiden Ketten A und B praktisch identisch mit der bei 2.5 Å

gelösten Struktur ist, wird sie für die weitere Diskussion nicht einbezogen. Die

Qualitätskriterien der Struktur sind in Tabelle 4.3.4 gegeben.

Tabelle 4.3.4 Verfeinerungsstatistik von MTX 30-870

Kristallform I

Auflösungsbereich [Å] 74.5 - 2.5 50 - 2.9

Anzahl unabhängiger Reflexe 87’586 29’077

Zahl der Reflexe im test set 4379 1454

R cryst (%) 19.2 18.7

R free (%) 23.4 23.9

strukturierte Bereiche

Kette A

Kristallform II

31-188, 193-261 und 271-866 32-188, 193-261

Kette B

31-188, 193-260 und 271-866

und 271-866

-

Anzahl von Nichtproteinmolekülen

Wasser

Glycerin

MPD

676

3

1

110

-

-

rms-Abweichung

Bindungslänge [Å]

Bindungswinkel [°]

0.011

1.20

0.012

1.39

Mittlere B-Faktoren [Å 2 ] (Kette A/B)

Hauptkettenatome

Seitenkettenatome

Wassermoleküle

49.0/ 49.0

49.2/ 49.2

50.5

59.0

59.1

53.9

Ramachandran-Torsionswinkel

energetisch günstiger Bereich [%]

erlaubter Bereich [%]

verbotener Bereich [%]

96.1

3.9

0.0

91.4

8.6

0.0

TLS-Gruppen (alle Ketten) 31-295, 296-441, 442-581, 582-724 und 725-866

157


4 Ergebnisse und Diskussion

Qualität des Modells

Die Qualität der Strukturmodelle für MTX 30-870 wurde während der Verfeinerung anhand der

R-Faktoren sowie der Abweichung von geometrischen Daten validiert (Abschnitt 3.5.6). Die

Qualitätskriterien und ihre Werte für MTX 30-870 sind in Tabelle 4.3.4 gegeben. Die Struktur

wies gute R-Faktoren auf und zeigte auch nur geringe Abweichungen von

Standardbindungslängen und -winkeln. Die Werte aller dihedraler Hauptkettentorsionswinkel

φ und ψ befinden sich im erlaubten Bereichen des Ramachandran-Diagramms und sogar über

96% im energetisch günstigen Bereich (Abbildung 4.3.6). Weiterhin befanden sich alle

Ergebnisse der mit dem BIOTECH-Server durchgeführten Analysen innerhalb gängiger

Toleranzgrenzen.

Abbildung 4.3.6 Ramachandran-Diagramme für das Modell des MTX-Holotoxins (Kristallform I)

Glycinreste sind durch Kreuze, Proline durch Dreiecke und alle anderen Aminosäurereste

durch Quadrate eingezeichnet. Reste, die im energetisch günstigen Bereich liegen, sind

schwarz und Reste, die im erlaubten Bereich liegen, sind orange gekennzeichnet. Die

Farbgebung des Hintergrundes ist so gestaltet, dass der dunkelste Farbton den energetisch

günstigen Bereich markiert.

A. Ramachandran-Diagramm aller Aminosäurereste

B. Ramachandran-Diagramm der Glycine

C. Ramachandran-Diagramm für Aminosäurereste, die direkt vor Prolin liegen

D. Ramachandran-Diagramm für Proline

158


4.3 Das Moskitozide Toxin (MTX)

Analyse der Temperaturfaktoren

Abbildung 4.3.7 zeigt den Verlauf der B- Faktoren sowie die Dichtekorrelation des fertigen

Modells entlang der Hauptkette für die beiden Monomere der asymmetrischen Einheit.

60

200 400 600 800

1,0

0,9

B-Faktor [Å 2 ]

55

50

45β

α

30 200 400 600 800

Sequenzposition

0,8

0,7

0,6

0,5

0,4

0,3

0,2

0,1

0,0

Dichtekorrelation

Abbildung 4.3.7 Darstellung der B-Faktoren und der Dichtekorrelation für MTX 30-870

Die B-Faktoren (unten) der Monomere A (schwarz) und B (grau) sowie die

Dichtekorrelation (oben, Farben entsprechend) wurden gegen die Sequenzposition

aufgetragen. Zusätzlich sind unten die zugehörigen Sekundärstrukturelemente des Modells

wie in Abbildung 4.3.8 gezeigt, auf eine Nummerierung wurde der Übersichtlichkeit

wegen verzichtet. Die Aminosäurereste, die an Kristallkontakten beteiligt sind, sind oben

in der Farbe des jeweiligen Monomers als Balken gezeigt.

Das Diagramm zeigt, daß die B-Faktoren beider Ketten sehr hoch sind und im Mittel gut mit

dem Wilson B-Faktor von 48 Å 2 übereinstimmen. Insgesamt schwanken die B-Faktoren

relativ wenig und es sind keine ausgeprägten Minima und Maxima zu erkennen. Dagegen

zeigt die Dichtekorrelation stärkere Schwankungen und auch Abweichungen zwischen den

beiden Monomeren. Diese Abweichungen können teilweise durch die leicht unterschiedliche

Umgebung im Kristall erklärt werden (Tabelle 4.3.8). Die mittlere Dichtekorrelation liegt in

Kette A bei 90% und in Kette B bei 89%.

159


4 Ergebnisse und Diskussion

4.3.5 Strukturbeschreibung

Sekundärstruktur

Die Analyse der Sekundärstruktur des MTX-Holotoxins wurde mit Hilfe der Programme

DSSP und STRIDE vorgenommen und manuell überprüft. Die endgültige Zuordnung ist in

Abbildung 4.3.8 zu sehen. Das Modell enthält 4 α-Helices, die sich sämtlich in der

katalytischen Domäne befinden, und 63 β-Stränge. Die Zuweisung der

Sekundärstrukturelemente für MTX 30-308 stimmt mit dem Modell der katalytischen Domäne

[155] überein.

Die vier C-terminalen Domänen, die im Folgenden auf Grund ihrer Homologie zu den

Domänen der Ricin B-Kette als RBL- (ricin B like-) Domänen oder Lektindomänen

bezeichnet werden, bestehen aus drei repeats zu je vier β-Strängen, wobei die β-Stränge durch

3 10 -Helices oder turns verbunden sind.

. . 30 . . . . 80

ASS

aSPNSPKDNTWIQAASLTWLMDMSSLLYQLISTRIPSFASPNGLHMREQTI

DSSP A TT 3333TT 33333 HHHHHHHHHHT 333 TT EE

DSSP B 333TT 33333 HHHHHHHHHHT 333 TT EE

STRIDE A TTTT 333TTTTT333TTHHHHHHHHHHHH 333TTTT EETTTT

STRIDE B TTTT 333TTTTT333TTHHHHHHHHHHH 333TTTT EETTTT


α1

β1

. . . . . . . 160

ASS DSNTGQIQIDNEHRLLRWDRRPPNDIFLNGFIPRVTNQNLSPVEDTHLLNYLRTNSPSIFVSTTRARYNNLGLEITPWTP

DSSP A 333 EEEEE HHHHHHH TTTTT HHHHHHH EEEEEE EE TT EE EE

DSSP B 333 EEEEE HHHHHHH TTTTT HHHHHHH EEEEEE EE TT EE EE

STRIDE A TTTTT 333 EEEEE HHHHHHH TTTTTTTTTTTTTTTHHHHHHH EEEEEE EEETTTEEE EE

STRIDE B TTTTT 333 EEEEE HHHHHHH TTTTTTTTTTTTTTTHHHHHHH EEEEEE EETTTT EE EE


β2 β3 β4 α2 α3 β5 β6 β7 β8

. . . . . . . 240

ASS HSANNNIIYRYEIFAPGGIDINASFSRNhnpfPNEDEITFPGGIRPEFIRSTYEYHNGEIVRIWINPNFINPSTLNDVSG

DSSP A TTTT EEEEEEE EEHHHH TTEEEEET 333EEEEEEEETTEEEEEEE TT TT 333

DSSP B TTTT EEEEEEE EEHHHH TTEEEEET 333EEEEEEEETTEEEEEEE TT TT 333

STRIDE A TTTTT EEEEEEE EETTTTT TTTEEEEETT 333EEEEEEEETTEEEEEEETTTTTTTTTTTTT

STRIDE B TTTTT EEEEEEE EETTTTT TTTEEEEETT 333EEEEEEEETTEEEEEEETTTTTTTTTTTTT


β9 β10 α4 β11 β12 β13

. . . . . . . 320

ASS PSNISKVFWHENHSEGNNMDSkgfildldyNQDFDMFAPNGEIPNNNLLNNNSLNVIQNSEYQIKNKKDRNIVVTLDSDY

DSSP A TT EEE TT TT TT333 333EE EEEEEEE TTEEEEE

DSSP B TT EEE TT TT TT333 333EE EEEEEEE TTEEEEE

STRIDE A TTTT EEE TTTTTTTTT TTTTTTT333EE TTTT EEEEEEETTTTTEEEEE T

STRIDE B TTTT EEE TTTTTTTTT TTTTTTT333EE TTTT EEEEEEETTTTTEEEEE T


β15 β13 β16 β17

160


4.3 Das Moskitozide Toxin (MTX)

. . . . . . . 400

ASS GGSPVESYKNFGFENQKWNIKYDSKKNAYKIYNRETPTLLLSWNSNSSNGEQVIRGYTESGSNNQYWTIEKNVNGFYKFR

DSSP A TTEEEEEEE 333 EEEEEETTTTEEEEEE TT EEE TT 3TT EEE 333 EEEEE TT EEEE

DSSP B TTEEEEEEE 333 EEEEEETTTTEEEEEE TT EEE TT 333 EEE 333 EEEEE TT EEEE

STRIDE A TTEEEEEEE 333 EEEEEETTTTEEEEEETTTTTEEEE TTTTTTT EEE 333 EEEEETTTT EEEE

STRIDE B TTEEEEEEE 333 EEEEEETTTTEEEEEETTTTTEEEEETTTTTTT EEEEE 333 EEEEETTTT EEEE


β18 β19 β20 β21 β22 β23 β24

. . . . . . . 480

ASS NLSDPSKILDLKDGNTLNKTPLVVSSENSSSSQEWLIEKTNYQTVKDGTYQVSSKLNENKVIEQISTNKVHIFSNSDKEN

DSSP A E TT EEEE333 TT EEEE 333 EEEEE EEEEEEETTEEEEEEEEETTTEEEEEE GG

DSSP B E TT EEEE333 TT EEEE 333 EEEEE EEEEEEETTEEEEEEEEETTTEEEEEE GG

STRIDE A ETTTTTTEEEE333 TTTEEEEEE TTTTEEEEEE TTTT EEEEEEETTEEEEEEEEETTTEEEEEE 33

STRIDE B ETTTTTTEEEE333 TTTEEEEEE TTTTEEEEEE TTTT EEEEEEETTTTTEEEEEETTTEEEEEE 33


β25 β26 β27 β28 β29 β30

. . . . . . . 560

ASS QVWNLIYNPILKAYKIKSLKYPNYSLAWDSNNTRTIVAATGDYNDQYWLIERNEDNTYIIRNYENRKIVLDLSNGSTTDG

DSSP A G EEEEEETTTTEEEEEE TT EEEE TTTT EEEE 333EEEEEE TT EEEEE TTEEEEE333 TT

DSSP B G EEEEEETTTTEEEEEE TT EEEE TTTT EEEE 333EEEEEE TT EEEEE TTEEEEE333 TT

STRIDE A 3 EEEEEETTTTEEEEEETTTTTTEEEEETTTTTEEEEE 333EEEEEETTTT EEEEETTTTTEEEEE333 TTT

STRIDE B 3 EEEEEETTTTEEEEEETTTTTTEEEEETTTTTEEEEE 333EEEEEETTTT EEEEETTTTTEEEEE333 TTT


β31 β32 β33 β34 β35 β36 β37

. . . . . . . 640

ASS NGLLGFEFHGGINQRWIIKPFSFNSIQDGIYQFMTVINQDLIADLTTNNYTIATKTNNYSSNQKWTVTYNDKKRAYKIRN

DSSP A EEEEE 333 EEEEE EEEEEEE TTEEEEE TT EEEEE 333 EEEEEETTTTEEEEEE

DSSP B EEEEE 333 EEEEE EEEEEEE TTEEEEE TT EEEEE 333 EEEEEETTTTEEEEEE

STRIDE A EEEEEEE 333EEEEEE TTTT EEEEEEETTTTTEEEEE TTTT EEEEE 333 EEEEEETTTTEEEEEE

STRIDE B EEEEEEE 333EEEEEE TTTT EEEEEEETTTTTEEEEE TTTT EEEEE 333 EEEEEETTTTEEEEEE


β38 β39 β40 β41 β42 β43 β44

. . . . . . . 720

ASS LQHAHLSLAWDSNHSDKIFGATGDYDDQYWIPILQTDGSFIFRNYKNPNKIFGTNGQPINDIPLKAQDVTGQNNQKWYLR

DSSP A TT EEEE TTT EEEE 333EEEEEE TT EEEEE TTEEEE TTEE EEEE 333 EEEE

DSSP B TT EEEE TTT EEEE 333EEEEEE TT EEEEE TTEEEE TTEE EEEE 333 EEEE

STRIDE A TTTTTEEEEETTTTT EEEEE 333EEEEEETTTT EEEEETTTTTEEEEETTT TTTEEEEEEE 333 EEEE

STRIDE B TTTTTTEEEETTTTT EEEE 333EEEEEETTTT EEEEETTTTTEEEEETTT TTTEEEEEEE 333 EEEE


β45 β46 β47 β48 β49 β50 β51

. . . . . . . 800

ASS HLNSSNNFTGYFNISSKKNFNKIITMNSNKTQAVIFDNIGINNQSWKLKYNDNKNAYQIHILDNFLYFQGGHNIVATMRN

DSSP A ETT EEEEEEETTEEEEEEEE TT EEEEE 333 EEEEEETTTTEEEEEETTEEEE TT EEE

DSSP B ETT EEEEEEETTEEEEEEEE TT EEEEE 333 EEEEEETTTTEEEEEETTEEEE TT EEE

STRIDE A ETTT EEEEEEETTEEEEEEEETTTT EEEEE 333 EEEEEETTTTEEEEEETTEEEE TTTEE EEEET

STRIDE B ETTT EEEEEEETTTTTEEEEETTTT EEEEE 333 EEEEEETTTTEEEEEETTEEEE TTTEE EEEET


β52 β53 β54 β55 β56 β57 β58

. . . . . . 870

ASS VTNDDLRSYWYVEYNFNKDGFIIRNAFDTSYVLDVFQGNFANNTPIITYQNYLNDNQLWNFIPSLGvepr

DSSP A TT 333EEEEEEETTTTEEEEEE TTEEEEE333 TT EEEEE 333 EEEEE

DSSP B TT 333EEEEEEETTTTEEEEEE TTEEEEE333 TT EEEEE 333 EEEEE

STRIDE A TTTTT333EEEEEEETTTTEEEEEETTTTTTEEEE333 TTTEEEEEE 333 EEEEE

STRIDE B TTTTT333EEEEEEETTTTEEEEEETTTTTEEEEE333 TTTEEEEEEE 333EEEEEE


β59 β60 β61 β62 β63

Abbildung 4.3.8

Zuordnung der Sekundärstrukturelemente des MTX-Holotoxins

ASS gibt die Aminosäuresequenz an, die darauffolgenden Zeilen die Ergebnisse der

Programme DSSP und STRIDE jeweils für die A- und die B-Kette (H = α-Helix, E =

β-Strang, T = turn, 3 = 3 10 -Helix). Die letzten beiden Zeilen enthalten die Zuordnung zu

den Sekundärstrukturelementen und ihre Nummerierung. Aminosäurereste, die in der

Struktur (Kette A) fehlen, sind als Kleinbuchstaben angegeben. Die einzelnen repeats der

RBL-Domänen (blau, grün, gelb und rot) sind in der Zeile der Sekundärstrukturelemente

farblich voneinander abgesetzt, wobei auf eine Abgrenzung des jeweiligen Linkers

verzichtet wurde.

161


4 Ergebnisse und Diskussion

Tertiärstruktur

Das MTX-Holotoxin weist fünf Domänen auf, wobei sich die katalytische Domäne A in der

Mitte befindet und die vier RBL-Domänen um sie herum liegen (Abbildung 4.3.9). Die

beiden Monomere zeigen wenig Unterschiede in ihrer Faltung (rmsd 0.1 Å). Die kompakte

Struktur des Holotoxins wird durch große Kontaktflächen zwischen den RBL-Domänen und

der katalytischen Domäne erzielt (Tabelle 4.3.5), die insgesamt 1950 Å 2 betragen.

Abbildung 4.3.9

Stereodarstellung des Bändermodells von MTX-Holotoxin

Die katalytische Domäne ist blau, die RBL-Domänen sind türkis (RBL-1), grün (RBL-2),

gelb (RBL-3) und orange (RBL-4) dargestellt. Die Aminosäurereste 31-70, die der

allgemeinen Faltung der ARTs vorangehen, sind lila, der Linker (AS 270-295) ist rot

eingezeichnet. Das Modell für NAD + wurde von der katalytischen Domäne [84]

übernommen. Die fehlenden Aminosäurereste des ARTT-Loops (AS 189-192) und des

Aktivierungsloops (AS 261-270) sind durch Punkte markiert.

Der ARTT-Loop (AS 190-197), der Aktivierungsloop (AS 260-270) und der Loop um

Position 150 sind dem Solvens zugewandt. Die katalytische Domäne besitzt die gleiche

Faltung wie bereits von Reinert et al. [84] beschrieben (rmsd 0.7). Es handelt sich um die

typische Faltung der ADP-Ribosyltransferasen mit zwei zueinander annähernd senkrecht

stehenden β-Faltblättern aus den β-Strängen β1, β5, β10 und β11 sowie β4, β9, β12, β13 und

β14 und dem dazwischen liegenden aktiven Zentrum. Ein Teil der Linker-Region (270-285)

162


4.3 Das Moskitozide Toxin (MTX)

Tabelle 4.3.5 Kontaktflächen zwischen katalytischer und ricinähnlichen Domänen

Kontakt Größe [Å 2 ] ∆G b)

i beteiligte Aminosäurereste

MTX 30-294 H/S-Brücken a) [kcal/mol] MTX 30-294 c) RBL- Domäne

RBL-1

(296-441)

RBL-2

(442-581)

RBL-3

(582-724)

RBL-4

(725-866)

530 - 4.0 225, 227-229, 232-233, 235-

6/2 d) 237, 246, 248, 294

418

6/0

384

2/0

613

8/0

+ 3.1 47, 51, 84, 86, 108-109, 112,

205-208, 227-230, 232, 249-251

296-300, 302, 342, 391, 397,

436-441

442-444, 446-447, 487, 489,

492, 532-534, 536, 579-580

- 2.7 48, 51-52, 55, 117-120 582, 585-587, 591, 674-678,

680, 718-719, 721

-6.9 55, 58-59, 61-63, 65-67, 117,

120-125, 127, 129-130, 133

725-728, 732, 740, 814, 816-

817, 819-821, 860-863

a) Anzahl der Wasserstoff- sowie Salzbrücken

b) berechneter Energiegewinn bei der Komplexierung (PISA)

c) ohne Aminosäurerest 295, da der kovalente Kontakt bei der Berechnung nicht berücksichtigt werden soll

d) eine der beiden Salzbrücken entsteht durch die Termini von MTX 30-294 und MTX 296-441

liegt im aktiven Zentrum, das durch die senkrecht zueinander stehenden β-Stränge β2 und β3

sowie die α-Helices α5, α6, den ARTT-Loop und den kurzen β-Strang β8 begrenzt ist.

