LANDWIRTSCHAFT - BMELV-Forschung

bmelv.forschung.de

LANDWIRTSCHAFT - BMELV-Forschung

Bundesministerium für

Ernährung, Landwirtschaft

und Forsten

2/1998

DIE ZEITSCHRIFT DES SENATS DER BUNDESFORSCHUNGSANSTALTEN

FORSCHUNGS

ERNÄHRUNG · LANDWIRTSCHAFT · FORSTEN

Schwerpunkt:

Biotechnologie

rund um’s Tier

Kennzeichnung

gentechnisch veränderter

Lebensmittel

Report

Zustand der deutschen

Waldböden


Bundesministerium für

Ernährung, Landwirtschaft

und Forsten

FORSCHUNGSREPORT 2/1998

DER FORSCHUNGSBEREICH

Das Bundesministerium für Ernährung, Landwirtschaft und Forsten

(BML) unterhält einen Forschungsbereich, um wissenschaftliche Entscheidungshilfen für

die Ernährungs-, Land- und Forstwirtschaftspolitik der Bundesregierung zu erarbeiten und

damit zugleich die Erkenntnisse auf diesen Gebieten zum Nutzen des Gemeinwohls zu

erweitern (Rochusstr. 1, 53123 Bonn, Tel.: 0228/529-0, Fax: 0228/529-4262).

Dieser Forschungsbereich wird von 10 Bundesforschungsanstalten und der Zentralstelle

für Agrardokumentation und -information (ZADI) gebildet und hat folgende Aufgaben:

■ Bundesforschungsanstalt für

Landwirtschaft (FAL):

Erhaltung und Pflege natürlicher Ressourcen

agrarischer Ökosysteme und

Weiterentwicklung der Nahrungs- und

Rohstoffproduktion unter verstärkter Einbeziehung

neuer Wissensgebiete und Forschungsmethoden.

Dabei stellen die Analyse,

Folgenabschätzung und Bewertung

von zukünftigen Entwicklungen für die

Landwirtschaft und die ländlichen Räume

einen besonderen Schwerpunkt dar (Bundesallee

50, 38116 Braunschweig, Tel.:

0531/596-1, Fax: 0531/596-814).

■ Biologische Bundesanstalt

für Land- und Forstwirtschaft

(BBA):

Eine selbständige Bundesoberbehörde

und Bundesforschungsanstalt mit im Pflanzenschutz-,

Gentechnik- und Bundesseuchengesetz

festgelegten Aufgaben. Forschung

auf dem Gesamtgebiet des Pflanzen-

und Vorratsschutzes; Prüfung und Zulassung

von Pflanzenschutzmitteln; Eintragung

und Prüfung von Pflanzenschutzgeräten;

Beteiligung bei der Bewertung

von Umweltchemikalien nach dem Chemikaliengesetz;

Mitwirkung bei der Genehmigung

zur Freisetzung und zum Inverkehrbringen

gentechnisch veränderter Organismen

(Messeweg 11/12, 38104

Braunschweig, Tel.: 0531/299-5, Fax:

0531/299-3000).

■ Bundesanstalt für

Milchforschung (BAfM):

Erarbeitung der Grundlagen für die Erzeugung

von Milch, die Herstellung von

Milchprodukten und anderen Lebensmitteln

und die ökonomische Bewertung der

Verarbeitungsprozesse sowie den Verzehr

von Lebensmitteln mit dem Ziel einer gesunden

Ernährung (Hermann-Weigmann-

Str. 1, 24103 Kiel, Tel.: 0431/609-1,

Fax: 0431/609-2222).

■ Bundesforschungsanstalt für

Fischerei (BFAFi):

Bearbeitung der Probleme der

Fischwirtschaft von der Produktion bis zur

Verarbeitung unter Berücksichtigung aller

Zweige der Küsten- und Hochseefischerei

und zum Teil auch der Binnenfischerei

(Palmaille 9, 22767 Hamburg, Tel.:

040/38905-0; Fax: 040/38905-200).

■ Bundesforschungsanstalt für

Forst- und Holzwirtschaft

(BFH):

Wissenschaftliche Untersuchungen zur

Erhaltung des Waldes und zur Steigerung

seiner Leistung sowie zur Verbesserung

der Nutzung des Rohstoffes Holz und zur

Steigerung der Produktivität in der

Holzwirtschaft (Leuschnerstr. 91, 21031

Hamburg, Tel.: 040/73962-0, Fax:

040/73962-480).

■ Bundesanstalt für Getreide-,

Kartoffel- und Fettforschung

(BAGKF):

Forschungsarbeiten mit der Zielsetzung

einer Qualitätsverbesserung von Getreide,

Mehl, Brot und anderen Getreideerzeugnissen,

von Kartoffeln und deren

Veredlungsprodukten sowie der Lösung

wissenschaftlicher und technologischer

Fragen im Zusammenhang mit Ölsaaten

und -früchten und daraus gewonnenen

Nahrungsfetten und -ölen sowie

Eiweißstoffen (Schützenberg 12, 32756

Detmold, Tel.: 05231/741-0, Fax:

05231/741-1 00).

■ Bundesforschungsanstalt für

Viruskrankheiten der Tiere

(BFAV):

Eine selbständige Bundesoberbehörde

mit im Tierseuchengesetz und Gentechnikgesetz

festgelegten Aufgaben. Erforschung

und Erarbeitung von Grundlagen

für die Bekämpfung viraler Tierseuchen

(Boddenblick 5a, 17498 Insel Riems,

Tel.: 038351/7-0, Fax: 038351/

7-151).

■ Bundesanstalt für Fleischforschung

(BAFF):

Erforschung der Voraussetzungen, unter

denen die Versorgung mit qualitativ

hochwertigem Fleisch sowie einwandfreien

Fleischerzeugnissen einschließlich

Schlachtfetten und Geflügelerzeugnissen

sichergestellt ist (E.-C.-Baumann-Str. 20,

95326 Kulmbach, Tel.: 09221/803-1,

Fax: 09221/803-244).

■ Bundesforschungsanstalt für

Ernährung (BFE):

Horizontale, das gesamte Gebiet der

Ernährungs-, Lebensmittel- und Haushaltswissenschaften

übergreifende Aufgabenstellung

(Haid-und-Neu-Str. 9, 76131

Karlsruhe, Tel.: 0721/6625-0, Fax:

0721/ 6625-111).

2

■ Bundesanstalt für Züchtungsforschung

an Kulturpflanzen

(BAZ):

Erhöhung der biotischen Resistenz und

der Verbesserung der abiotischen Toleranz

der Kulturpflanzen sowie Entwicklung

von Zuchtmethoden und Verbesserung der

Produktqualität (Neuer Weg 22/23,

06484 Quedlinburg, Tel.: 03946/47-0,

Fax: 03946/47-255).

■ Zentralstelle für Agrardokumentation

und -information (ZADI):

Aufbau des Deutschen Agrarinformationsnetzes

(DAlNet), Online-Angebot nationaler

und internationaler Datenbanken,

Forschung und Entwicklung auf den Gebieten

Agrardokumentation und Informatik

sowie Koordinierung der Dokumentation

im Fachinformationssystem Ernährung,

Land- und Forstwirtschaft (FIS-ELF) (Villichgasse

17,53177 Bonn, Tel.: 0228/

9548-0, Fax: 0228/9548-149).

Forschungseinrichtungen der

Blauen Liste:

Darüber hinaus sind sechs Forschungseinrichtungen

der Blauen Liste dem Geschäftsbereich

des BML zugeordnet: Deutsche

Forschungsanstalt für Lebensmittelchemie

(DFA) (Lichtenbergstr. 4, 85748

Garching, Tel.: 089/28914170, Fax:

089/28914183); Zentrum für Agrarlandschafts-

und Landnutzungsforschung

e. V. (ZALF) (Eberswalder Str. 84, 15374

Müncheberg, Tel.: 033432/82-0, Fax:

033432/82-212); Institut für Agrartechnik

Bornim e. V. (ATB) (Max-Eyth-Allee

100, 14469 Potsdam-Bornim, Tel.:

0331/5699-0, Fax: 0331/5699-

849); Institut für Gemüse- und Zierpflanzenbau

Großbeeren/Erfurt e. V. (IGZ)

(Theodor-Echtermeyer-Weg 1, 14979

Großbeeren, Tel.: 033701/78-0, Fax:

033701/55391); Forschungsinstitut für

die Biologie landwirtschaftlicher Nutztiere

(FBN) (Wilhelm-Stahl-Allee 2, 18196

Dummerstorf, Tel.: 038208/68-5, Fax:

038208/686-02); Institut für Agrarentwicklung

in Mittel- und Osteuropa (IAMO)

(Magdeburger Str. 1, 06112 Halle/S.,

Tel.: 0345/5008-111, Fax: 0345/

5126599).

Die wissenschaftlichen Aktivitäten des

Forschungsbereiches werden durch den

Senat der Bundesforschungsanstalten

koordiniert, dem die Leiter der Bundesforschungsanstalten,

der Leiter der ZADI und

sieben zusätzlich aus dem Forschungsbereich

gewählte Wissenschaftler angehören.

Der Senat wird von einem auf zwei Jahre

gewählten Präsidium geleitet, das die Geschäfte

des Senats führt und den Forschungsbereich

gegenüber anderen wissenschaftlichen

Institutionen und dem BML vertritt

(Präsidium des Senats der Bundesforschungsanstalten,

c/o BBA, Messeweg 11/12,

38104 Braunschweig, Tel.: 0531/299-5,

Fax: 0531/299-3001).