Die vier RBL-Domänen weisen eine interne dreifache Symmetrie auf und bestehen aus

jeweils 12 β-Strängen. Von diesen bilden jeweils 2 aufeinander folgende ein β-Faltblatt, das

von dem nächsten Faltblatt durch eine 3 10 -Helix und/oder einen turn getrennt ist. Der jeweils

letzte β-Strang eines repeats bildet mit dem jeweils ersten des nächsten repeats ebenfalls ein

β-Faltblatt. Das Modell einer ricinähnlichen Domäne ist in Abbildung 4.3.10 anhand der

ersten RBL-Domäne gezeigt. Die β-Stränge 17 und 18, 19 und 20, 21 und 22, 23 und 24, 25

und 26 sowie 27 und 16 bilden jeweils ein β-Faltblatt aus. Drei der Faltblätter bilden ein

sechssträngiges β-Barrel aus, während die anderen drei (17/18, 21/22 sowie 25/26) eine Art

Deckel darauf bilden. Die β-trefoil-Struktur kommt durch die Loops zwischen diesen

Faltblättern zustande.

Die Einteilung in die drei repeats α, β und γ erfolgt leicht abweichend von der Literatur [79,

86, 89]. Bei der Einteilung wurde darauf geachtet, die Grenzen nicht innerhalb von

β-Strängen zu setzen und den Linker λ, der keinen β-Strang enthält, als Verbindung zwischen

den Domänen zu definieren. Daraus ergeben sich drei repeats zu je ca. 40 Aminosäureresten,

die jeweils vier β-Stränge und ein QxW-Motiv beinhalten sowie zwei weitere unpolare

163


4 Ergebnisse und Diskussion

Aminosäurereste zum hydrophoben Kern beitragen (Tabelle 4.3.6). Die Einteilung ohne den

Linker ist in Abbildung 4.3.8 ersichtlich.

Abbildung 4.3.10 Stereoansicht eines Bändermodells der RBL-1-Domäne

Die drei repeats sind orange, grün und blau, der Linker ist rosa. Die β-Stränge sind gemäß

Abbildung 4.3.8 bezeichnet. Die pseudo-dreifache Symmetrieachse ist eingezeichnet.

Ein Vergleich der katalytischen Domäne allein (pdb-codes 2cb6 und 2cb4) und im Modell für

das Holotoxin zeigt, dass sie mit einem rmsd von 0.7 Å nahezu identisch sind. Abweichungen

zeigen sich lediglich im ARTT-Loop, der im Gegensatz zu MTX 30-308 im Holotoxin

ungeordnet ist, sowie im Loop 117-124, der an der Kontaktfläche zur RBL-Domäne 4

beteiligt ist (Abbildung 4.3.11). Dieser Loop zeigt auch eine Abweichung zwischen den

beiden Kristallformen der katalytischen Domäne, was darauf hinweist, dass er insgesamt

relativ flexibel ist. Der Aktivierungsloop (262-270) ist in allen Strukturen ungeordnet.

Der C-Terminus des inhibitorischen Linkers (289-298) faltet sich in MTX 30-308 zurück zur

Proteinoberfläche und ist Teil der Kontaktfläche des dort vorliegenden Heptamers. Es war

spekuliert worden, dass die Ausbildung des Heptamers den Linker fixiert [155]. In der

Holotoxinstruktur streckt sich der C-Terminus des Linkers jedoch weiter zur ersten

ricinähnlichen Domäne. Die in MTX 30-308 vorliegende Faltung ist daher vermutlich entweder

ein Kristallartefakt, oder aber, da das Heptamer auch in Lösung vorliegt [84], ein Effekt, der

durch die in der Natur nicht vorkommende Länge des Konstruktes erzeugt wird. Die

Kontaktflächen zwischen zwei Monomeren des Heptamers sind mit 670 Å 2 nur

unterdurchschnittlich groß, und fast ein Drittel der Kontaktfläche kommt durch den

164


4.3 Das Moskitozide Toxin (MTX)

inhibitorischen Linker zustande. Daher ist es fraglich, ob die katalytische Domäne allein

(MTX 30-264 ) ebenfalls ein Heptamer bildet

Durch Überlagerung des Modells für MTX 30-308 und der katalytischen Domäne des

Holotoxins (Abbildung 4.3.11) wurde die modellierte Position des NAD + aus MTX 30-308 in

das Holotoxin übernommen. Der inhibitorische Linker (AS 265-285) besetzt in beiden

Strukturen die Bindestelle, was seine Wirkungsweise erklärt [84]. Der Linker und die

katalytische Domäne binden mit einer Kontaktfläche von 905 Å 2 stark aneinander. Die beiden

laut Inhibitionsstudien [90] wichtigsten Aminosäurereste Asp273 und Asp275 steuern 20%

der Kontaktfläche und beide Salzbrücken bei.

Abbildung 4.3.11 Stereoansicht der überlagerten Bändermodelle von MTX 30-308 mit der katalytischen

Domäne des Holotoxins

Das Modell der katalytischen Domäne des Holotoxins ist blau, das von MTX 30-308 orange

(pdb-code 2cb4) dargestellt. Der Linker ist pink bzw. grün markiert. Das NAD + ist aus dem

Modell für die katalytische Domäne [84] übernommen. Loop 117-124, der ARTT-Loop und

der Loop an Position 150 sind beschriftet. Die fehlenden Aminosäurereste des

Aktivierungsloops und des ARTT-Loops sind durch schwarze bzw. blaue Punkte markiert.

Auch wenn der inhibitorische Linker aus dem aktiven Zentrum entfernt wird, kommt es beim

Modellieren des NAD + in beiden Strukturen zu sterischen Konflikten [84]. Zur Bindung des

NAD + ist folglich eine Neuordnung der Bindestelle notwendig, die Teil einer umfassenderen

Strukturänderung sein könnte.

165


4 Ergebnisse und Diskussion

Durch Sequenzanalyse war bereits bekannt, dass der C-Terminus des MTX-Holotoxins vier

ricinähnliche Domänen besitzt. Diese haben untereinander eine sehr ähnliche Faltung

(Abbildung 4.3.12), und zeigen auch eine gute Übereinstimmung mit der Struktur der beiden

Domänen der Ricin B-Kette (Tabelle 4.3.7). Lediglich in den Loop-Regionen sind größere

Abweichungen der Hauptkette vorhanden. Die Aminosäurereste, die den hydrophoben Kern

bilden (in Abbildung 4.3.12 gelb markiert), sind alle konserviert und für MTX in Tabelle

4.3.6 zusammengestellt. Im Gegensatz zu den Lektinen von Ricin B besitzt MTX aber keine

Disulfidbrücken.

Abbildung 4.3.12 Überlagerung der C α -Hauptketten der RBL-Domänen von MTX

Die Stereoansicht entlang der pseudo-dreizähligen Achse zeigt die vier RBL-Domänen in

orange (RBL-1), grün (RBL-2), blau (RBL-3) und lila (RBL-4). Die Aminosäurereste des

QxW-Motivs und des hydrophoben Kerns sind gelb eingezeichnet. Die typischen

Zuckerbindungsstellen sind durch rote Kugeln markiert, die die mittlere Position der 16

Zuckerbindungsstellen aus Abbildung 4.3.14 wiedergeben.

Tabelle 4.3.6 Aminosäurereste des hydrophoben Kerns der RBL-Domänen

α β γ

MTX RBL-1 I304, V314,W338 I351, L361, W387 F399, L409, W435

MTX RBL-2 V452, I462, W483 I496, L506, W528 I540, F550, W576

MTX RBL-3 F393, A603, W625 I638, L648, W670 F682, F692, W717

MTX RBL-4 I734, I744, W766 I779, L786, W810 I823, L833, W859

166


4.3 Das Moskitozide Toxin (MTX)

Die Sequenzhomologie zwischen den RBL-Domänen von MTX liegt im Mittel bei 29% von

131 überlagerten Aminosäureresten und ist damit ähnlich hoch wie die Sequenzhomologie

zwischen den beiden Lektindomänen der Ricin B-Kette (31% von 111 überlagerten

Aminosäureresten). Die Sequenzhomologie zwischen den RBL-Domänen beider Proteine ist

dagegen um 10% geringer bei 110 überlagerten Aminosäureresten (Tabelle 4.3.7). Die

Tatsache, dass die RBL-Domänen eines Proteins untereinander eine viel höhere Ähnlichkeit

aufweisen als zu den Lektindomänen eines anderen Proteins, weist darauf hin, dass die

mehrfachen RBL-Domänen eher auf eine lokale Genduplikation zurückzuführen sind als auf

die sequentielle Aufnahme der RBL-Domänen anderer Proteine.

Tabelle 4.3.7 Vergleich der RBL-Domänen von MTX und Ricin B

2

1

RBL-1 RBL-2 RBL-3 RBL-4 Ricin B1 * Ricin B2 **

RBL-1 146 1.06 1.17 0.83 1.23 1.45

RBL-2 136/32 140 1.03 0.95 1.34 1.42

RBL-3 136/30 138/33 143 1.15 1.15 1.38

RBL-4 125/29 126/26 127/20 142 1.18 1.43

Ricin B1 * 113/21 108/18 104/17 108/19 134 1.35

Ricin B2 ** 112/18 113/21 108/15 111/23 109/31 128

1) Anzahl der mittels LSQMAN überlagerten Aminosäurereste/ [%] der dabei identischen

Aminosäurereste: die Abweichungen der RBL-Domänen untereinander sind grau, die der beiden

Ricin B-Kette gelb unterlegt. Die Abweichungen zwischen den RBL-Domänen von MTX und Ricin

B sind blau markiert.

2) rmsd [Å] bei Überlagerung mit LSQMAN

* AS 1-134 ** AS 135-262

Neben der kompetitiven Inhibition durch den inhibitorischen Linker besitzt der äußerste

C-Terminus eine zusätzliche, vermutlich allosterisch hemmende Wirkung [90]. Da der

ARTT-Loop und der Loop 149-153 für die Substratspezifität verantwortlich gemacht werden

[84], war ein Modell für MTX entworfen worden, bei dem die letzte ricinähnliche Domäne

mit diesen Loops in Kontakt tritt und darüber das Toxin allosterisch inhibiert. In diesem

Modell legen sich die Ricin-Domänen in einen Ring seitlich der katalytischen Domäne, so

dass der C-Terminus in der Nähe des N-Terminus zu liegen kommt [156]. Dieses Modell wird

durch die MTX-Holotoxin-Struktur nicht bestätigt.

167


4 Ergebnisse und Diskussion

Quartärstruktur und Kristallpackung

Die Kristallstruktur des Holotoxins zeigt zwei Monomere in der asymmetrischen Einheit, die

nur über Kristallkontakte miteinander verbunden sind. Der monomere Status von MTX 30-870

war auf Grund der GPC (Abschnitt 4.3.1) bereits vermutet worden, allerdings konnte auf

Grund der unspezifischen Wechselwirkungen zwischen den Lektindomänen und dem

Säulenmaterial keine gesicherte Aussage getroffen werden.

Eine Analyse der Kristallkontakte mittels PISA ergibt die in Tabelle 4.3.8 gelisteten

Kristallkontakte. An der Ausbildung der Kristallpackung sind nur 6.8% der Proteinoberfläche

beteiligt. Dies erklärt die insgesamt hohen B-Faktoren, den hohen Lösungsmittelgehalt und

die damit verbundene schlechte Auflösung. Die katalytische Domäne ist überhaupt nicht an

der Ausbildung des Kristallgitters beteiligt, dies geschieht ausschließlich über die

ricinähnlichen Domänen. Besonders die letzte Lektindomäne trägt mit etwa 50% zur

Ausbildung von Kristallkontakten bei.

Tabelle 4.3.8 Kristallkontakte des MTX-Holotoxins

Kontakt Symmetrieoperation

Größe

beteiligte Aminosäurereste

[Å 2 ] Kette 1 Kette 2

I B-A -y+1, x-y, z 533 466-469, 504, 520, 630, 632-

633, 653, 661-669

317-320, 324, 419, 509-512,

514, 519-521, 523-525, 544

II B-B -y, x-y, z 439 738, 792, 818, 834, 836-839,

847, 849-850, 852, 854-856

752, 788-794, 807, 827-828,

831, 836-837, 845, 847, 849-850

III A-A -y+1, x-y+1, z 439 752, 788-794, 807, 827, 831,

836-837, 845, 847, 849-850

738, 792, 818, 834, 836-839,

847, 849, 852, 854-856

IV B-B -y+1, x-y, z 317 589-590, 621, 626, 641-642,

723, 725, 772-773

345-346, 366-368, 380-383, 402-

403, 405

V A-A -y+2, x-y+1, z 309 345-346, 366-368, 380-383,

402-403, 405

589-590, 621, 626, 641-642,

723, 725, 772-773

VI B-A x-1/3, y-2/3, z+1/3 165 748, 756-757, 759, 761, 842-

843

748, 756-757, 759, 761-762,

842-843

VII B-A x, y, z 124 318-321 465-466, 468-469

VIII* A-A x, y, z-1 278 148-150, 155, 188, 195, 284-

286, 756, 759, 761

467-468, 501, 510-512, 523,

653-654

* dieser Kontakt tritt nur in Kristallform II (P3) auf

168


4.3 Das Moskitozide Toxin (MTX)

Insgesamt sind die Kristallkontakte so klein, dass durch sie keine Veränderung der nativen

Struktur zu erwarten ist. Die Kristalle der Kristallform II (P3) weisen ebenfalls die Kontakte

III und V auf sowie eine weitere Kontaktfläche von 278 Å 2 (Kristallkontakt VIII in Tabelle

4.3.8). Ein Vergleich der beiden Kristallpackungen ist in Abbildung 4.3.13 zu sehen. Die

Kristallpackung von Kristallform II lässt sich als linearer Stapel von a-b-Schichten mit

gleichförmigen “Kopf-Fuß”-Kontakten (Kristallkontakt VIII) entlang der c-Achse

beschreiben. Dagegen bilden die zu Kristallform II ähnlichen a-b-Stapel in Kristallform I

abwechselnd “Kopf-Kopf”- (Kristallkontakt I) und “Fuß-Fuß”-Kontakte (Kristallkontakt VI)

mit seitlichen Verschiebungen aus.

Da alle drei MTX 30-870 -Moleküle trotz unterschiedlicher Kristallumgebung eine identische

Faltung besitzen, ist die beobachtete Struktur vermutlich nicht durch Kristallpackungseffekte

beeinflusst.

A

B

Abbildung 4.3.13 Kristallpackung von MTX in den Raumgruppen H3 und P3

A. Raumgruppe H3 mit zwei Monomeren (orange und hellblau) in der ASU; die

Symmetrieverwandten sind jeweils im Farbton des entsprechenden Monomers gehalten

B. Raumgruppe P3 mit einem Monomer (hellrot) in der ASU

169


4 Ergebnisse und Diskussion

4.3.6 Vergleich mit strukturverwandten Proteinen

Die strukturelle Homologie der katalytischen Domäne mit anderen ARTs ist bereits

beschrieben worden [84]. Bei der Analyse der Primärstruktur der C-terminalen Domänen ist

eine Homologie mit der Ricin B-Kette vorausgesagt worden, die sich in der Struktur des

Holotoxins bestätigt [79].

Eine Homologiesuche mit den RBL-Domänen von MTX mittels DALI erzielt für eine Reihe

von funktionell nicht verwandten Proteinen mit β-trefoil-Faltung Z-Scores zwischen 3 und 23.

Tabelle 4.3.9 listet alle Proteine mit einem Z-Score über 10. Dabei handelt es sich größtenteils

um Multidomänenproteine, bei denen sich eine enzymatische oder anderweitige Funktion auf

einer Domäne befindet, die mit ein oder mehreren RBL-Domänen verknüpft sind. Diese

besitzen in der Regel zuckerbindende Eigenschaften, allerdings ist nicht für alle Proteine die

Zuckerbindung auf atomarer Ebene aufgeklärt worden.

Zu den identifizierten Proteinen gehören mehrere Mitglieder der fibroblast growth factor

(FGF)-Familie von sekretierten Signalmolekülen [157, 158], die durch Bindung an ihre

Rezeptoren (FGFR) deren Dimerisierung und die Weiterleitung eines Signals in das

Cytoplasma bewirken. Dieser Signalmechanismus spielt in einer Vielzahl von Prozessen wie

Zellproliferation, -differenzierung und -migration sowie der Angiogenese eine wichtige Rolle.

Auch die Interleukine, die an der Regulation von Immun- und Entzündungsreaktionen [159]

beteiligt sind, sowie die cysteinreiche Domäne des Mannoserezeptor von Makrophagen und

Epithelien [160], der in die Immunabwehr von Pathogenen involviert ist, besitzen RBL-

Domänen. Sensorische Proteine wie der pH-Sensor Hisactophilin [161] und der IP 3 -Rezeptor

[162, 163] enthalten ebenso RBL-Domänen wie zahlreiche Enzyme, die am Auf- oder Abbau

von Zuckerpolymeren oder zuckerhaltigen Molekülen beteiligt sind [164-168]. Eine ganze

Reihe von Toxinen nutzt RBL-Domänen für zellbindende Aufgaben, während die toxische

Komponente auf einer anderen Domäne oder Untereinheit lokalisiert ist. Abrin-a besitzt

Glykosidaseaktivität, die zur Inaktivierung von Ribosomen führt [169]. CEL-III bindet mit

seinen zwei Lektindomänen zuckerhaltige Proteine an Zelloberflächen, was zur Einlagerung

der dritten Domäne in die Membran und zur anschließenden Porenbildung führt [170, 171].

Das cytolethal distending toxin (Cdt) aus Actinobacillus actinomycetemcomitans ist ein

Heterotrimer aus einer katalytischen Domäne und zwei RBL-Domänen, die Homologie zu

170


4.3 Das Moskitozide Toxin (MTX)

Tabelle 4.3.9 Strukturverwandte Proteine der ricinähnlichen Domänen von MTX 30-870

Protein

Hämagglutinin HA 33A

GlcNAc-α-1-4-Gal releasing

Endo-β-Galaktosidase

Organismus

Clostridium botulinum

type A

Clostridium perfringens

pdbcode

1ybi/

1qxm

1ups

DALI

Z-Score

22.8/

22.3

18.0

Funktion

Internalisierung des Botulinumtoxins

Toxin, Abbau von Glykoproteinen der

Darmmucine

Abrin-a

Abrus precatorius 1abr 17.6 Toxin, inaktiviert Ribosomen, Glykosidase

Xylanase

Streptomyces lividans 1mc9 17.2 spaltet Xylan

CEL-III

bFGF (basic fibroblast growth

factor)

CDT

IP3-Rezeptor

α-L-Arabinofuranosidase

Interleukin -1α/1β

UDP-GalNAc:Polypeptid-N-

Acetylgalactosaminyltransferase

cysteinreiche Domäne des

Mannoserezeptors

Hisactophilin

Tetanustoxin

Botulinus Neurotoxin A

Cucumaria echinata

Homo sapiens

Actinobacillus

actinomycetemcomitans

Mus musculus

Aspergillus kawachii

Homo sapiens

Mus musculus/

Homo sapiens

Mus musculus

Dictyostelium

discoideum

Clostridium tetani

Clostridium botulinum

1vcl

1bfg/

2fdb

1sr4

1n4k/

1xzz

1wd3

2ila/

2i1b

1xhb/

2ffu

1dqg

1hce

1a8d

2nyy

17.1

17.1/

15.5

16.5

15.4/

13.1

15.1

13.5/

14.4

14.5/

14.1

14.0

13.3

10.5

10.2

porenbildendes Toxin, Lektindomänen

binden Kohlenhydrate an Zelloberfläche

Bindung an Rezeptor Dimerisierung

Zellproliferation, -differenzierung u.a.