Guten Tag,

EDITORIAL INHALT

als ich mir neulich abends bei einem Gläschen Wein Gedanken

zum Editorial für diesen ‘biotechnologischen’ ForschungsReport

machte, wurde mir klar, daß ich eigentlich schon mitten im

Thema war. Denn was ist Wein anderes als ein Produkt

biotechnologischer Erzeugung, bei dem die Stoffwechselleistung

von Mikroorganismen, konkret die Vergärung von Zucker durch

Hefen, gezielt ausgenutzt wird? Biotechnologie begleitet uns in

vielen Bereichen unseres Lebens – in ihren Urformen schon seit

Jahrtausenden.

Die Möglichkeiten der

Biotechnologie haben sich

allerdings durch die

Fortschritte in der

Molekularbiologie, aber

auch der Verfahrens- und

Computertechnik,

immens erhöht. Nach

Meinung vieler Experten

sehen wir einem

„Jahrhundert der

Biologie” entgegen. Da

neue Technologien auf

gesellschaftliche Akzeptanz

angewiesen sind, kommen sie nicht ohne öffentliche Diskussion

aus. Wesentliche Voraussetzung dafür ist ein guter Kenntnisstand

über das aktuell Machbare und seine möglichen Auswirkungen.

Wer über den Stand der Forschung und ihre Umsetzung in die

Praxis informiert ist, wird neue Entwicklungen besser beurteilen

können und weniger den Statements und Prognosen

selbsternannter Experten glauben müssen.

Hier ist die Ressortforschung gefragt. Zu ihren wichtigsten

Aufgaben zählt die Unterrichtung und Beratung der politischen

Entscheidungsträger. Daher muß sie gerade auch in heiß

diskutierten Forschungsfeldern präsent sein. Ressortforschung ist

überwiegend angewandte Forschung mit direktem Bezug auf

praktische Erfordernisse und verantwortbare Entscheidungen.

Das läßt keinen Platz für Elfenbeintürme.

Der ForschungsReport greift in seinem Schwerpunkt

„Biotechnologie rund um’s Tier” einige topaktuelle Themen auf,

die im Brennpunkt des öffentlichen Interesses stehen. Dabei geht

es um innovative Verfahren im Bereich der Lebensmittelproduktion

ebenso wie um neue Impfstoffe und um

landwirtschaftliche Nutztiere, die in der Biomedizin eine Rolle

spielen können. Biotechnologie – und mit ihr die Gentechnik als

Teilbereich – hat hier viele Türen geöffnet. Was sich hinter den

Türen verbirgt und welche Perspektiven sich auftun, erfahren Sie

auf den folgenden Seiten.

Ihr

Prof. Dr. F. Klingauf

Präsident des Senats der Bundesforschungsanstalten

3

DER FORSCHUNGSBEREICH 2

BERICHTE AUS DER FORSCHUNG

Neue Impfstoffe gegen

Viruskrankheiten bei Tieren

Entwicklungssprung durch die Gentechnologie 4

Tiere als Arzneimittel- und

Organlieferanten

Neue Perspektiven in der Biomedizin 9

In-vitro-Erzeugung von

Rinderembryonen

Ultraschallgeleitete Entnahme von Eizellen

beschleunigt den Zuchterfolg 14

Gesündere Tiere durch

besseres Futter 18

Biotechnologie in

der Käseherstellung 22

Biokonservierung von

Fleischerzeugnissen

Bacteriocinogene Milchsäurebakterien

können Pathogene hemmen 26

Kennzeichnung von gentechnisch

veränderten Lebensmitteln 30

Neuentwicklungen

auf dem Prüfstand

Über die Verzahnung von wissenschaftlichen

Arbeiten und behördlichen Entscheidungen 34

Zustand der

deutschen Waldböden

Auswirkungen anthropogener Einflüsse 38

IMPRESSUM 43

PORTRAIT

Institut für Tierzucht und

Tierverhalten Mariensee 44

Institut für landwirtschaftliche

Kulturen, Groß Lüsewitz 46

NACHRICHTEN 48

TAGUNGEN 50

2/1998 FORSCHUNGSREPORT


Abb. 1:

Blutungen in

verschiedenen

Organen, hier in

der Lunge und

der Luftröhre,

sind typische

Symptome der

HämorrhagischenKaninchenkrankheit.