DNAse I-ähnliche Nuklease, toxisch für

Lymphozyten und Epithelzellen

Ca 2+ -Freisetzung aus ER

Abbau von L-Arabinosehaltiger

Hemicellulose

Cytokine, Signalmoleküle, Regulation von

Immun- und Entzündungsreaktionen

Mucinbiosynthese; Lektindomäne erhöht

Aktivität

Immunantwort, bindet an

sulfatmodifizierte Zucker von Pathogenen

pH-Sensor, aktinbindendes Protein,

reguliert Polymerisation

bindet an Ganglioside von Nervenzellen,

kat. Einheit spaltet Synaptobrevin

bindet an Ganglioside von Nervenzellen,

kat. Einheit spaltet u.a. Synaptobrevin

Zuckerbindung

bindet Glykoproteinen und -lipiden mit

Sialinsäure, ähnlich Ricin B

evtl. ähnlich zu bFGF (basic fibroblast

growth factor), da Substrat heparinähnlich

Laktose; Bindemechanismus nicht bekannt

Laktose-Bindung analog zu Ricin B; Xylan-

Bindung durch mehrere Bindetaschen

Zuckerbindung Ca 2+ -abhängig;

Bindemechanismus nicht bekannt

Heparine der extrazellulären Matrix; flache

Bindetasche, elektrostat. Wechselwirkungen

Saccharose-abhängig; Bindemechanismus

unbekannt

IP3-Bindung in Tasche zwischen

Lektindomäne und C-terminaler Domäne

2 Bindestellen für Arabinose über stacking-

Kräfte und Wasserstoffbrücken

nicht bekannt

glykosylierte Peptide; Bindemechanismus

unbekannt

sulfatmodifizierte Zucker über

Wasserstoffbrücken und stacking-Kräfte

nicht bekannt

untypische Bindung durch mehrere

Untereinheiten

untypische Bindung durch mehrere

Untereinheiten

171


4 Ergebnisse und Diskussion

denen des MTX aufweisen [172, 173]. Während die katalytische Domäne, CdtB, homolog zu

DNase I-ähnlichen Nukleasen ist und die Toxizität des Proteins für Lymphozyten und

Epithelzellen vermittelt, sind die RBL-Domänen (CdtA und CdtC) für die Aufnahme des

Toxins in die Zielzelle notwendig. Interessanterweise weisen die N-terminalen

Aminosäurereste von CdtC aus der β-trefoil-Faltung heraus und verdecken das aktive

Zentrum von CdtB, was an die Inhibition von MTX durch den Linker zwischen der

katalytischen Domäne und der ersten Lektindomäne erinnert. Weitere Toxine mit RBL-

Domänen sind Tetanustoxin [174], Botulinus Neurotoxin B [175] und die

Hämagglutininkomponente HA1 des Botulinustoxins [176].

Die Suche nach weiteren Proteinen mit RBL-Domänen mittels INTERPRO

(www.ebi.ac.uk/interpro) führte zu über tausend Treffern. Eine Analyse der Domänenstruktur

zeigte, dass etwa 90% der gefundenen Sequenzen nur eine (vorausgesagte) RBL-Domäne

enthalten, ca. 10% zwei und nur sieben Proteine mehr als zwei RBL-Domänen besitzen. Zu

diesen gehören drei Proteine mit drei RBL-Domänen, drei Proteine mit vier RBL-Domänen

(nämlich MTX sowie die beiden stark sequenzhomologen Pierisine) und ein hypothetisches

Protein mit sechs RBL-Domänen. Damit sind MTX und die Pierisine die Proteine mit den

meisten gesicherten RBL-Domänen (auf einer Proteinkette). Die große Anzahl von RBL-

Domänen könnte darauf hinweisen, dass MTX auch besonders viele Zuckerbindungsstellen

besitzt (Abbildung 4.3.16). Andererseits könnte ein Teil der RBL-Domänen auch seine

zuckerbindende Funktion verloren haben und nur noch für andere Aufgaben wie die

Autoinhibition von Bedeutung sein.

Angesichts der homologen Strukturen muss betont werden, dass diese Proteine trotz der nahen

Verwandtschaft ihrer Strukturen sehr unterschiedliche Funktionen ausüben und, wenn

überhaupt, auf sehr unterschiedliche Arten an Kohlehydrate binden. Um über die Funktion

und die möglichen Zuckerbindungsstellen von MTX gesicherte Aussagen zu treffen, sind

Bindungsstudien nötig.

172


4.3 Das Moskitozide Toxin (MTX)

4.3.7 Funktionsweise von MTX

Zuckerbindung

Eine RBL-Domäne ist vermutlich durch Gentriplikation aus einem ursprünglichen

zuckerbindenden Motiv hervorgegangen [86]. Sie besitzen einen unpolaren Kern, der aus den

drei Tryptophanen des QxW-Motivs sowie sechs weiteren unpolaren Aminosäureresten

besteht. Die Glutamine des QxW-Motivs weisen zur Proteinoberfläche und interagieren mit

den Loops der Zuckerbindungsstellen. Da sie in der Regel an der Zuckerbindung selbst nicht

beteiligt sind (Abbildung 4.3.14), erfüllen sie anscheinend eher eine strukturelle Aufgabe.

Obwohl theoretisch jede Lektindomäne aus drei ursprünglich zuckerbindenden Elementen

(QxW-Motiv) aufgebaut ist, wurde in der Struktur für die Ricin B-Lektine nur eine gebundene

Laktoseeinheit pro Lektin gefunden (1α und 2γ). MTX besitzt vier RBL-Domänen und damit

zwölf mögliche Zuckerbindungsstellen (Abbildung 4.3.16). Da es über die zuckerbindenden

Eigenschaften von MTX keinerlei biochemische Daten gibt, können Vermutungen dazu nur

indirekt über die starke Retardierung auf der Gelpermeationssäule mit Dextranmaterial sowie

über die Homologie zu anderen RBL-Domänen angestellt werden. Durch einen

Sequenzvergleich war versucht worden, die Zuckerbindungsstellen im MTX-Holotoxin zu

finden [79]. Anhand dieses Vergleichs wurden drei Bindestellen in den QxW-Einheiten 1α, 2γ

und 4γ postuliert. Ein strukturbasiertes Alignment zeigt jedoch, dass im 1α repeat die für

Aspartat 317 vorhergesagte Position in Wirklichkeit von einem Threonin (Thr315) besetzt

wird (Abbildung 4.3.15), so dass diese Zuckerbindungsstelle in Frage gestellt werden muss.

Zur genaueren Analyse der möglichen Zuckerbindungsstellen von MTX wurde zunächst nach

allen RBL-Domänen gesucht, deren Struktur im Komplex mit Zucker in der RCSB-Datenbank

hinterlegt ist. Dazu wurde die RCSB-Datenbank mit den Sequenzen aller strukturhomologen

Proteine (Tabelle 4.3.9) nach Verwandten durchsucht. Von den etwa 50 gefundenen

Strukturen wurden all diejenigen ausgeschlossen, die den Zucker nicht an der typischen

Zuckerbindungsstelle binden oder bei denen Aminosäurereste von mehr als einer Untereinheit

an der Zuckerbindungsstelle beteiligt sind. Ferner wurden RBL-Domänen, die modifizierte

Zucker binden, nicht sowie von stark sequenzhomologen Proteinen mit derselben Funktion

aus unterschiedlichen Organismen nur eines betrachtet. Diese Auswahl führte zu 16

unabhängigen Zuckerbindungsstellen (Tabelle 4.3.10), von denen sich 7 im α –, 3 im β- und 6

im γ–repeat befinden. Die Strukturhomologie zur RBL-1-Domäne von MTX wurde mittels

DALIlite bestimmt.

173


4 Ergebnisse und Diskussion

Tabelle 4.3.10

Auswahl von zuckerbindenden RBL-Domänen

Protein Organismus pdbcode

DALI

Z-Score

repeat

Referenz

Ricin B RBL-1/RBL-2 Ricinus communis 2aai 17.5/17.4 α / γ [87, 88]

Xylanase Streptomyces olivaceoviridis 1isz 19.5 α, γ [177]

hämolytisches Lektin Laetiporus sulphureus 1w3g 16.4 β, γ [171]

R-type Lektin Lumbricus terrestris 2d12 18.9 α, γ to be published

Hämagglutinin HA1 Clostridium botulinum 2ehn 24.3 α, γ [176]

MOA Marasmius oreades 2iho 21.7 α, β [178]

CEL-III RBL-2 Cucumaria echinata 2z49 17.9 α, β, γ [179]

Agglutinin Ricinus communis 1rzo 17.8 α to be published

Abbildung 4.3.14 zeigt die RBL-1-Domäne von MTX mit den Aminosäureresten des

hydrophoben Kerns und des QxW-Motivs. In dieses Modell wurden die Positionen der Zucker

aus den identifizierten Zuckerbindungsstellen übertragen. Dazu wurden die RBL-Domänen

durch Überlagerung sämtlicher β-Stränge mittels LSQKAB übereinander gelegt, die Mitte des

gebundenen Zuckersechsrings bestimmt und diese Position in der RBL-1-Domäne markiert.

Die Positionen der Zucker zeigen eine gewisse Streuung, die sich in der unterschiedlichen Art

der Bindung widerspiegelt. Dabei wird zwar stets die gleiche Bindungstasche verwendet, die

molekularen Interaktionen sind jedoch leicht verschieden.

Abbildung 4.3.14 Stereoansicht eines Bändermodells der RBL-1-Domäne mit Zuckerbindungsstellen

Die Farbgebung und Ansicht entsprechen Abbildung 4.3.10. Die Mittelpunkte der 16

Zuckerbindungsstellen laut Tabelle 4.3.10 sind als rote Punkte eingezeichnet.

Aminosäurereste, die in der RBL-1-Domäne an der Bindung von Zuckern beteiligt sein

könnten, sind grau dargestellt und entsprechen der Markierung in Abbildung 4.3.15.

174


4.3 Das Moskitozide Toxin (MTX)

Um die Zuckerbindungsstellen detaillierter zu analysieren und mit den potentiellen

Zuckerbindungsstellen von MTX zu vergleichen, wurden sämtliche zuckerbindenden repeats

sowie sämtliche MTX-Untereinheiten mit der α-Untereinheit der RBL-1-Domäne von MTX

mittels LSQKAB überlagert und das Alignment manuell überprüft (Abbildung 4.3.15).

β16 β17 β18 β19


MTX 1α 299 NSEYQIKNKKDRNIVVTLD--SDYG--GSPVESYKN-FG----FENQKWNIKYDSK

MTX 1β 346 kNAYKIYNRETPTLLLSWN--SnssngeQVIRGYTE-SG----SNNQYWTIEKNV

MTX 1γ 394 nGFYKFRNLSDPSKILDLKdgNTLN--KTPLVVSSE-NS----SSSQEWLIEKTN

MTX 2α 446 DGTYQVSSKLNENKVIEQI--ST-----NKVHIFSN-SD----KENQVWNLIYNpi

MTX 2β 491 lKAYKIKSLKYPNYSLAWD--S---nntRTIVAAT--GD----YNDQYWLIERNE

MTX 2γ 535 dNTYIIRNYENRKIVLDLSngSTTD--GNGLLGFEF-HG----GINQRWIIKPFS

MTX 3α 587 DGIYQFMTVINQDLIADLT--T----nnYTIATKTN-NY----SSNQKWTVTYNDk

MTX 3β 633 kRAYKIRNLQHAHLSLAWD--S---nhsDKIFGAT--GD----YDDQYWIPILQt

MTX 3γ 677 dGSFIFRNYKNPNKIFGTN-gQPIN--DIPLKAQDV-TG----QNNQKWYLRHLNs

MTX 4α 729 TGYFNISSKKNFNKIITMN--S----nkTQAVIFDN-IG----INNQSWKLKYNDN

MTX 4β 774 kNAYQIHI---LDNFLYFQ--G----gHNIVATMRnvt---ndDLRSYWYVEYNfn

MTX 4γ 818 kDGFIIRNAFDTSYVLDVFqnNFAN--NTPIITYQN-YL----NDNQLWNFIPSLg

RicB 1α 8 ePIVRIVGr-NG-LCVDVRdgRFHN--GNAIQLWPC-KS--ntDANQLWTLKRd

RicB 2γ 221 --dGTILNLYSG-LVLDVRasDPS---lKQIILYPL-HG----DPNQIWLPLF

Xyl α 313 ---GQIKGVGSG-RCLDVPnaSTTD--GTQVQLYDC-HS----ATNQQWTYTDA

Xyl γ 395 --dGSIVGVQSG-LCLDAVggGTAN--GTLIQLYSC-SN----GSNQRWTRT

R-lec α 131 pKFFYIKSELNG-KVLDIEgqNPAP--GSKIITWDQ-KK-gptAVNQLWYTDq

R-lec γ 217 ---NTIAQLSDRDIVLDIIksDKEA--GAHICAWKQ-HG----GPNQKFIIESE

HA1 α 149 NRNCKLQTQLNSDRFLSKN--L----nsQIIVLWQW-FD----SSRQKWIIEYNET

HA1 γ 240 aSKYILYNLQDTNRVLDVYNsQIAN--GTHVIVDSY-HG----NTNQQWIINLI

MOA α 5 RGIYHIENAGVP-SAIDLKDgSSSD--GTPIVGWQ--FTpdtiNWHQLWLAEPIPN

MOA β 57 aDTFTLCNLFSG-TYMDLYNgSSEA--GTAVNGWQ--GTafttNPHQLWTIKKSsd

CEL 2α 153 lFYGRLRNEKSD-LCLDVE--gsdgk--GNVLMYSC-ED----NLDQWFRYYEN

CEL 2β 197 ---GEIVNAKSG-MCLDVE--gsdgs--GNVGIYRC-DD----LRDQMWSRPNAyc

CEL 2γ 241 gDYCSFLNKESN-KCLDVS--gdqgt--GDVGTWQC-DG----LPDQRFKWVFd

Aggl α 2007 EPIVRIVGr-NG-LCVDVTGEEFFD--GNPIQLWPC-KS--ntDWNQLWTLRKD

hLec β 58 aGLYAIKSkatg-KVLFSR---rpaep--YVGQIDGdGR----YPDNWFKIEPGKTy

hLec γ 106 sKYFRLVQps-tgTALVSR---thlqp--YFWNHPQtEV----FDDQYFTFLFEdms

a bc d e f g hi

Abbildung 4.3.15 Strukturbasiertes Alignment der MTX-RBL-Domänen mit zuckerbindenden

Lektindomänen

Sämtliche Aminosäuresequenzen wurden analog zu MTX (Abschnitt 4.3.5) in ein α-, β-

und γ-Segment eingeteilt (kann von der in der Literatur verwendeten Nomenklatur

abweichen). Aminosäurereste, die mit dem 1α-Segment von MTX mit einer Abweichung

von maximal 3Å überlagert werden konnten, sind in Großbuchstaben dargestellt. Reste,

die zum hydrophoben Kern beitragen bzw. zum QxW-Motiv gehören, sind gelb

gekennzeichnet. Aminosäurereste, die in den etablierten Zuckerbindungsstellen an der

Zuckerbindung beteiligt sind, sind blau (Wasserstoffbrücken), grün (stacking interactions)

und orange (hydrophobe Interaktionen) unterlegt. Positionen, die dabei häufig in der

Bindung involviert sind, sind in der letzten Zeile durch Kleinbuchstaben bezeichnet. In

den potentiellen MTX-Zuckerbindungsstellen sind an diesen Positionen homologe

Aminosäurereste grau hinterlegt. Die Sekundärstrukturelemente der ersten MTX-RBL-

Domäne sind gezeigt.

Es bedeuten: RicB = Ricin B (2aai), Xyl = Xylanase (1isz), R-lec = R-type Lektin (2d12),

HA1 = Hämagglutinin HA1 (2ehn), MOA = Marasmius oreades Agglutinin (2iho), CEL =

hämolytisches Lektin CEL-III (2z49), Aggl = Agglutinin (1rzo) und hLec = hämolytisches

Lektin (1w3g).

175


4 Ergebnisse und Diskussion

Ein Analyse der Aminosäurereste, die an der Zuckerbindung in den etablierten

Zuckerbindungsstellen beteiligt sind, zeigt, dass sich diese an relativ gut konservierten

Positionen (a-i) befinden (Abbildung 4.3.15). Dabei besitzen praktisch alle

Zuckerbindungsstellen einen aromatischen Aminosäurerest (an Position e oder g), der den

Zucker über stacking-Interaktionen bindet. Weiterhin sind an allen Zuckerbindungsstellen im

Mittel sechs Aminosäurereste beteiligt, von denen die meisten über Wasserstoffbrücken mit

dem Zucker interagieren. Entsprechend häufig sind die sauren und basischen Aminosäuren

sowie Asparagin und Glutamin vorhanden, während kurze polare Aminosäuren wie Serin

oder Threonin nicht vorkommen. Das Lektin CEL-III benötigt im Gegensatz zu den anderen

RBL-Proteinen nur drei Aminosäurereste für die Zuckerbindung, hier ist allerdings zusätzlich

ein Ca 2+ -Ion an der Bindung beteiligt.

Ein Vergleich der Aminosäurereste von MTX an den Positionen a - i mit denen der etablierten

Zuckerbindungsstellen zeigt drei potentielle Bindungsstellen (2α, 2γ und 4γ) mit guter sowie

zwei (1β und 4α) mit schwacher Homologie zu den Ricin-B-ähnlichen Zuckerbindungsstellen,

die sich durch einen aromatischen Aminosäurerest an Position e auszeichnen. Weiterhin

finden sich drei potentielle Bindungsstellen (1α, 2β und 3β) mit guter Homologie zu den

Zuckerbindungsstellen des hämolytischen Lektins, das den Zucker durch eine aromatische

Aminosäure an Position g bindet. Vier repeats (1γ, 3α, 3γ und 4β) weisen an keiner der

beiden Positionen einen Aromaten auf und besitzen auch sonst wenige typische

Aminosäurereste. Zwar zeigt die Zuckerbindung im γ-Segment der HA1-Komponente, dass

diese grundsätzlich auch ohne stacking-Interaktionen realisierbar ist, dafür sind an dieser

Bindung jedoch überdurchschnittlich viele Aminosäurereste beteiligt, was für die vier

genannten potentiellen Zuckerbindungsstellen von MTX nicht der Fall ist.

Insgesamt ist es schwierig, Aussagen über eine Zuckerbindung von MTX zu treffen, da zum

einen keinerlei biochemische Daten über eine solche vorliegen und zum anderen die Varianz

in den etablierten Bindungsstellen so hoch ist, dass nicht ausgeschlossen werden kann, dass

MTX Zucker auf eine andere Weise bindet. Auch bei den etablierten Zuckerbindungsstellen

lassen sich allgemeine Aussagen nur durch Einschränkung auf einen bestimmten Zuckertyp

sowie die Bindung durch eine einzige Untereinheit treffen. Die Vielzahl von

Zuckerbindungsstellen, die durch Interaktion mit Aminosäureresten unterschiedlicher

176


4.3 Das Moskitozide Toxin (MTX)

Untereinheiten zustande kommen, sowie die Bindung modifizierter Zucker oder nicht

Galaktose-haltiger Zucker wurden bei dieser Analyse nicht berücksichtigt.

Auf der anderen Seite ist im Laufe der Evolution zwar die RBL-Faltung in vielen Proteinen

erhalten geblieben (Abschnitt 4.3.6), die Sequenzidentität zwischen diesen Proteinen ist

jedoch gering. Die Konservierung der Bindungsstellen in MTX hat daher mit hoher

Wahrscheinlichkeit auch eine funktionelle Bedeutung. Die stark konservierten Pierisine

besitzen ebenfalls Lektindomänen mit zuckerbindender Funktion [91, 92]. Abbildung 4.3.16

zeigt die Struktur von MTX mit den zwölf potentiellen Bindungsstellen.













Abbildung 4.3.16

MTX 30-870 mit potentiellen Zuckerbindungsstellen

MTX 30-870 ist als C α -Modell gezeigt, dabei entspricht die Farbgebung Abbildung 4.3.9. Die

potentiellen Zuckerbindungsstellen sind durch rote Kugeln markiert. Die pseudodreifachen

Achsen sind als schwarze Striche eingezeichnet.

177


4 Ergebnisse und Diskussion

Autoinhibition

Der C-terminale Teil des MTX-Holotoxins kann die ADP-Ribosylierung in zweifacher Weise

hemmen. Zum einen üben die Aminosäurereste 265-285 eine kompetitive Hemmung in Bezug

auf die NAD + -Bindung aus. Dieser Effekt beruht auf der Blockierung der NAD + -Bindestelle

durch den inhibitorischen Linker und war bereits durch die Struktur der katalytischen Domäne

[84] erklärt worden. Die Wirkung dieses kurzen Linkers steigt jedoch um zwei

Größenordnungen, wenn der ganze C-Terminus vorhanden ist. Das Fehlen der RBL-4-

Domäne hebt diesen Verstärkungseffekt auf, und das Fehlen des letzten repeats (4γ)

vermindert ihn stark [90]. Das Strukturmodell von MTX 30-870 erklärt diesen

Verstärkungseffekt durch den C-Terminus auf einfache Weise: Der C-Terminus bindet mit

einer Kontaktfläche von fast 2000 Å an die katalytische Domäne und verhindert so ein

Abdissoziieren des Linkers aus der NAD + -Bindungsstelle. Das Fehlen der letzten RBL-

Domäne, die den größten Kontakt zur katalytischen Domäne aufweist (Tabelle 4.3.5),

vermindert diese Assoziation so stark, dass sie sich (zumindest unter den recht stringenten

Versuchsbedingungen [90]) kaum mehr von der des Linkers alleine unterscheidet.

Dementsprechend ist auch die Komplexierungsenergie für die vierte RBL-Domäne mit

-5.3 kcal/mol am höchsten, während die ∆∆G i -Werte für die Entfernung der ersten drei RBL-

Domänen nur -3.5 kcal/mol (RBL-1), +2.5 kcal/mol (RBL-2) und -2.2 kcal/mol (RBL-3)

betragen (Tabelle 4.3.5 und Tabelle 4.3.14). Die Rolle des 4γ-Segments dürfte einmal darin

begründet sein, dass die Aminosäurereste 860-863 am Kontakt beteiligt sind, ihr Fehlen

könnte aber zusätzlich auch eine Destabilisierung der ganzen RBL-4-Domäne und dadurch

einen schwächeren Kontakt bewirken.

Die RBL-Domänen von MTX (MTX 285-870) können die katalytische Domäne zum anderen

aber auch ohne den Linker in nichtkompetitiver Weise hemmen. Dieser zweite

Hemmmechanismus kann nicht als alleinige Erklärung für die verstärkende Wirkung des

C-Terminus auf die kompetitive Inhibition durch den Linker dienen, da die beiden Konstrukte

MTX 265-285 und MTX 285-870 nicht additiv wirken [90]. Auf Grund der differentiellen

Inhibitionsstudien für die MTX-Konstrukte mit Linker wird vermutet, dass die vierte RBL-

Domäne auch für die nichtkompetitive Hemmung von entscheidender Bedeutung ist. Ein

entsprechendes Experiment für den C-Terminus ohne Linker wurde allerdings nicht

durchgeführt. Für die inhibitorische Wirkung von MTX 285-870 war ein allosterischer Effekt

vorgeschlagen worden, der entweder über den ARTT-Loop oder den Loop um

178


4.3 Das Moskitozide Toxin (MTX)

Aminosäurerest 150 herum ausgeübt werden soll, die beide für die Substratspezifität

verantwortlich gemacht werden [84]. Das Strukturmodell für das MTX-Holotoxin zeigt

jedoch keinerlei Kontakt der RBL-4-Domäne mit einer dieser beiden Regionen, so dass es

eine andere Erklärung für den Inhibitionsmechanismus geben muss. Die Kontaktfläche der

RBL-4-Domäne mit der katalytischen Domäne beinhaltet Aminosäurereste aus allen drei

repeats und die Reste 55-67 der katalytischen Domäne. Weiterhin ist der Loop 117-124 Teil

des Kontaktes zwischen der katalytischen Domäne und den beiden RBL-Domänen 3 und 4.

Dieser Loop zeigt zudem Abweichungen im Vergleich zum Modell für die katalytische

Domäne allein (Abbildung 4.3.11).

Um eine ADP-Ribosylierung durchzuführen, muss das Enzym sowohl NAD + als auch das

Substratprotein binden können und die ADP-Riboseeinheit auf das Substrat übertragen. In

Abwesenheit von Substratprotein wurde eine langsame Hydrolyse des NAD + beobachtet [82].

Die Inhibitionsstudien lassen keinen Rückschluss darauf zu, ob diese Reaktion ebenfalls

beeinflusst wird, da die Hemmung anhand der ADP-Ribosylierung überprüft wurde [90].

Somit kann die Inhibition durch die RBL-Domänen dadurch zustande kommen, dass entweder

eines der beiden Substrate (NAD + oder Proteinsubstrat) nicht binden kann, oder dass eine für

die Reaktion nötige strukturelle Umlagerung nicht erfolgen kann.

Wie bereits festgestellt wurde [84], kann NAD + trotz Entfernung des inhibitorischen Linkers

nicht ohne sterischen Konflikte in das aktive Zentrum modelliert werden, sondern es muss

zusätzlich eine Umordnung zumindest der Seitenketten erfolgen. Um die Möglichkeit einer

größeren strukturellen Umordnung zu untersuchen, wurden die Strukturen verwandter ADP-

Ribosyltransferasen analysiert. Eine Struktur mit NAD + oder einem nicht-hydrolysierbaren

Analogon von NAD + ist für Diphtherietoxin, Choleratoxin und Exotoxin A (Tabelle 1.3.2)

bekannt. Exotoxin A wurde sogar zusätzlich im Komplex mit seinem Substrat strukturell

untersucht.

Die Struktur des Diphtherie-Holotoxins konnte mit und ohne NAD + gelöst werden. Der

einzige Unterschied in den Domänen (Tabelle 4.3.11) zeigt sich im active site loop (AS 39-

46), der bei NAD + -Bindung eine ungeordnete Konformation annimmt [65, 66, 180-182].

179


4 Ergebnisse und Diskussion

Für Exotoxin A aus P. aeruginosa (PAETA) konnte die Struktur des Holotoxins ohne und die

der katalytischen Domäne mit Cosubstrat gelöst werden. Anstelle des leicht hydrolysierbaren

NAD + wurde das nicht-hydrolysierbare β-TAD verwendet. Der Vergleich der beiden

Strukturen zeigt, dass auch hier der zum active site loop von Diphtherietoxin topologisch

äquivalente Loop L1 (AS 458-463) von einer geordneten Struktur im nukleotidfreien Toxin zu

einer ungeordneten Struktur bei Bindung des NAD + -Analogons übergeht [70, 71, 183]. Loop

L1 (AS 458-463) nimmt wiederum bei gleichzeitiger Bindung von eEF2 und β-TAD eine

definierte Konformation an, die sich aber von der Konformation im inaktiven Holotoxin

unterscheidet (Tabelle 4.3.12).

Tabelle 4.3.11 Konformationelle Unterschiede im active site loop von Diphtherietoxin

AS 39 - 46

Holotoxin + NAD +

(1tox)

Holotoxin

(1sgk)

Holotoxin + NAD +

(1tox)

NAD + -Hydrolaseaktivität

ungeordnet

Holotoxin

(1sgk)

katalytische Domäne

(1dtp)

- -

inaktiv

geordnet ∆C α ~ 2.5Å

katalytische Domäne

(1dtp)

aktiv

geordnet

Tabelle 4.3.12

AS 458 - 463

kat. Domäne + β-TAD

(1aer)

Holotoxin

(1ikq)

kat. Dom. + eEF2 + β-TAD

(1zm4)

kat. Domäne + eEF2

(1zm2)

Konformationelle Unterschiede im Loop L1 von Exotoxin A

kat. Domäne + β-TAD

(1aer)

aktiv

ungeordnet

Holotoxin

(1ikq)

kat. Dom. + eEF2 + β-TAD

(1zm4)

kat. Domäne + eEF2

(1zm2)

- - --

inaktiv

geordnet

∆C α ~ 10Å

aktiv

geordnet

∆C α ~ 10Å

identisch

aktiv

geordnet

Tabelle 4.3.13

AS 25 - 36

intrins. aktives Holotoxin

(1s5d)

Holotoxin

(1s5e)

kat. Dom. + ARF6 + NAD +

(2a5f)

kat. Dom. + ARF6

(2a5e)

Konformationelle Unterschiede im Aktivierungsloop von Choleratoxin

intrinsisch aktives

Holotoxin (1s5d)

aktiv

ungeordnet

Holotoxin

(1s5e)

kat. Dom. + ARF6 + NAD +

(2a5f)

kat. Domäne + ARF6

(2a5e)

- - -

inaktiv

geordnet

∆C α ~ 10Å

aktiv

geordnet

∆C α ~ 10Å

identisch

aktiv

geordnet

180


4.3 Das Moskitozide Toxin (MTX)

Choleratoxin, und ebenso das zu 80% homologe E. coli heat labile toxin, konnten lange Zeit

nur in der inaktiven proenzymatischen Form kristallisiert werden, da das voll aktivierte Toxin

bereits bei niedrigen Proteinkonzentrationen aggregierte. Die strukturelle Untersuchung einer

intrinsisch aktiven Mutante des Cholera-Holotoxins ermöglicht jedoch einen Einblick in die

Konformationsänderungen, die mit der Aktivierung verbunden sind. Der größte Unterschied

zwischen den Strukturen tritt im so genannten Aktivierungsloop (AS 25-36) auf, der in der

aktiven Form ungeordnet wird. Dieser Loop nimmt bei Bindung des Aktivators ARF6 mit

oder ohne NAD + wiederum eine strukturierte Form an, die sich aber von der Konformation im

inaktiven Holotoxin unterscheidet (Tabelle 4.3.13). Der Aktivierungsloop ist topologisch

äquivalent zum active site loop von Diphtherietoxin.

Die Loops 25-37 von Choleratoxin, 457-464 von Exotoxin A und 39-47 von Diphtherietoxin

sind topologisch äquivalent zu Loop 117-124 von MTX. Bei diesen Loops handelt es sich um

einen an der Oberfläche gut zugänglichen Bereich, der in einigen, aber nicht allen Strukturen

auch an Kristallkontakten beteiligt ist. Dennoch erscheint es signifikant, dass dieser Loop bei

allen drei betrachteten Toxinen, die in einer inaktiven und einer aktiven Form strukturell

untersucht wurden, eine Konformationsänderung erfährt. Diese Konformationsänderung kann

jedoch nicht ursächlich auf die Bindung von NAD + zurückzuführen sein, da die aktiven

Formen von Choleratoxin und Exotoxin A keinen Unterschied in Abhängigkeit von der

NAD + -Bindung aufweisen. Ob dieser Bereich direkt an der Substraterkennung oder -bindung

beteiligt ist, muss durch weitere Experimente untersucht werden. Das Modell für die Struktur

von MTX 30-870 zeigt aber, dass eine Bewegung des Loops 117-124 im Holotoxin nicht

möglich ist, weil dieser Teil des Kontaktes zu den RBL-Domänen 3 und 4 ist. Dies ist eine

mögliche Erklärung für die inhibitorische Wirkungsweise des C-Terminus.

Die Betrachtung der Struktur des Holotoxins liefert auch eine alternative Erklärung für den

Wirkmechanismus der RBL-Domänen. Die vier Domänen legen sich in einer langen Kette um

die katalytische Domäne und bilden dabei einen Halbkreis, in dessen Mitte die katalytische

Domäne zu liegen kommt (Abbildung 4.3.9). Die Anordnung der RBL-Domänen wirkt dabei

wie eine große Klammer, die strukturelle Umordnungen der katalytischen Domäne verhindern

und so deren Funktion inhibieren kann.

181


4 Ergebnisse und Diskussion

Aufnahmemechanismus von MTX

Über den Aufnahmemechanismus von MTX liegen keinerlei Daten vor. Daher können nur

Hypothesen auf Grund des Eintrittsmechanismus anderer Toxine aufgestellt werden. Die

meisten Toxine werden in einem ersten Schritt bei Bindung an einen extrazellulären Rezeptor

durch Endocytose in die Zellen aufgenommen. Der genaue Mechanismus der Endocytose

variiert dabei von Toxin zu Toxin, und teilweise sind auch für ein Toxin mehrere

Mechanismen möglich. Unabhängig von der Art der Endocytose gelangen die Toxine aber

zunächst in die frühen Endosomen, in denen ein pH-Wert von 6.0 - 6.2 herrscht. Dieser pH-

Wert ist bei vielen Proteinen für die Ablösung von ihrem Rezeptor ausreichend [69, 184-186].

Diphtherietoxin, Botulinustoxin und Anthraxtoxin werden von den frühen Endosomen in die

späten Endosomen weitertransportiert, wo ein pH-Wert von 5.0 - 5.5 herrscht. Bei diesem pH-

Wert dissoziieren die Toxine von ihrem Rezeptor ab, erfahren eine Konformationsänderung

und lagern ihre Translokationsdomänen in die Membran ein. Anschließend erfolgt der

Transport der aktiven Komponente durch die Membran [185].

Für Shigatoxin, Choleratoxin, PAETA, Ricin und andere Toxine wird der ERAD-pathway

vorgeschlagen [69, 184-186]. Dabei gelangen die Proteine aus den frühen oder späten

Endosomen über das Trans-GOLGI-Netzwerk in das ER, wo sie den Transportweg für

ungefaltete Proteine über die Sec61-Pore ins Cytosol ausnutzen. Da die katalytischen

Komponenten auffallend wenige Lysine besitzen, könnten sie der anschließenden

Ubiquitinylierung und dem Abbau im Proteasom entgehen (Abschnitt 1.3.1).

MTX wird im alkalischen Milieu des Insektendarms durch Proteasen aktiviert. Über die

Rezeptorbindung ist nichts bekannt, allerdings bindet das stark sequenzhomologe Pierisin-1

die neutralen Glykosphingolipide Gb3 und Gb4 [91], so dass auch für MTX Glykolipide als

Rezeptoren wahrscheinlich erscheinen. MTX wird dann aller Wahrscheinlichkeit nach

endocytiert und gelangt in die frühen Endosomen. Im Folgenden muss die katalytische

Domäne zum einen von den RBL-Domänen und dem inhibitorischen Linker abdissoziieren

und zum anderen die Membran ins Cytosol überqueren. Anhand der Aufnahmemechanismen

anderer Toxine lassen sich hierfür zwei Wege postulieren, die auf Grund fehlender Daten

jedoch nur als Arbeitshypothesen für weitere Untersuchungen gelten können.

182


4.3 Das Moskitozide Toxin (MTX)

Die Analyse sämtlicher Strukturen für die katalytische Domäne zeigt, dass die ersten 40

Aminosäurereste (MTX 30-70 ), die nicht zur typischen Faltung der ARTs gehören, relativ

flexibel sind, da sie in Strukturen bei pH 4.3 und pH 6.3 starke Abweichungen voneinander

zeigen [84]. Dieser Abschnitt enthält auch die Helix α1, die als Transmembranhelix

vorhergesagt wird [78]. Weiterhin tritt bei pH 4.3 in zwei Kristallformen ein Heptamer auf,

das auch in Lösung nachgewiesen werden konnte (vergleiche Abschnitt 4.3.5). Allerdings ist

das Heptamer inkompatibel mit der Struktur des Holotoxins bei pH 8.4, da die RBL-2-

Domäne im Heptamer mit einem benachbarten Monomer kollidieren würde. Eine Analyse der

Kontaktflächen zwischen den fünf Domänen des Holotoxins (Tabelle 4.3.5 und Tabelle

4.3.14) zeigt jedoch, dass diese relativ klein sind. Zudem befinden sich in den Kontaktflächen

insgesamt sechs Glutamate, Aspartate und Histidine, die keine Salzbrücken ausbilden. Diese

können bei Senkung des pH-Wertes protoniert werden und dadurch die Dissoziation der

Domänen bewirken. Es ist somit denkbar, dass sich die kompakte Struktur des Holotoxins bei

einem niedrigeren pH-Wert, wie er zum Beispiel in den späten Endosomen auftritt, auflöst.

Sofern eine hohe lokale Toxinkonzentration, die durch eine lokale Ansammlung von

Rezeptoren zustande kommen könnte, vorliegt, wäre dann die Bildung des Heptamers

denkbar, bevor die RBL-Domänen und der Linker abdissoziieren (Abbildung 4.3.17). Die

Ausbildung des Heptamers würde den Linker zunächst in den Heptamerkontakten fixieren.

Anschließend könnte es zu einer Umstrukturierung der N-terminalen 40 Aminosäurereste und

der Einlagerung der sieben α1-Helices in die Membran kommen, die dann die Translokation

der katalytischen Domäne ins Cytosol ermöglichen würden. Es ist auch denkbar, dass wie im

Falle des Diphtherietoxins weitere Faktoren für die Translokation benötigt werden. Der

Linker würde mit den an den Rezeptor gebundenen RBL-Domänen in den späten Endosomen

zurückbleiben, so dass die ins Cytosol translocierte katalytische Domäne aktiv wäre.

Tabelle 4.3.14

Kontaktflächen der RBL-Domänen untereinander

RBL-Domänen a) Größe [Å 2 ] ∆G i [kcal/mol] b) H/S-Brücken c)

RBL-1 (296-440) RBL-2 (442-580) 387 0.5 7

RBL-2 (442-580) RBL-3 (582-723) 366 -1.1 8

RBL-3 (582-723) RBL-4 (725-866) 494 1.6 12

a) es wurde jeweils ein Rest entfernt, da der kovalente Kontakt bei der Berechnung nicht berücksichtigt werden

sollte

b) berechneter Energiegewinn bei der Komplexierung (PISA)

c) Anzahl der Wasserstoff- sowie Salzbrücken

183


4 Ergebnisse und Diskussion

Abbildung 4.3.17

Modell von MTX-Holotoxin nach theoretischer Disassemblierung der RBL-Domänen

und Ausbildung des Heptamers

Die RBL-Domänen, deren Anordnung vereinfacht als lineare Kette dargestellt ist, könnten

Glykolipide der Membran binden. Die instabilen 40 N-terminalen Aminosäurereste mit

der vorhergesagten Transmembranhelix berühren die Membran.

Ein alternatives Eintrittszenario berücksichtigt die Tatsache, dass MTX im Gegensatz zu

Diphtherietoxin, Botulinustoxin und Anthraxtoxin keine eigene Translokationsdomäne besitzt

und daher der Translokationsmechanismus wie oben beschrieben sehr ungewiss erscheint.

Dagegen besitzt MTX nur drei Lysine in der katalytischen Domäne, so dass die Aufnahme ins

Cytosol über den ERAD-pathway, der sich bei vielen Toxinen unabhängig voneinander

entwickelt hat, sehr wahrscheinlich ist (Abbildung 4.3.18). Nach dieser Hypothese würde

MTX in den frühen oder auch späten Endosomen von seinem Rezeptor abdissoziieren und

anschließend über das Trans-GOLGI-Netzwerk ins ER gelangen. Dabei könnte bei einem

Weg über die späten Endosomen bereits eine pH-abhängige Trennung von katalytischer

Domäne und C-Terminus stattgefunden haben. Alternativ kann die Dissoziation durch die

teilweise Entfaltung, die für den Transport aus dem ER ins Cytoplasma nötig ist, realisiert

werden. Durch den Mangel an Ubiquitinylierungsstellen würde die katalytische Domäne dem

Abbau durch das Proteasom entgehen, während der C-Terminus, sofern er überhaupt ins

Cytosol gelangt, ubiquitinyliert und degradiert werden würde.