BIOTECHNOLOGIE

Neue Impfstoffe

gegen

Viruskrankheiten

bei Tieren

Entwicklungssprung durch die

Gentechnologie

V. Kaden, G. M. Keil, N. Osterrieder, H. Schirrmeier

und T. C. Mettenleiter (Insel Riems)

Gegen Infektionskrankheiten, die durch Viren verursacht werden, gibt es keine oder

nur unzureichende Behandlungsmöglichkeiten. Daher ist die Entwicklung von Impfstoffen,

die vorbeugend eingesetzt werden, eine der Hauptaufgaben virologischer

Forschung. Die aktive Immunisierung von Tier und Mensch erfolgt entweder mit Impfstoffen

aus vermehrungsfähigen Erregern (sog. „Lebendvakzinen”) oder inaktivierten

Erregern („Totvakzinen”). Seit einigen Jahren werden sowohl Lebend- als auch Totvakzinen

unter Einsatz gentechnologischer Verfahren hergestellt.

Die gezielte Inaktivierung von Genen,

die für die krankmachenden Eigenschaften

der Erreger verantwortlich

sind, führt zu biologisch sicheren

Lebendvakzinen. Darüber hinaus besteht

die Möglichkeit, Gene anderer

FORSCHUNGSREPORT 2/1998

Erreger in das genetische Material

eines Virus einzubauen und so

gleichzeitig gegen mehrere Infektionen

zu schützen („Vektorvakzinen”).

Immunogene Proteine von viralen Erregern

können auch biotechnologisch

in Bakterien oder in Zellkulturen

hergestellt und nach der Reinigung

für eine Impfung verwendet werden

(„Subunit-Vakzinen”). Die neueste Entwicklung

beruht auf der Immunisierung

mit „nackter” DNA (DNA-Vakzinen).

Gentechnologisch produzierte

Vakzinen bieten gegenüber konventionell

hergestellten Impfstoffen mehrere

Vorteile. Durch die gezielte Manipulation

ist eine hohe biologische

Sicherheit von Lebendvakzinen gegeben.

Zweitens kann ein hoher

gleichbleibender Reinheitsgrad der

Impfstoffe gewährleistet werden. Drittens

erlaubt die Gentechnologie die

Schaffung sogenannter „Markerimpf-

4

stoffe” und damit die Möglichkeit,

zwischen geimpften und infizierten

Tieren zu unterscheiden.

Im folgenden wird anhand von

Beispielen auf die Möglichkeiten der

Bekämpfung von viralen Infektionskrankheiten

bei Tieren durch gentechnologisch

produzierte Impfstoffe

eingegangen.

HÄMORRHAGISCHE

KANINCHENKRANKHEIT

Im Jahr 1984 trat in China bei

Angorakaninchen, die zwei Monate

zuvor aus Deutschland importiert

worden waren, eine hochansteckende

Viruserkrankung auf, an der nahezu

alle betroffenen Tiere in kurzer

Zeit verendeten. Die Kaninchen hatten

massive Leberschäden und Blutungen

(= Hämorrhagien) in verschiedenen

Organen (Abb.1). Dieses

Krankheitsbild führte zu dem Namen

‘Hämorrhagische Kaninchenkrankheit’

(engl. Rabbit Hemorrhagic Disease,

RHD). Die Seuche breitete

sich in der Folgezeit sehr rasch aus

und wurde ein Jahr später auch in

Korea festgestellt.


Beginnend mit dem Jahr 1986

wurde bis 1990 nahezu der gesamte

europäische Kontinent erfaßt. Seuchenausbrüche

wurden auch aus

Mexiko, Nordafrika und dem Nahen

Osten gemeldet. Der größte Seuchenherd

existiert gegenwärtig in

Australien, wo der Erreger im Rahmen

eines wissenschaftlich und

ethisch umstrittenen Programms zur

Bekämpfung der Wildkaninchenplage

freigesetzt wurde.

In Deutschland wurden erste RHD-

Fälle im 2. Halbjahr 1988 festgestellt.

Trotz des Einsatzes von Impfstoffen

sind seit 1989 jährlich zwischen

1000 und 2000 Seuchenausbrüche

zu verzeichnen.

Die RHD ist ein Beispiel dafür, daß

ständig mit dem plötzlichen Auftreten

neuer Erkrankungen gerechnet werden

muß. In diesen Fällen ist es von

besonderer Wichtigkeit, sehr schnell

alle notwendigen Werkzeuge für

Diagnose und Bekämpfung verfügbar

zu machen.

Der Erreger der Hämorrhagischen

Kaninchenkrankheit wird den Caliciviren

zugeordnet. Die gesamte genetische

Information ist in einem einzigen

RNA-Strang lokalisiert, der circa

BIOTECHNOLOGIE

7.500 Nukleotide (Einzelbausteine

der RNA) umfaßt. Die Viruspartikel

bestehen im wesentlichen aus einem

einzigen Protein, dem VP60. Dieses

Protein löst im Tier die Bildung von virusneutralisierenden,

das heißt vor einer

Erkrankung schützenden Antikörpern

aus. Alle Anstrengungen zur Entwicklung

eines Impfstoffes zielen also

letztlich darauf ab, im geimpften Tier

Antikörper gegen dieses Protein zu

erzeugen.