Allerdings besitzt MTX im Gegensatz zu anderen Toxinen keine Disulfidbrücke, die die

katalytische und die zellbindenden Domänen verbinden, so dass es nicht auf die Funktion der

Proteindisulfidisomerase (PDI) im ER für die Aktivierung angewiesen ist.

184


4.3 Das Moskitozide Toxin (MTX)

Legende:

7

Abbildung 4.3.18 Schematische Darstellung des hypothetischen ERAD-pathways für MTX

Aktiviertes MTX 30-870 bindet an seinen Rezeptor, wird endocytiert (1) und gelangt in die

frühen Endosomen (2). Von dort wird es über das Trans-GOLGI-Netzwerk ins ER

transportiert (3,4), wo die Ketten zumindest teilweise entfaltet werden und dadurch

dissoziieren (5). Über Sec61 (6) gelangen beide Polypeptide ins Cytosol. Dort entgeht die

katalytische Domäne auf Grund des geringen Lysingehaltes der Ubiquitinylierung und dem

Abbau im Proteasom und faltet sich zurück (7), während die RBL-Domänen im Proteasom

abgebaut werden. Alternativ könnte MTX auch bis in die späten Endosomen (3a) gelangen

und dort auf Grund des niedrigen pH dissoziieren, so dass nur die katalytische Domäne ins

ER weitertransportiert wird (3b).

185


4 Ergebnisse und Diskussion

4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

4.4.1 Reinigung von DHPH

Das für DHPH als Polyhistidinfusionsprotein codierende Plasmid pH6EX3.DHPH wurde

durch den Arbeitskreis Brandsch (Institut für Biochemie und Molekularbiologie, Universität

Freiburg) zur Verfügung gestellt. DHPH wurde in BL21 (DE3) durch Induktion mit IPTG und

Kultivierung über Nacht bei 25°C produziert und über eine Affinitätssäule gereinigt. Die

Elution fand mit einem Imidazolkonzentrationsgradienten statt, detektiert wurde bei 280 nm

und dem FAD-Absorptionsmaximum bei 450 nm (Abbildung 4.4.1 A). Proteinhaltige

Fraktionen wurden mittels SDS-PAGE untersucht (Abbildung 4.4.1 B).

A

Absorption [mAU]

3000

2500

2000

1500

1000

500

A 280nm

A 450nm

% B

100

90

80

70

60

50

40

30

20

10

% B

B

0

0

100 150 200 250 300 350

Volumen [mL]

Abbildung 4.4.1

Affinitätschromatographie von DHPH

A: Elutionsdiagramm der Ni-Affinitätssäule

B: SDS-PAGE der DHPH-haltigen Fraktionen

Als weiterer Reinigungsschritt wurde eine Anionenaustauschchromatographie an einer

MonoQ-Säule durchgeführt. Dazu wurden die DHPH-haltigen Fraktionen (in Abbildung 4.4.1

mit einem schwarzen Balken markiert) aufkonzentriert, 1:10 mit salzfreiem Puffer verdünnt

und auf die Säule aufgetragen. Die Elution erfolgte durch graduelle Erhöhung der

Salzkonzentration. Ein typisches Chromatogramm ist in Abbildung 4.4.2 A, die zugehörige

SDS-PAGE in Abbildung 4.4.2 B zu sehen.

186


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

A

1600

100

B

Absorption [mAU]

1400

1200

1000

800

600

400

A 280nm

A 450nm

(4fach vergrößert)

Leitfähigkeit [mS/cm]

% B

90

80

70

60

50

40

30

20

Leitfähigkeit [mS/cm] // %B

200

10

0

0

0 5 10 15 20 25 30

Volumen [mL]

Abbildung 4.4.2

Anionenaustauschchromatographie von DHPH

A: Elutionsdiagramm der MonoQ-Säule

B: SDS-PAGE der DHPH-haltigen Fraktionen

Die SDS-PAGE zeigt, dass DHPH zu diesem Zeitpunkt sehr rein vorlag. Das Protein wurde

gegen den Kristallisationspuffer (40 mM HEPES, pH 7.4, 100 mM NaCl, 10% (v/v) Glycerin)

dialysiert und für Kristallisationsversuche nach der sitting drop Methode eingesetzt. Dabei

präzipitierte DHPH in sämtlichen Bedingungen auch bei niedrigen Proteinkonzentrationen.

Daher wurde der Einfluss von Reduktionsmittel auf DHPH getestet. Dazu wurde zum einen

eine SDS-PAGE mit und ohne β-ME im Probenpuffer durchgeführt (Abbildung 4.4.3 B) und

zum anderen das Laufverhalten bei einer GPC mit und ohne DTT im GPC-Puffer (Abschnitt

3.4.8) getestet (Abbildung 4.4.3 A). Dabei konnten keine Unterschiede festgestellt werden.

Kristallisationsversuche mit Protein aus der GPC mit Reduktionsmittel verliefen ebenso

erfolglos. Das Chromatogramm der GPC an einer HiLoad-26/60 Superdex-200 prep grade

Säule (Säule I) zeigt ein Absorptionsmaximum bei 187 mL (Abbildung 4.4.3A), was einer

molekularen Masse von 113 kDa entspricht. Dieser Wert liegt zwischen den theoretischen

Werten für ein Trimer und ein Dimer. In der Literatur [95] wird DHPH als Dimer

beschrieben.

187


4 Ergebnisse und Diskussion

A

70

Puffer mit DTT

Puffer ohne DTT

B

60

50

Absorption [mAU]

40

30

20

10

0

Abbildung 4.4.3

160 180 200 220 240

Volumen [mL]

Untersuchung des Einflusses von Reduktionsmitteln auf DHPH

A: Überlagerte Chromatogramme von GPC-Läufen von DHPH mit und ohne DTT

B: SDS-PAGE von DHPH mit und ohne β-ME im Probenpuffer

Wurde das Protein für mehrere Tage bei 4°C aufbewahrt, so zeigte sich auch hier ein gelbes

Präzipitat. Dieses wurde abzentrifugiert und der Überstand erneut einer Anionenaustauschchromatographie

an einer MonoQ-Säule unterworfen. Elutionsdiagramm und SDS-PAGE

unterschieden sich nicht von der ersten Chromatographie und sind hier daher nicht dargestellt.

DHPH wurde erneut für Kristallisationsversuche eingesetzt, die nun erfolgreich waren.

Bei dem präzipitierten Protein muss es sich um DHPH handeln, da das Protein sehr rein

vorlag. Eine Aggregation durch Ausbildung von Disulfidbrücken kann ausgeschlossen

werden, da Reduktionsmittel ebenso wenig Einfluss auf die Proteineigenschaften zeigte wie

der Austausch der beiden Cysteine zu Serin (Abschnitt 4.4.4). Weiterhin kann es sich nicht

um Apo-Protein handeln, da der Niederschlag gelb war. Zudem fiel auch bei weiterer

Inkubation des Überstandes weiterhin gelbes Protein aus. Daher wurde vermutet, dass es sich

bei dem präzipitierten Protein um ein heterogenes Dimer aus Apo- und Holoenzym handelt.

Um dies zu überprüfen, wurde das Verhältnis der Absorptionen bei 280 nm und 450 nm

gemessen. Die Absorption bei 450 nm ist vollständig auf FAD zurückzuführen, während bei

280 nm sowohl Protein als auch FAD absorbieren. Der Anteil der Proteinabsorption

(ε = 59360 M -1 cm -1 ) wurde rechnerisch bestimmt (Abschnitt 3.3.1), während für FAD zur

188


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Bestimmung des Extinktionskoeffizienten ein Spektrum aufgenommen wurde. Da die

Steigung des FAD-Spektrums bei 280 nm jedoch groß ist, ist der erhaltene

Extinktionskoeffizient von 24'000 M -1 cm -1 relativ stark fehlerbehaftet. Für das Verhältnis der

Extinktionen bei 280 und 450 nm ergab sich für das Holotoxin ein Wert von 7.4

(Abschnitt 3.3.1). Protein, das nur durch Affinitätschromatographie gereinigt wurde, zeigte

ein Verhältnis von A 280nm /A 450nm > 9, was auf einen Überschuss von Protein gegenüber FAD

hinweist. Dagegen besaß das zur Kristallisation eingesetzte Protein ein A 280nm /A 450nm -

Verhältnis von 7.8 - 7.9, was innerhalb der Fehlergrenzen gut mit dem berechneten Wert

übereinstimmt. Nach langer Inkubationszeit bei 4°C nimmt der Wert jedoch wieder zu.

Vermutlich dissoziiert FAD nach und nach vom Protein ab und das entstehende Apo- und

heterogene Apo-/Holoenzym ist instabil und fällt aus. Da sich der heterogene Proteinanteil

nicht vom Holotoxin unterscheidet und zudem ständig nachgebildet wird, kann dieser

Umstand nicht beeinflusst werden. Er ist vermutlich mit für die schlechte Kristallqualität

verantwortlich (Abschnitte 4.4.2 - 4.4.5).

4.4.2 Kristallisation von DHPH

DHPH wurde gegen den Kristallisationspuffer (40 mM HEPES, pH 7.4, 100 mM NaCl,

10% (v/v) Glycerin) dialysiert und eine Proteinkonzentration von 8 mg/mL eingestellt. Mit

Hilfe der sitting drop-Methode wurden die Kristallisationsbedingungen der Screens JBS 1-10,

Wizard I+II, Wizard Cryo I+II sowie Crystal Screen I+II und Crystal Screen Cryo getestet.

Es fanden sich mehrere initiale Kristallisationsbedingungen (Tabelle 4.4.1), die bezüglich pH-

Wert und Fällungsmittelkonzentration verfeinert wurden. Zudem wurden Additive eingesetzt,

die jedoch keine weitere Verbesserung der Kristalle erbrachten. Weiterhin wurde zur

Verbesserung der Kristallqualität mit Zusatz von Agarose kristallisiert, die aber keinen

Einfluss auf die Röntgentauglichkeit hatte. Auch durch microseeding wurde keine

Verbesserung der Kristalle erzielt.

Zudem wurde versucht, weitere Kristallisationsbedingungen oder bessere Kristalle durch

Zusatz von Substrat (2 mM 2,6-Dihydroxypyridin in 8 mg/mL Proteinlösung) oder

Inhibitoren (2 mM 2,6-Dimethoxypyridin oder 2 mM 2,3-Dihydroxypyridin in 8 mg/mL

Proteinlösung) ausfindig zu machen, was aber ebenfalls nicht gelang.

189


4 Ergebnisse und Diskussion

Tabelle 4.4.1 Kristallisationsbedingungen von DHPH

Initiale Bedingung

I Crystal Screen I, 18

0.1 M NaCacodylat pH 6.5

20% (w/v) PEG-8000

0.2 M MgAc 2

Verfeinerte Bedingung

0.1 M NaCacodylat pH 6.2

18% (w/v) PEG-8000

0.2 M MgAc 2

II Crystal Screen II, 22

0.1 M MES pH 6.5

12% (w/v) PEG-20000

0.1 M MES pH 6.7

13% (w/v) PEG-20000

III

JBS 5, A5

0.1 M MES pH 6.5

0.1 M MES pH 6.4

15% (w/v) PEG-8000

14% (w/v) PEG-8000

0.2 M NaAc 2 0.2 M NaAc 2

(hier mit 2 mM 2,6-DHP)

IV Crystal Screen Cryo, 9

0.085 M Citrat pH 5.6

25.5% (w/v) PEG-4000

0.17 M NH 4 Ac

15% (v/v) Glycerin

0.1 M Citrat pH 5.4

23.5% (w/v) PEG-4000

0.2 M NH 4 Ac

15% (v/v) Glycerin

V Crystal Screen Cryo, 18

0.085 M NaCacodylat

pH 6.5

16% (w/v) PEG-8000

0.16 M MgAc 2

20% (v/v) Glycerin

0.1 M NaCacodylat pH 6.6

15% (w/v) PEG-8000

0.2 M MgAc 2

20% (v/v) Glycerin

(hier mit 2 mM 2,6-DHP

und 2 mM NADH)

Der Balken in der Ecke der Kristallbilder entspricht einer Länge von 100 µm.

Die größten Kristalle der Bedingung Crystal Screen I, 18 (0.1 M Natriumcacodylat pH 6.2,

18% (w/v) PEG-8000, 0.2 M MgAc 2 ) wurden auf ihre Röntgentauglichkeit hin überprüft.

Dazu wurden verschiedene Cryoreagenzien getestet, die aber alle zu Rissen in den Kristallen

führten. Auch ein langsames Erhöhen der Cryoschutzmittelkonzentration konnte dies nicht

verhindern. Die besten Ergebnisse wurden mit MPD (20% (v/v)) und sehr kurzen

Inkubationszeiten (< 1min) erzielt; die so behandelten Kristalle streuten am SLS (Villigen,

Schweiz) bis maximal 3.1 Å (Bedingung I). Die Kristalle aus anderen

Kristallisationsbedingungen streuten bis max. 8 Å. Auf Grund der Probleme beim Einfrieren

der Kristalle wurde das Hauptaugenmerk auf die Verfeinerung der gefundenen initialen

Bedingung mit Cryoschutz (Bedingung V) gelegt. Hier konnten Kristalle bis zu einer Größe

von 100 x 400 x 600 µm 3 gezüchtet werden. Diese Kristalle wuchsen innerhalb von einer

Woche und streuten am SLS bis 2.9 Å.

190


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

4.4.3 Reinigung und Kristallisation von Selenomethionin-markiertem DHPH

Für die Phasenbestimmung bot sich auf Grund der guten Expression und der hohen Anzahl

von Methioninen (7 von 397 Aminosäureresten) die Phasierung durch den Einbau von

Selenomethionin an. Die Inkorporation von Selenomethionin erfolgte durch Produktion des

Proteins im Methionin-auxotrophen E. coli Stamm B834 (DE3) in LeMaster-Medium. Die

Aufreinigung erfolgte unter reduktiven Bedingungen mit 0.5 mM TCEP in allen Puffern. Das

Reinigungsprotokoll bestand aus einer Affinitätschromatographie, gefolgt von einer

Anionenaustauschchromatographie, viertägiger Inkubation bei 4°C, Zentrifugation zur

Abtrennung von präzipitiertem Protein und erneuter Anionenaustauschchromatographie. Da

der Reinigungsverlauf sich nicht von dem des Wildtypproteins unterschied, wird hier auf eine

genauere Darstellung verzichtet.

Für Kristallisationsversuche wurde das Protein gegen den Kristallisationspuffer (40 mM

HEPES pH 7.4, 100 mM NaCl, 10% (v/v) Glycerin) dialysiert und eine Proteinkonzentration

von 8 mg/mL eingestellt. Mit Hilfe der sitting drop-Methode wurden die

Kristallisationsbedingungen der Screens JBS 1-10, Wizard I+II, Wizard Cryo I+II sowie

Crystal Screen I+II und Crystal Screen Cryo getestet. Es wurden dieselben initialen

Bedingungen wie für das native Protein gefunden und wie oben verfeinert. Auch hier zeigten

nur die Kristalle der Bedingung V eine ausreichende Auflösung von 3.1 Å (SLS, Villigen).

4.4.4 Herstellung, Reinigung und Kristallisation von Cysteinmutanten

Da die Auflösung des Datensatzes des nativen Proteins für eine Strukturlösung

unbefriedigend war, wurde weiterhin versucht, durch Mutation von Cysteinresten bessere

Kristalle zu erhalten. Cysteine können durch Ausbildung von Disulfidbrücken hinderlich für

die Kristallisation sein und ihr Austausch gegen Serin hat schon in vielen Fällen Erfolg für die

Kristallisation gezeigt [27, 187, 188]. DHPH besitzt zwei Cysteine an den Positionen 119 und

323. Daher wurden die beiden Einzelmutanten DHPH (C119S) und DHPH (C323S) sowie die

Doppelmutante DHPH (C119S, C323S) mit Hilfe der QuikChange TM -Methode hergestellt und

die Proteine wie das Wildtypprotein produziert und gereinigt (Daten nicht gezeigt). Auch die

Mutanten präzipitierten teilweise bei Inkubation bei 4°C, und nur der erneut gereinigte

Überstand konnte kristallisiert werden. Für das Auffinden initialer Bedingungen wurden die

Proteine auf 8 mg/mL in Kristallisationspuffer (40 mM HEPES, pH 7.4, 100 mM NaCl,

191


4 Ergebnisse und Diskussion

10% (v/v) Glycerin) eingestellt und mit Hilfe der sitting drop-Methode die

Kristallisationsbedingungen der Screens JBS 1-10, Wizard I+II, Wizard Cryo I+II sowie

Crystal Screen I+II und Crystal Screen Cryo getestet. Gleichzeitig wurden Screenings mit

und ohne Substrate und Inhibitoren durchgeführt. Es konnten jedoch auch hier keine vom

Wildtypprotein verschiedenen initialen Kristallisationsbedingungen gefunden werden. Tabelle

4.4.2 gibt einen Überblick über sämtliche durchgeführte initiale Screens und die gefundenen

initialen Kristallisationsbedingungen.

Tabelle 4.4.2

Übersicht über die durchgeführten Versuche zum Auffinden initialer

Kristallisationsbedingungen

Protein Zusätze Screens initiale Kristalle

DHPH

DHPH SeMet

DHPH (C119S, C323S)

DHPH (C119S)

DHPH (C323S)

keine

2 mM 2,6-Dihydroxypyridin

2 mM 2,6-Dimethoxypyridin

2 mM 2,3-Dihydroxypyridin

keine

keine

2 mM 2,6-Dihydroxypyridin

2 mM 2,6-Dimethoxypyridin

2 mM 2,3-Dihydroxypyridin

keine

2 mM 2,6-Dihydroxypyridin

2 mM 2,6-Dimethoxypyridin

2 mM 2,3-Dihydroxypyridin

keine

2 mM 2,6-Dihydroxypyridin

2 mM 2,6-Dimethoxypyridin

2 mM 2,3-Dihydroxypyridin

JBS 1-10

Wizard I+II,

Wizard Cryo I+II

Crystal Screen I+II

Crystal Screen Cryo

JBS 5, A5

Crystal Screen I, 18

Crystal Screen II, 22

Crystal Screen Cryo, 9

Crystal Screen Cryo, 18

Eine Verfeinerung der initialen Bedingungen bezüglich pH-Wert und Fällungsmittel sowie

der Einsatz von Agarose führte jedoch schließlich in der Bedingung V, die bereits für das

Wildtypprotein die besten Kristalle ergeben hatte, zu Kristallen, die ein besseres Wachstum in

der dritten Dimension aufwiesen. Vor allem Kristalle der Cysteinmutante C323S (Abbildung

4.4.4) zeigten auch eine höhere Röntgentauglichkeit mit Auflösungen von unter 3 Å. Die

Kristallisationsbedingung ist in Tabelle 4.4.3 detailliert aufgeführt.