Bis heute läßt sich der Erreger

nicht in Zellkultur züchten, so daß alle

eingesetzten Impfstoffe gegen die

Kaninchenseuche aus der Leber experimentell

infizierter Tiere gewonnen

werden müssen. Dies ist nicht nur

sehr aufwendig, sondern auch aus

Gründen des Tierschutzes längerfristig

nicht tolerierbar. Unsere Arbeiten

haben daher das Ziel, auf gentechnischem

Wege einen Impfstoff zu entwickeln,

der Kaninchen einen wirksamen

Schutz verleiht.

Dazu wurde die genetische Information

für das VP60 in ein anderes

Virus verbracht, das Kaninchen nicht

befallen kann. Solche Erreger sind

zum Beispiel Insektenviren wie die

Baculoviren. Dieser

Virentyp kann

sich in Warmblütern

nicht vermehren

und erfüllt

so bereits

wesentliche Forderungen

an die

Biosicherheit. Typisch

für diese Viren

ist, daß im

Überschuß ein

Protein (Polyhedrin)

gebildet

wird, in das die

reifen Viruspartikel eingeschlossen

werden, wodurch sie mit einer besseren

Überlebensfähigkeit in der freien

Natur ausgestattet sind. Diese

Überschußproduktion macht man

sich zunutze, indem man DNA-Abschnitte,

die für das Polyhedrin kodieren,

gegen die des gewünschten

Proteins austauscht. Auf diese Weise

wird anstelle des Polyhedrins zum

Beispiel VP60 produziert.

Zu diesem Zweck haben wir den

für das VP60 kodierenden Genabschnitt

in Baculoviren eingefügt. Diese

Viren produzieren nun im Rahmen

Abb. 2: Prinzip der Herstellung von Subunit-Vakzinen mit Hilfe von Baculoviren.

Die genetische Information für ein schutzerzeugendes Protein wird in

das Erbgut der Baculoviren integriert und das Fremdgen nach Infektion von

Insektenzellen exprimiert. Nach Aufreinigung wird das Protein zur Immunisierung

verwandt.

RHD-Virus

Aufreinigung des

RHD-Virus VP60-Proteins

5

VP 60-Gen

Baculovirus-DNA

Insektenzellen

(Spodoptera frugiperda Sf9)

IMMUNISIERUNG

rekombinante

Baculovirus-DNA

Einschleusen der rekombinanten DNA

in Insektenzellen

rekombinantes

Baculovirus

2/1998 FORSCHUNGSREPORT

In Fermenten

können

neuartige

Impfstoffe mit

Hilfe von

Bakterien

hergestellt

werden


ihres eigenen Vermehrungszyklusses

in kultivierten Insektenzellen das

VP60 in großer Menge (Abb. 2 und

3). Dieses Material wurde dann zur

Impfung von Kaninchen verwendet.

Nach einmaliger Impfung bildeten

die Tiere Antikörper, die sie vor einer

ansonsten tödlich verlaufenden RHD-

Virus-Infektion schützten. Der Schutz

trat innerhalb von 6-10 Tagen ein

und war mit dem durch herkömmliche

Impfstoffe vermittelten vergleichbar

(Abb. 4).

Auf diesem Wege ist es gelungen,

eine neuartige Vakzine zu entwickeln,

die in Zukunft die Verwendung

von Tieren zur Herstellung von

Impfstoffen gegen RHD überflüssig

machen sollte.

SCHWEINEPEST

Die Klassische oder Europäische

Schweinepest (KSP) verursacht hohe

wirtschaftliche Verluste in der Landwirtschaft.

Durch verschiedene

Bekämpfungsmaßnahmen konnte die

KSP-Verseuchung beim Hausschwein

im europäischen Raum zurückgedrängt

werden, wobei lange Zeit ein

BIOTECHNOLOGIE

höchst wirksamer Lebendimpfstoff

eingesetzt wurde. Mit der Internationalisierung

des Marktes war es notwendig,

die Schweinepestimpfung

einzustellen, damit lebende Schweine

und Fleischprodukte in und aus

der Europäischen Union uneingeschränkt

gehandelt werden können

(Hintergrund: Um eine Verbreitung

der Krankheit zu verhindern, dürfen

nur KSP-negative Schweine gehandelt

werden, was durch das Fehlen

von Antikörpern gegen KSP definiert

ist. Geimpfte Tiere bilden aber ebenso

wie latent infizierte Schweine Antikörper,

so daß eine Unterscheidung

nicht möglich ist).

Die Bekämpfung der Schweinepest

erfolgt daher zur Zeit durch

Tötung infizierter und ansteckungsverdächtiger

Tierbestände einschließlich

Quarantäne- und Hygienemaßnahmen

sowie intensiver diagnostisch-epidemiologischerUntersuchungen.