100 µm

Abbildung 4.4.4

Kristall der DHPH-Cysteinmutante C323S aus

Kristallisationsbedingung V

192


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Tabelle 4.4.3

Kristallisationsbedingung V für DHPH (C323S)

Parameter

Wert

Reservoirpuffer a

0.1 M Natriumcacodylat, pH 6.6 (NaOH), 15% (w/v)

PEG-8000, 0.2 M MgAc 2 , 20% (v/v) Glycerin

Kristallisationsmethode hanging drop

Vorsättigung

50% (v/v) der Reservoirkonzentration

Konzentration MTX 30-870 a 8 mg/mL

Zusätze a

0.4% (w/v) low melting Agarose

Kristallisationspuffer a 40 mM HEPES, pH 7.4, 100 mM NaCl, 10%(v/v) Glycerin

Tropfengröße 4 - 8 µL

Temperatur 20°C

a Die Angaben beziehen sich auf die Konzentrationen vor Ansetzen des Kristallisationstropfens

Herstellung von substrathaltigen Kristallen

Zur Herstellung von substrathaltigen Kristallen wurde zunächst versucht, Kristalle der DHPH

Cysteinmutante C323S mit Substrat oder Inhibitoren zu tränken. Dazu wurde in die Kristalle

enthaltenden Tropfen vorsichtig etwas Substratlösung (50 mM) zugegeben. Zum Teil zeigten

sich infolge dessen Risse in den Kristallen, in der Regel aber konnten keine morphologischen

Störungen festgestellt werden. Allerdings streuten die so behandelten Kristalle bis maximal

3.4 Å und die Dichte erwies sich als zu schlecht, um feststellen zu können, ob das Substrat

oder die Inhibitoren in das aktive Zentrum gelangt waren. Die schlechte Auflösung muss nicht

auf die Tränkexperimente zurückzuführen sein, da auch die nativen Kristalle ein sehr

unterschiedliches Streuverhalten zeigten. Da die Tränkversuche nicht zu auswertbaren

Ergebnissen führten, wurde das Protein mit Substrat oder Inhibitor versetzt und die bereits

zuvor gefundenen Kristallisationsbedingungen, die sich nicht von denen ohne Zusätze

unterschieden, verfeinert. Auch hier wurden schließlich mit der Kristallisationsbedingung V

die besten Ergebnisse erzielt. Für beide Inhibitoren sowie für das Substrat konnten Kristalle

erzeugt werden, die Auflösungen um 3 Å zeigten.

Zusätzlich wurde versucht, das Cosubstrat NADH durch Kokristallisation an seiner

Bindestelle zu lokalisieren. Dazu wurden 2 mM NADH bzw. NAD + zusammen mit 2 mM

2,6-DHP der Proteinlösung beigemischt. Es fanden sich keine neuen

Kristallisationsbedingungen, allerdings zeigten einige Kristalle eine deutliche Blaufärbung,

die auf die Bindung des produzierten blauen Pigments hinweisen (Bedingung V in Tabelle

4.4.1). Diese Kristalle wuchsen jedoch nur bis zu einer maximalen Größe von

80 x 80 x 150 µm 3 und streuten nur bis etwa 4 Å.

193


4 Ergebnisse und Diskussion

4.4.5 Datensammlung

Die Kristalle aus Bedingung V wurden mit cryo-loops aus den entsprechenden

Kristallisationstropfen gefischt und anschließend direkt in flüssigem Stickstoff

schockgefroren. Ein Zusatz von Cryopuffer war nicht nötig, da diese Bedingung bereits genug

Cryoreagenz enthielt. Die Kristalle wurden am SLS an den beamlines PX10 und PX06 auf

ihre Röntgentauglichkeit geprüft. Nur wenige Kristalle streuten besser als 3 Å, die beste

erzielte Auflösung betrug 2.6 Å. Der beste Kristall mit Selenomethionin-substituiertem

DHPH streute bis 3.1 Å. Für diesen Kristall wurde ein Fluoreszenzspektrum aufgenommen,

um die idealen Wellenlängen für die Messung der drei Datensätze (peak, inflection, high

remote) für eine MAD-Phasierung zu bestimmen (Daten nicht gezeigt). Ein MAD-Datensatz

wurde bei den drei ermittelten Wellenlängen an einem einzigen Kristall aufgenommen. Die

Daten wurden mittels XDS und XSCALE prozessiert. Sämtliche Kristalle gehörten der

Raumgruppe P3 2 21 an. In Tabelle 4.4.5 und Tabelle 4.4.6 sind die Parameter und die Statistik

der für DHPH aufgenommenen Datensätze zusammengefasst.

Durch die Analyse des Matthews-Parameters und des Lösungsmittelgehaltes (Tabelle 4.4.4)

konnte nicht geklärt werden, wie viele Monomere sich in der ASU befinden. Auf Grund der

Tatsache, dass DHPH als Dimer vorliegt, wurden zunächst 4 oder 6 Monomere pro ASU

vermutet.

Tabelle 4.4.4

Monomere/ASU

Mögliche Zusammensetzung der ASU

Matthews-Parameter

[Å 3 Da -1 ]

Lösungsmittelgehalt

[%]

3 4.0 69

4 3.0 59

5 2.4 49

6 2.0 39

Auch die Betrachtung der stereographischen Projektionen der Selbstrotationsfunktionen

(Abbildung 4.4.5) half bei der Frage nach der Anzahl der Monomere nicht weiter, so dass erst

die Phasierung der Daten Klärung brachte. Die Analyse der Selbstrotationsfunktionen deutet

aber auf eine lokale zweizählige Achse hin. Die unvermutet geringe Anzahl von nur drei

Monomeren pro ASU und der damit verbundene hohe Lösungsmittelanteil von 69% sowie der

194


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

sehr hohe Wilson-B-Faktor von 66 Å 2 erklären die geringe Auflösung. Zudem sind die

Kristalle durch das vermutliche Vorhandensein von heterogenem Apo-Holo-Protein

(Abschnitt 4.4.1) nicht perfekt, was zu einer Einbuße an Auflösung führt.

Abbildung 4.4.5

Stereographische Darstellung der Selbstrotationsfunktion von DHPH bei κ=180°

Die Suche wurde bei einem Suchradius von 40 Å und 5 Å Auflösung durchgeführt. Die

Konturlinien beginnen bei einer Signalhöhe von 6 σ und haben eine Schrittweite von

0.5 σ.

Tabelle 4.4.5

Parameter und Statistiken der Datensätze für DHPH

nativ

SeMet

DHPH (C323S) peak inflection high remote

beamline PX10 PX06

Wellenlänge λ [Å] 1.0008 0.9795 0.9797 0.9078

Detektor MarCCD MarCCD

Raumgruppe P3 2 21 P3 2 21

Zellparameter a, b, c [Å] 185.96, 185.96, 104.76 186.33, 186.33, 105.14

Auflösungsbereich [Å] a 20 - 2.6 (2.8 - 2.6) 20 - 3.1 (3.2 - 3.1)

Anzahl unabhängiger Reflexe a 64088 (12645) 74026 (6697) 74023 (6696) 74026 (6697)

Vollständigkeit [%] a 99.7 (99.5) 99.9 (100) 99.9 (100) 99.9 (100)

Multiplizität a 4.9 (3.6) 5.8 (5.8) 5.8 (5.8) 5.8 (5.8)

R sym-I [%] a 6.6 (50.7) 8.3 (58.8) 8.6 (64.6) 9.5 (76.1)

R merge-I [%] a 10.3 (73.6) 9.1 (64.6) 9.7 (71.0) 14.1 (69.9)

I/σ a 15.0 (2.4) 16.5 (2.9) 17.8 (2.6) 18.3 (2.2)

Wilson B-Faktor [Å 2 ] 66.3 70.0 69.7 69.7

Anzahl Monomere/ASU 3 3

Matthews-Parameter [Å 3 Da -1 ] 4.0 4.1

Lösungsmittelgehalt [%] 69 70

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale

195


4 Ergebnisse und Diskussion

Tabelle 4.4.6 Parameter und Statistiken der Datensätze für DHPH mit Substrat/Inhibitor

2,6-Dihydroxypyridin 2,3-Dihydroxypyridin 2,6-Dimethoxypyridin

beamline PX10 PX10 PX10

Wellenlänge λ [Å] 0.9993 0.9993 0.9993

Detektor MarCCD MarCCD MarCCD

Raumgruppe P3 2 21 P3 2 21 P3 2 21

Zellparameter a, b, c [Å] 185.87, 185.87, 105.48 185.68, 185.68, 104.80 185.88, 185.88, 104.36

Auflösungsbereich [Å] a 30 - 2.9 (3.0 - 2.9) 30 - 3.0 (3.2 - 3.0) 30 - 3.2 (3.4 - 3.2)

Anzahl unabhängiger Reflexe a 43613 (4271) 41861 (7269) 32391 (5455)

Vollständigkeit [%] a 93.3 (95.0) 99.9 (100) 93.7 (96)

Multiplizität a 8.0 (8.0) 7.4 (7.6) 7.6 (7.6)

R sym-I [%] a 7.6 (43.6) 10.9 (48.1) 15.8 (52.1)

R merge-I [%] 9.0 (42.0) 12.2 (48.8) 10.2 (26.8)

I/σ a 19.2 (4.2) 13.4 (4.6) 9.5 (4.1)

Wilson B-Faktor [Å 2 ] 66.2 66.8 58.7

Anzahl Monomere/ASU 3 3 3

Matthews-Parameter [Å 3 Da -1 ] 4.0 4.0 4.0

Lösungsmittelgehalt [%] 70 69 69

a Werte in Klammern beziehen sich auf die letzte Auflösungsschale

4.4.6 Strukturlösung

Die Suche nach Selenpositionen wurde mittels autoSHARP anhand des MAD-Datensatzes

mit den drei Wellenlängen peak, inflection und high remote durchgeführt. Sämtliche

Datensätze wurden auf den peak-Datensatz skaliert. Die Schwermetallsuche ergab 19

Positionen (Tabelle 4.4.8). Die Verfeinerung der Phasen durch SHARP (Tabelle 4.4.7) sowie

die folgende Dichtemodifikation mittels DM und SOLOMON, wie sie in autoSHARP

implementiert sind, ergab eine relativ gut interpretierbare Dichte, die allerdings für den

Modellbau noch nicht ausreichte. Jedoch konnten eindeutig 3 Monomere pro asymmetrische

Einheit identifiziert werden. Unter diesem Gesichtspunkt wurden die durch SHARP

gefundenen Schwermetallpositionen manuell mittels COOT analysiert und den drei

Monomeren zugeordnet (Tabelle 4.4.8). Die letzte Position, die sich nicht zuordnen ließ,

wurde entfernt. Die dann vorhandenen 18 Positionen entsprechen den 7 theoretisch

vorliegenden Methioninen in DHPH unter der Annahme, dass das N-terminale Methionin

ungeordnet und daher nicht sichtbar ist.

Die initialen Phasen wurden mittels phase extension auf den nativen Datensatz, der eine

deutlich bessere Auflösung aufwies, übertragen. Dazu wurden sämtliche Datensätze auf den

196


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

nativen Datensatz skaliert, die 18 gefundenen Selenpositionen mittels SHARP verfeinert, die

Phasen mit SHARP auf den nativen Datensatz übertragen und auf die maximale Auflösung

von 2.6 Å erweitert. Tabelle 4.4.9 zeigt die Phasierungsstatistik für den zweiten SHARP-Lauf,

die eine deutliche Verbesserung im Vergleich zum ersten aufweist (Tabelle 4.4.7).

Tabelle 4.4.7 Phasierungsstatistik des ersten SHARP-Laufs

Datensatz peak inflection* high remote*

Auflösungsbereich 20 – 3.1

phasing power

isomorph-zentrisch

isomorph-azentrisch

anomal-azentrisch

R cullis

isomorph-zentrisch

isomorph-azentrisch

anomal-azentrisch

0.000

0.000

0.615

0.000

0.000

0.896

0.214

0.239

0.258

0.888

0.849

0.984

FOM

zentrisch

0.246

azentrisch

0.292

* Datensätze wurden auf den peak-Datensatz skaliert

0.622

0.578

0.399

0.823

0.794

0.972

Tabelle 4.4.8 Selen-Positionen für DHPH

nach 1. SHARP-Lauf Monomer AS-Position nach 2. SHARP-Lauf

1 0.52566 0.59802 0.51633 A 237 0.52053 0.59043 0.52005

2 0.53091 0.83131 0.29557 B 237 0.53457 0.83312 0.30014

3 0.50286 0.79926 0.50717 B 364 0.50778 0.80317 0.50935

4 0.58845 0.65084 0.28266 A 296 0.58243 0.64395 0.28160

5 0.46396 0.81699 0.53433 B 75 0.46902 0.81931 0.53518

6 0.53274 0.69917 0.38560 A 364 0.52660 0.68995 0.39183

7 0.55868 0.53750 0.27839 A 132 0.55259 0.53078 0.27619

8 0.47660 0.69220 0.37984 A 75 0.47273 0.68773 0.38796

9 0.66817 0.88561 0.20766 C 237 0.67284 0.88977 0.21329

10 0.51058 0.79793 0.09528 C 132 0.50375 0.78580 0.09469

11 0.50483 0.59835 0.20104 A 23 0.49973 0.59268 0.19924

12 0.58490 0.75740 0.06870 C 296 0.57860 0.74833 0.07097

13 0.73588 0.85610 0.00258 C 75 0.73952 0.86010 0.00213

14 0.70061 0.95321 0.40135 B 132 0.70388 0.95435 0.40285

15 0.63111 0.86414 0.50911 B 296 0.63230 0.86443 0.51293

16 0.69663 0.81387 0.05484 C 364 0.70216 0.81930 0.06590

17 0.63410 0.94657 0.55853 B 23 0.63841 0.94870 0.56339

18 0.57613 0.79901 0.05956 C 23 0.56646 0.79102 -0.05552

19 0.20063 0.69579 0.58764 - -

197


4 Ergebnisse und Diskussion

Tabelle 4.4.9

Phasierungsstatistik des zweiten SHARP-Laufs

Datensatz peak* inflection* high remote*

Auflösungsbereich 20 - 2.6

phasing power

isomorph -zentrisch

isomorph-azentrisch

anomal-azentrisch

R cullis

isomorph -zentrisch

isomorph-azentrisch

anomal-azentrisch

3.384

4.601

1.680

0.217

0.178

0.668

3.347

4.976

0.964

0.198

0.148

0.900

FOM

zentrisch

0.279

azentrisch

0.324

* Datensätze wurden auf den nativen Datensatz skaliert

2.810

3.751

0.268

0.325

0.270

0.945

Die folgende Dichtemodifikation mittels SOLOMON und DM führte bereits zu einer guten

Elektronendichte, die jedoch für einen automatischen Modellbau mit ARP/wARP nicht

ausreichte (Abbildung 4.4.6 A und B). Daher wurde die Dichte mit Hilfe von RESOLVE

weiter verbessert, und auch Teile des Proteinrückgrats konnten mit diesem Programm erstellt

werden (Abbildung 4.4.6 C). Letztlich wurde aber das gesamte Modell manuell in COOT neu

gebaut. Die Zuordnung der Aminosäuresequenz war über die Selenomethioninpositionen sehr

gut möglich. Das Modell wurde mit PHENIX Autobuild Wizard neu gebaut und mit REFMAC

weiter verfeinert. Dabei wurden für die Ketten B und C NCS-restraints eingeführt. Die drei

FAD-Moleküle wurden in COOT manuell an die entsprechenden Positionen gebaut und mit

dem restlichen Molekül verfeinert. Wassermoleküle wurden mit COOT an sinnvollen

Positionen in die verbliebene positive Referenzdichte gesetzt und manuell überprüft. Ebenso

wurden drei Acetat- und 3 Glycerinmoleküle manuell mit COOT eingefügt. In den letzten

Zyklen der Verfeinerung wurde außerdem eine TLS-Verfeinerung mit den drei Ketten

inklusive der FAD-Cofaktoren als individuelle TLS-Gruppen (Abbildung 4.4.6 D)

durchgeführt. Das fertige Modell enthält die Aminosäurereste 2 - 388 der Ketten B und C

sowie 2 - 394 der Kette A, drei FAD-Moleküle sowie Wasser und Moleküle der

Kristallisationsbedingung (Abbildung 4.4.11).

Um den Einfluss der Mutation C323S zu untersuchen, wurde eine rigid body-Verfeinerung

mittels REFMAC mit dem Modell (ohne Wasser, Glycerin und Acetat) und den Daten des

Selenomethionin-substituierten Proteins, das keine Mutation enthält, durchgeführt. Das

198


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

erhaltene Modell wurde weiterhin durch eine TLS-Verfeinerung mittel REFMAC verbessert

und die Elektronendichte mittels einer (2Fo-Fc)-map und einer (Fo-Fc)-map analysiert. Dabei

zeigten sich weder lokale noch globale Änderungen in der Proteinstruktur, so dass das Modell

für DHPH (C323S) auch für das native Protein gilt.

A

B

C

D

Abbildung 4.4.6

Darstellung der Elektronendichte mit einem Ausschnitt des verfeinerten Strukturmodells

von DHPH im Bereich der Aminosäurereste 189 - 195

A. nach SHARP

B. nach density modification mittels autoSHARP

C. nach RESOLVE

D. nach TLS-Verfeinerung mittel REFMAC

Die Elektronendichte ist jeweils bis zu einer maximalen Auflösung von 2.6 Å bei einem

Konturniveau von 1.5 σ dargestellt.

Die Datensätze für die substrat- oder inhibitorhaltigen Kristalle wurden mittels XDS und

XSCALE prozessiert. Die Phasen stammen aus einer rigid body-Verfeinerung mittels

REFMAC. Dazu wurde das Modell für DHPH mit FAD, aber ohne weitere

Nichtproteinmoleküle verwendet. Zur Beseitigung des model bias wurde anschließend für

jedes Modell ein simulated annealing mit CNS durchgeführt. Die Modelle wurden mittels

REFMAC unter Anwendung von NCS-restraints für alle drei Proteinketten und manuellem

199


4 Ergebnisse und Diskussion

Bau in COOT verfeinert. Wassermoleküle wurden mit COOT gebaut. Die Modelle wurden

abschließend mit einer TLS-Verfeinerung mit REFMAC verbessert (Tabelle 4.4.11). Die

Elektronendichte im aktiven Zentrum wurde durch eine (2Fo-Fc)-map und eine (Fo-Fc)-map

analysiert. Zum Vergleich der gefundenen Dichte wurde mit dem Datensatz des substratfreien

Kristalls ebenso verfahren. Dabei konnte in keinem Fall genügend Elektronendichte für den

Bau der Substrate bzw. Inhibitoren gefunden werden, sondern die Elektronendichte entsprach

in etwa der Dichte, wie sie für das Glycerin in der substratfreien Struktur im aktiven Zentrum

gefunden wird. Abbildung 4.4.7 zeigt die Elektronendichten der aktiven Zentren nach der

TLS-Verfeinerung für alle vier Datensätze im Vergleich.

A

B

C

D

Abbildung 4.4.7

Darstellung der Elektronendichte im aktiven Zentrum von DHPH

Die Elektronendichte der (2Fo-Fc)-map (blau) ist bei einem Konturniveau von 1.5 σ

dargestellt, die der (Fo-Fc)-map bei 3 σ (grün) und -3 σ (rot). Einige Aminosäurereste im

aktiven Zentrum, FAD und Glycerin sind als ball-and-stick-Modell dargestellt. Das jeweils

zur Kokristallisation verwendete Molekül ist grau eingezeichnet.

A. ohne Zusätze, die maximale Auflösung beträgt 2.6 Å.

B. mit 2,6-DHP, die maximale Auflösung beträgt 2.9 Å.

C. mit 2,3-DHP, die maximale Auflösung beträgt 3.0 Å.

D. mit 2,6-DMP, die maximale Auflösung beträgt 3.2 Å.

200


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Die misslungenen Tränkversuche sind vermutlich darauf zurückzuführen, dass für den Eintritt

des Substrates ins aktive Zentrum eine Bewegung des Enzyms notwendig ist, die im Kristall

nicht möglich ist (Abschnitt 4.4.9). Das Scheitern der Kokristallisationsversuche könnte

darauf zurückzuführen sein, dass das Enzym mit gebundenem Substrat eine leicht andere

Konformation aufweist, die nicht mehr kristallisiert. Eventuell ist aber auch die Auflösung

einfach nicht ausreichend, um die Dichte eines Glycerinmoleküls von der des Substrates oder

Inhibitors zu unterscheiden.

Qualität des Modells

Die Qualität des Strukturmodells für DHPH wurde während der Verfeinerung anhand der

R-Faktoren sowie der Abweichung von geometrischen Daten validiert (Abschnitt 3.5.7). Die

Qualitätskriterien und ihre Werte für DHPH sind in Tabelle 4.4.10 gegeben.

Abbildung 4.4.8

Ramachandran-Diagramme für das Modell von DHPH

Glycinreste sind durch Kreuze, Proline durch Dreiecke und alle anderen Aminosäurereste

durch Quadrate eingezeichnet. Reste, die im energetisch günstigen Bereich liegen, sind

schwarz und Reste, die im erlaubten Bereich liegen, sind orange gekennzeichnet. Die

Farbgebung des Hintergrundes ist so gestaltet, dass der dunkelste Farbton den energetisch

günstigen Bereich markiert.

A. Ramachandran-Diagramm aller Aminosäurereste

B. Ramachandran-Diagramm der Glycine

C. Ramachandran-Diagramm für Aminosäurereste, die direkt vor Prolin liegen

D. Ramachandran-Diagramm für Proline

201


4 Ergebnisse und Diskussion

Die Struktur wies gute R-Faktoren auf und zeigte auch nur geringe Abweichungen von

Standardbindungslängen und -winkeln. Die Werte aller dihedraler Hauptkettentorsionswinkel

φ und ψ befinden sich in erlaubten Bereichen des Ramachandran-Diagramms (Abbildung

4.4.8) und sogar zu fast 96% im energetisch günstigen Bereich. Weiterhin befanden sich alle

Ergebnisse der mit dem BIOTECH-Server durchgeführten Analysen innerhalb gängiger

Toleranzgrenzen.

Tabelle 4.4.10

Verfeinerungsstatistik von DHPH (C323S)

Parameter

Auflösungsbereich [Å] 20 - 2.6

Anzahl unabhängiger Reflexe 64088

Zahl der Reflexe im test set 3204

R cryst [%] 18.5

R free [%] 22.2

strukturierte Bereiche

Kette A

Kette B/C

Anzahl von Nichtproteinmolekülen

FAD

Wasser

Glycerin

Acetat

rms-Abweichung

Bindungslänge [Å]

Bindungswinkel [°]

Mittlere B-Faktoren [Å 2 ] (Kette A/B/C)

Hauptkettenatome

Seitenkettenatome

FAD (Kette A/B/C)

Wasser

Acetat

Glycerin

Ramachandran-Torsionswinkel

energetisch günstiger Bereich [%]

erlaubter Bereich [%]

verbotener Bereich [%]

TLS-Gruppen

Kette A

Kette B/C

DHPH (C323S)

2 - 394

2 - 388

3

388

3

3

0.013

1.51

67.0/ 66.5/ 66.5

67.9/ 67.2/ 67.1

67.8/ 69.9/ 69.0

65.5

95.1

77.4

95.9

4.1

0.0

2 - 394

2 - 388

202


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Auch die Datensätze aus Kokristallisationsversuchen zeigten weitgehend gute

Qualitätskriterien (Tabelle 4.4.11). Diese Daten und die daraus gewonnen Modelle wurden

jedoch nicht abschließend verfeinert, nachdem sich zeigte, dass keine neuen Informationen

enthalten waren. Insbesondere wies das Modell des Datensatzes aus der Kokristallisation mit

2,6-DMP zwei Aminosäurereste pro Monomer auf, deren dihedrale Hauptkettentorsionswinkel

φ und ψ sich nicht in erlaubten Bereichen des Ramachandran-Diagramms befinden.

Dabei handelt es sich jeweils um die Aminosäurereste Gly43 und Phe44, die sich auch im

2.6 Å-Modell in einem hochflexiblen, schlecht definierten Bereich befinden.

Tabelle 4.4.11

Verfeinerungsstatistik der Datensätze aus Kokristallisationsversuchen

Parameter DHPH (C323S) + 2,6-DHP + 2,3-DHP + 2,6-DMP

Auflösungsbereich [Å] 30 - 2.9 30 - 3.0 30 - 3.2

Anzahl unabhängiger Reflexe 43613 41861 32391

Zahl der Reflexe im test set 2181 2093 1620

R cryst (%) 20.7 20.2 19.5

R free (%) 24.6 23.1 23.9

strukturierte Bereiche

Kette A

Kette B

Kette C

Anzahl von Nichtproteinmolekülen

FAD

Wasser

rms-Abweichung

Bindungslänge [Å]

Bindungswinkel [°]

Mittlere B-Faktoren [Å 2 ] (Kette A/B/C)

Hauptkettenatome

Seitenkettenatome

FAD (Kette A/B/C)

Ramachandran-Torsionswinkel

energetisch günstiger Bereich [%]

erlaubter Bereich [%]

verbotener Bereich [%]

2-394

2-388

2-388

3

49

0.012

1.318

79/ 77/ 77

78/ 78/ 78

89/ 87/ 89

95.2

4.8

0.0

2-393

2-387

2-389

3

38

0.012

1.439

79/ 77/ 77

78/ 78/ 78

83/ 91/ 83

94.3

5.7

0.0

2-394

2-388

2-388

3

108

0.011

1.373

86/ 85/ 85

86/ 86/ 86

87/ 86/ 90

94.5

5.0

0.5 *

TLS-Gruppen (KetteA/B/C) 2-388 + FAD 2-388 + FAD 2-388 + FAD

* dabei handelt es sich um Gly43 und Phe44 aller drei Ketten

203


4 Ergebnisse und Diskussion

Analyse der Temperaturfaktoren

Die B-Faktoren von DHPH sind insgesamt sehr hoch und stimmen im Mittel gut mit dem

Wilson-B-Faktor von 66 Å 2 überein. Abbildung 4.4.9 zeigt den Verlauf der B-Faktoren

entlang der Hauptkette für die drei Monomere der asymmetrischen Einheit.

100

Kette A (ohne NCS, kristallographisch)

Kette B (mit NCS)

Kette C (mit NCS)

90

B-Faktor [Å 2 ]

80

70

60

β

α

50A

B

C

1 2 3 4 5 6 7 8 9 10/11 12 13/14 15 16 17 18/19

1 2 3 4 5 6 7 8 9 10

0 100 200 300

Sequenzposition

Abbildung 4.4.9

Darstellung der B-Faktoren des DHPH-Modells

Die B-Faktoren der Monomere A (schwarz), B (grau) und C (hellgrau) wurden gegen die

Sequenzposition aufgetragen. Zusätzlich sind die zugehörigen Sekundärstrukturelemente

des Modells wie in Abbildung 4.4.10 gezeigt sowie die Aminosäurereste, die in Kontakte

involviert sind.

Auffällig sind die beiden Maxima besonders der A-Kette im Bereich der Aminosäurereste

35-49 sowie 208-218. Beide Bereiche sind zumindest teilweise in Kristallkontakte involviert.

Vermutlich handelt es sich um Bereiche des Proteins, die eine hohe Flexibilität aufweisen.

Insgesamt treten in den beiden Ketten B und C weniger starke Abweichungen auf, was

vermutlich auf die Anwendung von NCS-restraints während der Verfeinerung

zurückzuführen ist. Die Ketten zeigen aber einen ähnlichen Verlauf der B-Faktoren, nur mit

geringerer Ausprägung von Minima und Maxima.

204


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

4.4.7 Strukturbeschreibung

Sekundärstruktur

Die Analyse der Sekundärstruktur von DHPH wurde mit Hilfe der Programme DSSP und

STRIDE vorgenommen und manuell überprüft. Die endgültige Zuordnung ist in Abbildung

4.4.10 zu sehen. Da die einzelnen Monomere keine gravierenden Unterschiede aufweisen,

wurde lediglich eine Kette dargestellt. Auf die Nummerierung von 3 10 -Helices wurde

verzichtet. Das Modell enthält 10 α-Helices, 4 3 10 -Helices und 19 β-Stränge.

. . . . . . . 80

ASS mSPTTDRIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLLEQGVELDSISVPSSSMEYVDA

STRIDE EEEEE HHHHHHHHHHHHH EEEEE TTTT TTTTEEE 333HHHHHHH 333 EEEEEET

DSSP EEEEE HHHHHHHHHHHHTT EEEEE EEE HHHHHHHHHTT 333T EEEEEET


β1 α1 β2 β3 α2 β4

. . . . . . . 160

ASS LTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVVRKRLL

STRIDE TTT EEEEEE EEEHHHHHHHHHHHH TTTEETTT EEEEEEETTEEEEEETTT EEEETEEEE TTTTHHHHHHH

DSSP TT EEEEEE EEEHHHHHHHHHHHH TTEE EEEEEE EEEEETT EEEE EEEE TT HHHHHHH


β5 β6 α3 β7 β8 β9 β10 β11 α4

. . . . . . . 240

ASS GIEPTYAGYVTWRGVLQPGEVADDVWNYFNDKFTYGLLDDGHLIAYPIPGRENAESPRLNFQWYWNVAEGPDLDELMTDV

STRIDE EEEEEEEEEEEETTTTTTHHHHHHHTTEEEEEEETTEEEEEEEE TTTTTT EEEEEEEEE HHHHHHH T

DSSP EEEEEEEEEEEE TT HHHHHHHTTEEEEEEETTEEEEEEEE TT EEEEEEEEE TTHHHHHHT T


β12 α5 β13 β14 β15 α6

. . . . . . . 320

ASS RGIRLPTSVHNNSLNPHNLRQFHSKGESLFKPFRDLVLNASSPFVTVVADATVDRMVHGRVLLIGDAAVTPRPHAAAGGA

STRIDE TT TTTEE 333 HHHHHHHHHHHH HHHHHHHHHTTTTEEEEEEE EETTEEE 333TT TTTTHHHH

DSSP T EE 333 HHHHHHHHHHHTT HHHHHHHHH EEEEEEE EETTEEE 333T TT HHH


β16 α7 α8 β17 β18 β19

. . . . . . . 400

ASS KASDDARTLAEVFTKNHDLRGSLQSWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVDEPSVVtns

STRIDE HHHHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH TTTT333

DSSP HHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT TT 333


α9

α10

Abbildung 4.4.10 Zuordnung der Sekundärstrukturelemente der A-Kette für DHPH

ASS gibt die Aminosäuresequenz an, die darauffolgenden Zeilen die Ergebnisse der

Programme DSSP und STRIDE (H = α-Helix, E = β-Strang, T = turn, 3 = 3 10 -Helix). Die

letzten beiden Zeilen enthalten die Zuordnung zu den Sekundärstrukturelementen und ihre

Nummerierung. Aminosäurereste, die in der Struktur fehlen, sind als Kleinbuchstaben

angegeben. Die oberste Zeile liefert die Sequenznummer. Die Farbgebung der

Sekundärstrukturelemente entspricht den drei Domänen in Abbildung 4.4.11.

205


4 Ergebnisse und Diskussion

Tertiärstruktur

DHPH besteht aus drei Domänen, zwischen denen die Proteinkette mehrfach hin und her

wechselt. Bei der ersten Domäne handelt es sich um eine FAD-Bindedomäne mit der

typischen Rossmann-Faltung. An ihr sind die Aminosäurereste 2-68, 98-164 sowie 290-338

beteiligt. Sie besteht aus einem fünfsträngigen, parallelen β-Faltblatt (β1, β2, β7, β11 und

β19) sowie einem antiparallelen β-Mäander aus den β-Strängen β8, β9 und β10, die

gemeinsam ein β-Sandwich bilden. Mehrere α-Helices (α1, α2, α3, α4 und α9) packen gegen

eine Seite des fünfsträngigen β-Faltblatts. Die zweite Domäne, die aus den Aminosäureresten

165-289 gebildet wird und auch die Substratbindungsstelle beinhaltet (Abschnitt 4.4.9),

besteht aus einem sechssträngigen antiparallelen β-Faltblatt (β12, β13, β14, β15, β16 und

β17), das von vier α-Helices (α5, α6, α7 und α8) flankiert wird. Die Segmente 69-97 sowie

339-388 bilden die Verbindung der beiden Domänen. Dabei trägt das Segment 69-97 zwei

weitere Stränge zum sechssträngigen Faltblatt der DHP-Bindedomäne bei (β4 und β5),

während das zweite Segment eine lange α-Helix (α10) bildet. Im Interface zwischen der

FAD-Bindedomäne und der DHP-Bindedomäne befindet sich das aktive Zentrum mit dem

Isoalloxazinring des FAD. Abbildung 4.4.11 zeigt das Strukturmodell für ein DHPH-

Monomer.

Abbildung 4.4.11

Stereodarstellung des Bändermodells eines DHPH-Monomers

Bändermodell eines DHPH-Monomers (AS 2-388) mit Blick auf die si-Seite des Flavins.

Die FAD-Bindedomäne ist blau, die DHP-Bindedomäne rot und die verbindenden

Segmente sind grün dargestellt. Die mobilen Segmente 35-49 und 208-218 sind pink. Die

Sekundärstrukturelemente sind gemäß Abbildung 4.4.10 beschriftet und das FAD-

Molekül ist als ball-and-stick gezeigt. Die zweizählige Symmetrieachse ist eingezeichnet.

206


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

Quartärstruktur und Kristallpackung

Die asymmetrische Einheit beinhaltet drei Monomere (A, B und C). Die einzelnen Ketten

zeigen wenig Abweichung voneinander, mit maximalen ∆C α von 1 Å. Dies gilt insbesondere

für die Ketten B und C, für die während der Verfeinerung NCS-restraints angewendet worden

waren (rmsd A-B 0.26 Å, rmsd A-C 0.26 Å sowie rmsd B-C 0.05 Å).

Die Monomere B und C bilden über Kontakte mit Resten zweier Domänen ein Dimer. Die

A-Kette bildet die entsprechenden Kontakte mit einem Symmetrieverwandten aus (Tabelle

4.4.12). Die Struktur ist relativ offen mit einem großen zentralen Tunnel entlang der

zweizähligen Achse. Das Interface des Dimers verteilt sich auf zwei kleinere Kontaktflächen,

die insgesamt ca. 900 Å 2 aufweisen und damit einer durchschnittlichen Proteinkontaktfläche

[5] entsprechen. Der dimere Zustand im Kristall stimmt unter Berücksichtigung der offenen

Struktur mit dem großen Tunnel mit den Ergebnissen der Gelpermeationschromatographie

(Abbildung 4.4.3) und mit der Literatur [95] überein. Abbildung 4.4.12 zeigt das

Bändermodell für ein DHPH-Dimer.

Neben den Dimerkontakten bildet DHPH nur wenige, kleine Kristallkontakte aus (Tabelle

4.4.12). Die Kristallpackung von DHPH ist in Abbildung 4.4.13 gezeigt. Insgesamt sind die

Kristallkontakte so klein, dass durch sie keine Veränderung der nativen Struktur zu erwarten

ist.

Abbildung 4.4.12

Stereodarstellung des Bändermodell des DHPH-Dimers

Ausrichtung und Farbgebung entsprechen Abbildung 4.4.11. Die zweizählige

Symmetrieachse ist schwarz eingezeichnet. Die vorgeschlagene NADH-Bindestelle ist als

roter Strich mit Markierung des Nikotinamidendes (n) und des Adeninendes (a)

eingezeichnet (Abschnitt 4.4.9). Der potentielle Substratzugang (e) ist als hellblauer Strich

dargestellt (Abschnitt 4.4.9).

207


4 Ergebnisse und Diskussion

Tabelle 4.4.12 Kristallkontakte von DHPH

Kontakt

Symmetrieoperation

Größe

beteiligte Aminosäurereste

[Å 2 ] Kette 1 Kette 2

I* C-E x, y, z 911 36, 119, 121-122, 133-137,

157-158, 231, 234-235,

238-244, 255-257, 260

II* A-A y, x, -z+1 890 36, 119, 121-122, 133-137,

157-158, 231, 234-235,

238-244, 255-257, 260

III B-A x, y, z 357 199-200, 229, 312, 362,

366-367, 370-373, 378

IV B-A -y+1, x-y+1, z-1/3 357 179-180, 256-257, 260,

263-264, 267, 274- 275,

278-279, 281

V C-C x-y+1, -y+2, -z+ 1/3 365 179-180, 256-257, 260,

263-264, 267, 274-275,

278-279, 281

36, 119, 121-122, 133-137,

139, 157-158, 231, 234-235,

238-244, 255-257, 260

36, 119, 121-122, 133-137,

157-158, 231, 234-235,

238-244, 255-257, 260

79, 84-90, 367, 373, 375-

377, 379

179-180, 256-257, 260,

263-264, 267, 271, 274-275,

278-279, 281

179-180, 256-257, 260,

263-264, 267, 274-275,

278-279, 281

VI C-B x-y+1, -y+2, -z+ 1/3 259 177-181, 183, 213-216 7, 32, 112-113, 115, 118,

131, 137-141

VII A-B -x+1, -x+y, -z+2/3 250 7, 32, 112-113, 115, 118,

131, 137-140

VIII C-A -y+1, x-y+1, z-1/3 249 7, 32, 112-113, 115, 118,

137-140

IX C-A x, y, z 224 125, 159-160, 162, 293-295,

298-299

177-180, 183, 213-216

177-180, 213-216

387, 390-393

*) Die Kontakte I und II entsprechen den Dimerkontaktflächen

Abbildung 4.4.13

Stereodarstellung der Kristallpackung von DHPH

Das Dimer B-C sowie seine Symmetrieverwandten sind in blau-grün und das

kristallographische Dimer A-A sowie seine Symmetrieverwandten in orange gehalten.

208


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

4.4.8 Vergleich mit strukturverwandten Proteinen

Anhand von Sequenzvergleichen war bereits eine Zuordnung von DHPH zu den externen

Flavin-Monooxygenasen vorgeschlagen worden [95]. Diese Zuordnung wurde bei einer

Homologiesuche mittels DALI bestätigt. Es wurden eine ganze Reihe von Monooxygenasen

gefunden, die alle FAD als Cofaktor nutzen. Um sicherzugehen, dass keine struktur- oder

sequenzverwandten Proteine übersehen wurden, wurden BLAST-Suchen gegen die RCSB-

Datenbank mit den Aminosäuresequenzen von DHPH sowie den beiden besten

Strukturhomologen Phenolhydroxylase (PH) und p-Hydroxybenzoat-3-Hydroxylase (PHBH)

durchgeführt. Dabei fanden sich keine Homologen für DHPH und nur drei schwache Treffer

für PHBH (CabE, RebC und PgaE). Die Suche nach Sequenzhomologen für PH ergab

dagegen vier stark verwandte Proteine, die m-Hydroxybenzoat-4-Hydroxylase (MHBH),

CabE, PgaE und RebC. Mit deren Sequenzen wurde die RCSB-Datenbank wiederum nach

Sequenzhomologen durchsucht, wobei keine weiteren Proteine identifiziert wurden. Die

Strukturhomologie der neu gefundenen Proteine zu DHPH wurde mittels DALIlite bestimmt.

Alle Z-Scores weisen die Proteine als gute Strukturverwandte aus. Tabelle 4.4.13 listet alle

Strukturhomologen mit einem Z-Score über 15 auf.