Die auf der Richtlinie

80/217/EWG basierende

Schweinepest-Verordnung vom

24.10.1994 erlaubt jedoch unter

besonderen Seuchenbedingungen

die Impfung. Impfungen mit einem

konventionellen und daher unmar-

Abb. 4: Antikörperentwicklung nach Verabreichung eines kommerziellen Impfstoffes

(Gruppe 2), von VP60 exprimierendem Baculovirus (Gruppe 3) und von mit

Immunstimulantien versetztem Baculovirus (Gruppe 4) an Kaninchen. Gruppe 1:

nicht vakzinierte Kontrolltiere. Die Antikörper wurden in einem ELISA gegen gereinigtes

RHD-Virus getestet. Die Menge der gebildeten Antikörper (ablesbar an

der Höhe der optischen Dichte) korreliert mit dem Impfschutz.

1,2

1,0

0,8

0,6

0,4

0,2

0,0

Optische Dichte (490 nm)

FORSCHUNGSREPORT 2/1998

Gruppe 1 Gruppe 2 Gruppe 3 Gruppe 4

0 4 7 13 21 28 35 55 69 126

Tage nach Vakzinierung

6

Abb. 3: Expression von VP60 des RHD-

Virus in Insekten-Zellkulturen, die mit

gentechnisch veränderten Baculoviren

infiziert worden sind. Nachweis des

Proteins mittels eines VP60-spezifischen

Antikörpers in der Immunfluoreszenz.

kierten Impfstoff führen allerdings zu

umfangreichen Handelsrestriktionen,

die ebenfalls große wirtschaftliche

Verluste nach sich ziehen.

Schweinepestausbrüche haben in

Deutschland, Belgien und den Niederlanden

enorme wirtschaftliche

Schäden verursacht. So kam es

1997 allein in Deutschland zu

44 Ausbrüchen, bei denen

39.000 Schweine gekeult werden

mußten; darüber hinaus wurden in

351 Kontaktbetrieben 36.700 Tiere

vorbeugend gekeult. Um hier Abhilfe

zu schaffen wird intensiv an der Entwicklung

eines Markerimpfstoffes gegen

die Schweinepest gearbeitet. An

einen solchen markierten Impfstoff

sind hinsichtlich seiner Unschädlichkeit

und Wirksamkeit hohe Anforderungen

zu stellen, wie

1. Schutz gegenüber einer natürlichen

Kontaktinfektion;

2. keine Übertragung von Feldvirus

durch geimpfte Schweine auf Kontakttiere;

3. keine Übertragung des Schweinepestvirus

von geimpften Sauen

auf die Nachkommen;

4. effektiver Langzeitschutz möglichst

nach einmaliger Impfung;

5. eindeutige Unterscheidung von infizierten

und geimpften Tieren;

6. keine Handelsbarrieren für die

geimpften Schweine.

Bei der Entwicklung von Schweinepest-Markervakzinen

wurden mehrere

Wege beschritten. Schweine bil-


den nach natürlicher Infektion Antikörper

gegen verschiedene Virusproteine,

vor allem gegen die Strukturproteine

E rns und E2 sowie das Protein

NS3 (Abb. 5). Besonders die

gegen E2 gerichteten Antikörper

führen zu einem Immunschutz, so

daß dieses Protein in einem Impfstoff

enthalten sein muß. Bisher wurde vor

allem an der Entwicklung von Subunit-Vakzinen

sowie rekombinanten

Vektorvakzinen mit Erfolg gearbeitet.

Während der Schweinepest-Markerimpfstoff

der ersten Generation, die

Subunit-Vakzine, vor der Zulassung

steht, dürften zur Einführung rekombinanter

vermehrungsfähiger Vektorvakzinen

noch umfangreiche Untersuchungen

erforderlich sein.

Subunit-Vakzine

Bei der Subunit-Vakzine wird das

Gen für das E2-Protein in das Genom

eines genetisch veränderten Baculovirus

integriert (Abb. 5; in Zusammenarbeit

mit der Universität

Gießen). Gereinigtes E2 dient dann

als Totimpfstoff, wobei Antikörper nur

gegen dieses Virusprotein gebildet

werden. Werden zusätzlich Antikörper

gegen weitere Proteine des

Schweinepest-Virus gefunden, so

liegt eine Infektion mit Feldvirus vor.

Das Tier muß dann geschlachtet und

unschädlich beseitigt werden. Eine

solche Unterscheidung läßt sich

durch Blutuntersuchungen durchführen.

Laboruntersuchungen haben

gezeigt, daß ein derartiger Impfstoff

geeignet ist, nach zweimaliger Impfung

eine Schweinepest-Infektion bei

Läuferschweinen und Sauen sowie

eine Feldvirusausscheidung wirksam

zu verhindern. Da es sich bei der

Subunit-Vakzine um einen Totimpfstoff

handelt, der zudem nur auf einem

einzelnen Protein – dem E2 – basiert,

wird der Schutz im Vergleich zur konventionellen

Lebendvakzine, bei der

ja sämtliche Proteine des Schweinepestvirus

vorliegen, später ausgebildet.

Wichtige zellvermittelte Immunmechanismen

werden ebenfalls

nicht genügend in Gang gesetzt. Daher

dürfte dieser Impfstoff, dessen

BIOTECHNOLOGIE

Abb. 5: Genom-Organisation des KSP-Virus. Das schutzvermittelnde E2-Glykoprotein

wird mittels gentechnisch veränderter Baculoviren exprimiert und

zur Immunisierung der Schweine verwandt. Nach Immunisierung mit E2 werden

nur Antikörper gegen dieses Protein gebildet (rot dargestellte Antikörper).

Die Immunantwort von infizierten Tieren ist gegen alle Proteine gerichtet,

vor allem gegen E rns , E2 und NS2/3 (blau dargestellte Antikörper). Wenn

in Schweinen nur Antikörper gegen E2 nachzuweisen sind, handelt es sich um

geimpfte Tiere, bei Nachweis von Antikörpern sowohl gegen E2 als auch gegen

E rns und/oder NS2/3 um infizierte Tiere.

Herstellung auch relativ teuer ist, nur

bedingt für einen Einsatz geeignet

sein. Dennoch stellt er ein wichtiges

Instrument bei der künftigen Beherrschung

der Schweinepest dar.

Rekombinante

Vektorvakzinen

Arbeiten zur Entwicklung von Markervakzinen

auf der Grundlage von

vermehrungsfähigen Viren als Träger

(Vektoren) KSP-Virus-spezifischer Antigene

wurden bisher sowohl in

Deutschland (BFAV, Universität

Gießen) als auch im Ausland durchgeführt.

Grundlagen hierfür bildeten

genetisch veränderte Viren, wie beispielsweise

das Virus der Aujeszky’schen

Krankheit, in dessen genetisches

Material das Gen für E2 integriert

wurde. Vakzinen auf der Basis

vermehrungsfähiger Vektoren haben

entscheidende Vorteile gegenüber

7

Subunit-Vakzinen: Neben der Antikörper-Immunität

wird auch die zellvermittelte

Immunität stimuliert, was zu einer

höheren und früheren Schutzwirkung

führt. Gerade letzteres ist zum

Beispiel für Schweinebestände von

Bedeutung, die unmittelbar Kontakt

zum Seuchenbetrieb hatten. Ein weiterer

Vorteil einer solchen Vakzine ergibt

sich aus der Tatsache, daß nicht

nur effizient gegen Schweinepest immunisiert

werden kann, sondern auch

gegen den Erreger, der als Vektor genutzt

wird (z. B. Schweinepest und

Aujeszky’sche Krankheit).

ANIMALE HERPESVIREN

ALS MARKER- UND

VEKTORIMPFSTOFFE

Herpesviren sind bedeutende

Krankheitserreger bei Mensch und

2/1998 FORSCHUNGSREPORT


Abb. 6: Prinzip der

DNA-Immunisierung:

Das virale

Gen, welches für

ein schutzerzeugendesProtein

kodiert, wird

in ein Plasmid

unter Kontrolle

starker Promotoren

eingefügt

und in Bakterien

vermehrt. Die

Plasmid-DNA wird

nach Aufreinigung

in Schweine injiziert.

Nach der

Impfung kommt es

zu einer Immunreaktion

im Tier

gegen das entsprechende

Protein.

Tier und verursachen erhebliche ökonomische

Verluste in der Nutztierhaltung.

Die zur Zeit verfügbaren Impfstoffe

für Rinder, Schweine und Geflügel

müssen meist mehrmals angewendet

werden, um einen sicheren

Schutz vor den jeweiligen Erkrankungen

zu gewährleisten. Ein weiterer

Nachteil klassischer Impfstoffe ist,

daß diese im allgemeinen keine Unterscheidung

zwischen geimpften

und infizierten Tieren erlauben. Deshalb

sind auch hier Markerimpfstoffe

wünschenswert, um Bekämpfungsprogramme

effizient durchführen zu

können. Weiterhin werden Herpesvirus-Vektoren

entwickelt, die zur Immunisierung

gegen mehrere Krankheitserreger

verwendet werden können.