Tabelle 4.4.13 Strukturhomologe von DHPH

Protein Organismus pdbcode

Z-score

(DALI)

Identität

[%]

rmsd

[Å]

Reste

aligned

p-Hydroxybenzoat-3-Hydroxylase P. fluorescens 1pbe 32.0 9 1.6 242

Phenol-2-Monooxygenase T. cutaneum 1pn0 31.4 7 1.7 253

PgaE S. species 2qa1 25.0 10 1.5 221

Tryptophan-7-Halogenase P. fluorescens 2apg 24.7 7 2.0 202

CabE S. species 2qa2 23.8 11 1.4 208

RebC L. aerocolonigenes 2r0c 22.8 9 1.8 205

m-Hydroxybenzoat-4-Hydroxylase C. testosteroni 2dkh 21.1 7 1.7 239

Monooxygenasedomäne von MICAL M. musculus 2bry 20.8 7 1.7 194

Elektronentransferflavoprotein- S. scrofa 2gmj 20.8 7 2.0 202

Ubichinon-Oxidoreduktase

L-Aminosäure-Oxidase R. opacus 2jae 17.5 6 1.7 131

Sarcosinoxidase B. sphaericus 1el5 17.3 10 2.0 162

Glycinoxidase B. subtilis 1ng3 17.1 6 1.9 140

N,N-Dimethylglycinoxidase A. globiformis 1pj5 16.8 6 1.9 159

Protoporphyrinogenoxidase N. tabacum 1sez 15.7 5 1.8 135

209


4 Ergebnisse und Diskussion

Die Strukturmodelle der homologen Proteine wurden mit LSQMAN mit dem DHPH-Modell

überlagert. Tabelle 4.4.13 gibt die mittleren Abweichungen (rmsd-Werte) und die Anzahl der

mit DHPH überlagerten Aminosäurereste an. Die Sequenzidentität wurde mit CLUSTAL W

bestimmt. Trotz der großen Ähnlichkeit in der Struktur weisen die Proteine nur eine geringe

Sequenzidentität auf (Tabelle 4.4.13). Die strukturell am engsten verwandten Proteine sind

die p-Hydroxybenzoat-3-Hydroxylase (PHBH) und die Phenolhydroxylase (PH) mit Z-Scores

von über 30. Tryptophan-7-Halogenase weist zwar eine sehr ähnliche Proteinfaltung auf,

katalysiert aber eine deutlich andere Reaktion und ist deshalb bei der weiteren Analyse nicht

berücksichtigt. PgaE, CabE, RebC und m-Hydroxybenzoat-4-Hydroxylase (MHBH) zeigen

ebenfalls gute Strukturhomologie und sind als aromatische Flavin-Monooxygenasen auch

funktionell verwandt (s.u.).

Um die Verwandtschaft und die Homologie der Proteine untereinander zu klären, wurden die

Strukturen der aromatischen Flavin-Monooxygenasen mittels LSQMAN aufeinander

überlagert und die Primärsequenzen mit CLUSTAL W verglichen. Der Anteil der strukturell

konservierten Aminosäurereste ist Tabelle 4.4.14 (grau hinterlegt) zu entnehmen. Die

Sequenzverwandtschaft ist ebenfalls angegeben. Dabei ist die Sequenzidentität zwischen PH,

RebC, PgaE, CabE und MHBH untereinander deutlich höher als zu DHPH und PHBH, die

praktisch keine Sequenzidentität zu einem der anderen Proteine aufweisen. Dieses Ergebnis

stimmt mit dem Ergebnis der BLAST-Suche in der RCSB-Datenbank überein.

Tabelle 4.4.14

Sequenzidentität zwischen den Strukturverwandten von DHPH

2 DHPH PHBH PH PgaE CabE RebC MHBH

1

DHPH * 397 9 7 10 11 9 7

PHBH * 242/21 394 8 12 11 11 10

PH ** 248/18 291/21 665 14 15 14 31

PgaE * 221/22 276/23 312/31 476 68 21 17

CabE * 210/23 250/23 311/29 463/71 474 21 18

RebC * 205/22 235/22 256/31 306/33 229/48 529 18

MHBH * 239/16 260/22 498/40 303/33 293/32 155/30 639

1) Anzahl der mittels LSQMAN überlagerten Aminosäurereste/ [%] der dabei identischen Aminosäurereste

(grau hinterlegt)

2) Sequenzidentität nach Alignment mit CLUSTAL W in [%]

*

Kette A, ** Kette C

210


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

p-Hydroxybenzoat-3-Hydroxylase (PHBH) ist ein Enzym des β-Ketoadipinsäure-Abbauwegs,

durch den einige Bodenbakterien in der Lage sind, aromatische Verbindungen abzubauen, die

durch den Abbau von Lignin entstehen. Das dimere Enzym katalysiert NADPH-abhängig die

Hydroxylierung von 4-Hydroxybenzoat zu 3,4-Dihydroxybenzoat und ist relativ

substratspezifisch [189]. Die dimere Phenolhydroxylase (PH) aus der Hefe Trichosporon

cutaneum hydroxyliert NADPH-abhängig Phenol sowie einfache Hydroxy-, Amino-,

Halogen- und Methylderivate von Phenol in ortho-Position [190, 191]. m-Hydroxybenzoat-4-

Hydroxylase (MHBH) aus dem aeroben Bodenbakterium Comamonas testosteroni ist

ebenfalls ein dimeres Enzym, das NADPH-abhängig spezifisch die Hydroxylierung von

3-Hydroxybenzoat zu 3,4-Hydroxybenzoat bewirkt [192]. Abbildung 4.4.14 fasst die durch

die einzelnen Enzyme katalysierten Reaktionen zusammen.

A

HO

N OH HO

N OH

2,6-Dihydroxypyridin

2,3,6-Trihydroxypyridin

HO

+ NADH + H + + O 2

+ NAD + + H 2

O

B

HO

+ NADPH + H + + O H

2

O + NADP + H 2

O

HO

+

Phenol

1,2-Dihydroxybenzol

C

HO

O

O

HO

+ NADPH + H + + O 2

OH

HO

+ NADP + + H 2

O

OH

p-Hydroxybenzoat

3,4-Dihydroxybenzoat

D

HO

O

OH

m-Hydroxybenzoat

HO

O

+ NADPH + H + + O 2

HO

+ NADP + + H 2

O

OH

3,4-Dihydroxybenzoat

Abbildung 4.4.14

Von DHPH und den strukturverwandten Enzymen katalysierte Reaktionen

Hydroxylierungsreaktion durch DHPH (A), PH (B), PHBH (C) und MHBH (D)

PgaE und CabE sind aromatische Hydroxylasen, die in Streptomyceten species an der

Biosynthese von Angucyclin, einer Klasse aromatischer Polyketidantibiotika, beteiligt sind.

Diese dimeren Proteine konnten nur substratfrei kristallisiert werden [193]. RebC aus

Lechevlieria aerocolonigenes ist an der Synthese des Topoisomerase-I-hemmenden

Antitumorproduktes Rebeccamycin beteiligt. Obwohl es gute Hinweise für seine Funktion als

211


4 Ergebnisse und Diskussion

Flavin-Monooxygenase gibt, ist diese Aufgabe nicht gesichert, so dass diese Struktur in die

weiteren Diskussion nicht einbezogen wird [194]. Neben diesen aromatischen Hydroxylasen

wurde eine ganze Anzahl weiterer strukturverwandter Proteine gefunden (Tabelle 4.4.13), die

allerdings wenig oder keine Sequenzhomologie aufweisen und andere Reaktionen

katalysieren.

Bis auf RebC sind alle oben genannten Strukturhomologen von DHPH Dimere, die aber alle

auf verschiedene Art und Weise assoziieren. Dabei weisen die stark sequenzhomologen

Proteine PH und MHBH einen Typ von Dimerbildung auf, der teilweise über eine eigene

Domäne vermittelt wird. PHBH, PgaE und CabE bilden einen zweiten und die

Tryptophanhalogenase einen dritten Dimertyp. DHPH weist eine eigene, von allen anderen

verschiedene Art der Dimerisierung auf, die in Abbildung 4.4.12 gezeigt wird. Im Angesicht

dieser starken Diversität erscheint es unwahrscheinlich, dass die Dimerbildung für die

Katalyse wichtig ist.

Eine BLAST-Suche gegen alle nichtredundanten Aminosäuresequenzen in der GeneBank

führte neben zahlreichen hypothetischen Proteinen zu vielen sequenzhomologen Flavin-

Monooxygenasen und -hydroxylasen aus anderen Organismen, was zeigt, wie weit verbreitet

diese Enzymklasse ist. Allerdings fanden sich nur zwei hypothetische Proteine aus Mycolata,

die mehr als 30% Sequenzidentität aufweisen. Eine entsprechende Suche für die

strukturverwandten Flavin-Monooxygenasen zeigte, dass diese weit mehr eng verwandte

Enzyme besitzen. Dieser Unterschied und die Tatsache, dass alle für den Nikotinabbau

benötigten Enzyme auf einem Plasmid lokalisiert sind, sind Hinweise darauf, dass sich DHPH

möglicherweise in wenigen Jahrhunderten parallel mit der aufkommenden Tabakindustrie

entwickelt hat und nur wenige Bakterien diesem evolutionären Weg gefolgt sind.

Die große Bedeutung der aromatischen Flavin-Monooxygenasen zeigt sich bereits in der

kleinen Auswahl der strukturell charakterisierten Vertreter dieser Enzymklasse. Aromatische

Verbindungen sind nach den Kohlenhydraten die häufigste natürlich vorkommende

Stoffklasse. Ihr Vorkommen wird durch die Entstehung als industrielle Nebenprodukte aus

Raffinerien und Chemiefabriken noch verstärkt, und diese Verbindungen sind häufig toxisch

für höhere Organismen und belasten die Umwelt. Zudem ist die Modifizierung von

aromatischen Molekülen wichtig für die Biosynthese von Sterolen, Pflanzenhormonen,

Antibiotika und Komponenten mit Antitumorwirkung.

212


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

4.4.9 Funktionsweise

Überblick

Die durch DHPH katalysierte Hydroxylierung von 2,6-Dihydroxypyridin durch molekularen

Sauerstoff beinhaltet die Bindung des Substrates 2,6-DHP, die Reduktion von FAD durch

NADH sowie die anschließende Oxidation des reduzierten FAD durch Sauerstoff und die

Übertragung eines Sauerstoffatoms auf das Substrat sowie die Eliminierung von Wasser aus

dem oxidierten FAD (Abbildung 1.4.2).

Da es nicht gelungen ist, Daten für eine unzweifelhafte Lokalisierung des Substrates im

aktiven Zentrum von DHPH zu bestimmen und weiterhin keinerlei Daten für den

Reaktionsmechanismus von DHPH vorhanden sind, muss für die Erstellung eines

hypothetischen Reaktionsverlaufs auf Daten zu den eng verwandten Strukturhomologen

p-Hydroxybenzoat-3-Hydroxylase (PHBH), Phenolhydroxylase (PH) und m-Hydroxybenzoat-4-Hydroxylase

(MHBH) zurückgegriffen werden. Dies sind die einzigen

aromatischen Flavin-Monooxygenasen, deren Strukturen im Komplex mit ihrem Substrat

gelöst werden konnten. Die Strukturen der ebenfalls homologen aromatischen Flavin-

Monooxygenasen PgaE und CabE konnten nur in substratfreiem Zustand bestimmt werden

[193]. RebC konnte zwar im Komplex mit verschiedenen aromatischen Komponenten

kristallisiert werden, allerdings ist seine Funktion als Flavin-Monooxygenase nicht gesichert,

so dass es in die weitere Diskussion nicht einbezogen wird [194].

Um DHPH mit den anderen aromatischen Flavin-Monooxygenasen vergleichen zu können,

wurden die Strukturen mittels LSQKAB überlagert und ein strukturbasiertes

Sequenzalignment erstellt, das manuell kontrolliert wurde. Für die Überlagerung wurden 60

C α -Atome, die in der Nähe von FAD liegen, und FAD selbst (für MHBH nur die Atome des

Adenosylanteils) verwendet. Das Alignment ist in Abbildung 4.4.15 zusehen. Die Faltung der

Enzyme ist sehr ähnlich und weist nur geringe Abweichungen auf. Insgesamt 63% der

C α -Atome von DHPH können mit denen der anderen Proteine überlagert werden. Die sechs

Enzyme weisen 15 streng konservierte Aminosäurereste auf, die fast alle in unmittelbarer

Umgebung des FAD liegen.

213


4 Ergebnisse und Diskussion


β1 . α1 . . β2 . β3 . α2 . . β4 . β5 .

dhph 1 mSPTTDRIAVVGGSISGLTAALMLRDA-----GVDVDVYERSPQPLS-GFGTGIVVQPELVHYLLEQGVE-----LDSISVPSSSMEYVDA-----LTGERVGSVPAD-----------

phbh 1 ---MKTQVAIIGAGPSGLLLGQLLHKA-----GIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR---RMARDGLVHEGVEIAFA--------GQRRRIDLKRLSGGKT----

ph 3 YSESYCDVLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKRSTKVY--NGQADGLQCRTLESLKNLGLADK--ILSE-ANDMSTIALYNPDE--NGHIRRTDRIPDTLPGISRY----

mhbh 28 AVPSQVDVLIVGCGPAGLTLAAQLAAFP----DIRTCIVEQKEGPME--LGQADGIACRTMEMFEAFEFADS--ILKE-ACWINDVTFWKPDPGQPGRIARHGRVQDTEDGLSEF----

PgaE 1 ---SDAAVIVVGAGPAGMMLAGELRLA-----GVEVVVLERLVERTG--ESRGLGFTARTMEVFDQRGILPRFGEVETSTQGH----------------------FGGLPIDFGVLEGA

CabE 1 ---SDASVIVVGAGPAGLMLAGELRLG-----GVDVMVLEQLPQRTG--ESRGLGFTARTMEVFDQRGILPAFGPVETSTQGH----------------------FGGRPVDFGVLEGA

GxGxxG-Motiv



β6 . α3 . β7 . β8 . β9 .β10 β11 . α4 . β12 .

dhph 93 ---WRFTSYDSIYGGLYELFGP-----ERYHTSKCLVGLSQD--------SETVQMRFSD-------------GTKAEANWVIGADGGASVVRKRLL----GIEPTYAGYVTWRGVLQP

phbh 97 ---VTVYGQTEVTRDLMEAREAC---GATTVYQAAEVRLHDL-------QGERPYVTFERD----------GERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGWLGLLADT

ph 111 --HQVVLHQGRIERRILDSIAEISDTRIKVERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMSE-#36#-EAGEIETVHCKYVIGCDGGHSWVRRTLG---FEMIGEQTDYIWGVLDAVP

mhbh 134 --PHVILNQARVHDHYLERMRNSP-SRLEPHYARRVLDVKVDHG----AADYPVTVTLERCDA------HAGQIETVQARYVVGCDGARSNVRRAIG---RQLVGDSANQAWGVMDVLA

PgaE 88 WQAAKTVPQSVTETHLEQWATGL---GADIRRGHEVLSLTDD--------GAGVTVEVRGP----------EGKHTLRAAYLVGCDGGRSSVRKAAG---FDFPGTAATMEMYLADIKG

CabE 88 HYGVKAVPQSTTESVLEEWALGR---GAELLRGHTVRALTDE--------GDHVVVEVEGP----------DGPRSLTTRYVVGCDGGRSTVRKAAG---FDFPGTSASREMFLADIRG

DG-Motiv



. α5 . β13 . β14 . . β15 . α6 . β16. . α7 . α8 . β17 .

dhph 179 GEVADDVWNYFNDKFTYGLLD-DGHLIAYPIPGRENAESPRLNFQWYWNVAEGPDLDELMTDVRGIRLPTSVHNNSLNPHNLRQFHSKGESLFKPFRDLVLN---ASSPFVTVVADATV

phbh 193 PPV--------SHELIYANHP-RGFALCSQRSA------TRSRYYVQVPLTEKV-----------------------EDWSDERFWTELKARLPAEVAEKLVTGPSLEKSIAPLRSFVV

ph 256 ASNFP-----DIRSRCAIHSAESGSIMIIPREN------NLVRFYVQLQAraekg-----------------gRVDRTKFTPEVVIANAKKFHPYTFDVQQ----LDWFTAYHIGQRVT

mhbh 238 VTDFP-----DVRYKVAIQSE-QGNVLIIPREG-----GHLVRFYVEMDkldade------------------rvasrNITVEQLIATAQRVLHPYKLEVKN---VPWWSVYEIGQRIC

PgaE 183 VEL--------QPRMIGETLP-GGMVMVGPLPG------GITRIIVCERGTPPqr--------------------retPPSWHEVADAWKRLTGDDIAHAE----PVWVSAFGNATRQV

CabE 183 CEI--------TPRPIGETVP-LGMVMSAPLGD------GVDRIIVCERGAPARR--------------------RTGPPPYQEVAAAWQRLTGQDISHGE----PVWVSAFGDPARQV



β18 . β19 . . α9 . . . α10 . . . .

dhph 294 DRMVHG--------RVLLIGDAAVTPRPHAAAGGAKACDDARTLAEVFTKN---HDLRGSLQSWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVdepsvvtns 397

phbh 274 EPMQHG--------RLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKA-YREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRIQQTELEYYLGS-#20# 394

ph 344 EKFSKDE-------RVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKTYEEERQPFAQALIDFDHQFSRLFSGRPAKDVADEMGVSMDVFKEAF-#219# 664

mhbh 325 AKYDDVVD-#9#-PRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLHTYSSERQVVAQQLIDFDREWAKmfsdpakeggqggvDPKEFQKYFEQ-#202# 639

PgaE 263 TEYRRG--------RVILAGDSAHIHLPAGGQGMNTSIQDAVNLGWKLGAVVNGTATEELLDSYHSERHAVGKRLLMNTQAQGLLFLSGPEVQPLRDVLTELIQYGEVA-#128# 491

CabE 263 SAYRRG--------RVLLAGDSAHVHLPAGGQGMNVSVQDSVNLGWKLAAVVSGRAPAGLLDTYHEERHPVGRRLLMNTQAQGMLFLSGDEMQPLRDVLSELIRYDEVS-#126# 489

GD-Motiv

Abbildung 4.4.15 Strukturbasiertes Sequenzalignment von DHPH, PHBH (1pbe), PH (1pn0, Kette C), MHBH (2dkh), PgaE (2qa1) und CabE (2qa2)

Die erste Zeile enthält die Sekundärstrukturelemente von DHPH laut Abbildung 4.4.10. Aminosäurereste, die in den Modellen fehlen, sind mit

Kleinbuchstaben angegeben. Aminosäurereste, die der besseren Übersichtlichkeit wegen weggelassen wurden, sind mit #n# markiert, wobei n die Anzahl der

nicht gezeigten Reste bezeichnet. Für das Alignment wurden 60 Cα-Atome in der Umgebung des FAD (in der ersten Zeile rot markiert) sowie FAD selbst (für

MHBH nur der Adenosylteil) verwendet. Cα-Atome, die strukturell gut mit DHPH überlagert werden konnten (∆Cα ~ 3Å), sind gelb unterlegt.

Aminosäurereste, die sich im Dimerkontakt von DHPH befinden, sind unterstrichen. Die fingerprint-Motive [105] sind durch blaue Balken gekennzeichnet

214


4.4 2,6-Dihydroxypyridin-3-Hydroxylase (DHPH)

FAD-Bindung

Sämtliche strukturell bekannten aromatischen Flavin-Monooxygenasen binden FAD

nichtkovalent durch zahlreiche Wasserstoffbrücken und van-der-Waals-Wechselwirkungen,

die zum Teil stark konserviert sind. Dabei sind drei fingerprint-Motive an der Bindung

beteiligt [105]. Das GxGxxG-Motiv interagiert mit dem ADP-Teil des FAD, und die GD-

Sequenz bindet über eine Wasserstoffbrücke mit dem Aspartat das O3’-Atom des Flavins.

Das DG-Motiv, das auch für die Bindung von NAD(P)H verantwortlich gemacht wird, ist

indirekt an der FAD-Bindung beteiligt. Die fingerprint-Motive sind in Abbildung 4.4.15

markiert. Der Isoalloxazinring von FAD liegt bei allen aromatischen Flavin-Monooxygenasen

im Interface zwischen den Domänen. Am aktiven Zentrum sind Aminosäurereste aller

Domänen beteiligt.

Die FAD-Bindedomäne von DHPH enthält das typische Nukleotidbindemotiv βαβ, das jedoch

leicht abweichend vom Konsensus GxGxxG das Motiv GxSxxG (GGSISG, AS 12-17)

beinhaltet. In DHPH besteht das Nukleotidbindemotiv aus den β-Strängen β1 und β2 sowie

der α-Helix α1. FAD wird von diesem Motiv in gestreckter Form gebunden. Die α-Helix α1

zeigt mit ihrem N-Terminus in Richtung der Pyrophosphats und sorgt so für einen

Ladungsausgleich. Zudem sind fast sämtliche Peptidstickstoffatome des aktiven Zentrums

zum FAD hin au