In den Labors der Bundesforschungsanstalt

für Viruskrankheiten

der Tiere (BFAV) ist bereits ein solcher

Impfstoff auf der Basis eines Herpesvirus

hergestellt worden, der Rinder

gegen zwei verschiedene Viruskrankheiten

gleichzeitig schützt. Darüber

hinaus sollen die immunisierenden Eigenschaften

der Impfstoffe so erhöht

werden, daß nach einmaliger

Anwendung bereits ausreichender

Schutz vorhanden ist.

FORSCHUNGSREPORT 2/1998

BIOTECHNOLOGIE

Derartige kostengünstige Impfstoffe

könnten vor allem in Staaten der

Dritten Welt die Durchführung von

Impfprogrammen wesentlich erleichtern.

Die Genome von Herpesviren enthalten

eine Vielzahl von Genen (zwischen

60 und 200), von denen fast

die Hälfte für die Virusvermehrung

nicht benötigt wird. Einige von diesen

können durch andere Gene ersetzt

werden, ohne daß die Virusvermehrung

in der Zellkultur und die

schutzvermittelnden Eigenschaften im

Tier wesentlich beeinträchtigt werden

– beides eine Voraussetzung für die

Entwicklung effizienter Vektorimpfstoffe

der nächsten Generation.

DNA-VAKZINIERUNG

GEGEN DIE AUJESZKY’SCHE

KRANKHEIT

Bei konventionellen Lebend- und

Totvakzinen wird mit Protein (=Antigen)

geimpft. Es ist allerdings auch

möglich, durch direkte Verabreichung

eines Gens, das für ein immunogenes

Protein kodiert, einen Impfschutz

zu erzeugen. Hierbei entfällt

8

die zum Teil aufwendige Reinigung

des Antigens. Darüber hinaus werden

durch die DNA-Immunisierung

beide Seiten des Immunsystems, die

Antikörper- und die zellvermittelte Immunität,

gleichermaßen stimuliert.

Für die DNA-Immunisierung wird

das virale Gen in ein Plasmid (ringförmiges

Stück Bakterien-DNA) eingefügt

und unter die Kontrolle eines

starken Promotors gebracht, also eines

genetischen Elements, das später

für eine hohe Synthese des Proteins in

den Säugetierzellen sorgt. Das Plasmid

wird in Bakterienkultur vermehrt.

Wir haben diese Möglichkeit bei der

Immunisierung gegen die Aujeszky’sche

Krankheit der Schweine untersucht.

Das Prinzip ist in Abbildung 6

dargestellt. Wurde den Versuchstieren

die entsprechende Plasmid-DNA

in die Haut injiziert, konnte ein belastbarer

Impfschutz gegen eine Infektion

mit dem Aujeszky-Virus hervorgerufen

werden. Die Wirksamkeit

lag zwischen der einer Tot- und einer

Lebendvakzine.

NEUE CHANCEN

Die dargestellten Beispiele zeigen,

wie mit gentechnischen Methoden

effektive und sichere Impfstoffe

entwickelt werden können. Den Nutzen

haben nicht nur Landwirte, auch

unter dem Blickwinkel des Tierschutzes

ergeben sich Vorteile: Spektakuläre

Tötungsaktionen wie im Falle

der Schweinepest wären vermeidbar,

darüber hinaus eröffnen sich

Möglichkeiten, Impfstoffe (z. B. gegen

die Hämorrhagische Kaninchenkrankheit)

vermehrt in Zellkulturen zu

produzieren, wodurch sich die Verwendung

von Labortieren deutlich reduzieren

läßt. ■

Dr. habil. Volker Kaden, Dr. Günter

M. Keil, PD Dr. Nikolaus Osterrieder,

Dr. Horst Schirrmeier, Prof. Dr. Thomas

C. Mettenleiter, Bundesforschungsanstalt

für Viruskrankheiten

der Tiere, Friedrich-Loeffler-

Institute, 17498 Insel Riems


Tiere als Arzneimittel- und

Organlieferanten

Neue Perspektiven in der Biomedizin

Heiner Niemann (Neustadt-Mariensee)

Im Jahr 1985 wurde erstmals über die Geburt transgener Nutztiere berichtet. Seitdem hat es auf diesem Gebiet erhebliche

Fortschritte gegeben. Transgene Nutztiere haben allerdings bislang weniger in der Landwirtschaft, als vielmehr in einem

anderen Bereich Bedeutung erlangt: in der Biomedizin. Dies liegt unter anderem daran, daß bisher kaum Gene bekannt

sind, die im engeren Sinne landwirtschaftlich relevante Merkmale ausprägen. Zudem werden tierzüchterisch interessante

Merkmale häufig durch das Zusammenspiel mehrerer Gene beeinflußt. Im folgenden werden die gegenwärtigen methodischen

Ansätze zur Erstellung transgener Tiere kurz skizziert und der Entwicklungsstand in zwei biomedizinisch relevanten

Bereichen – der Produktion rekombinanter Proteine durch transgene Nutztiere und der Transplantation von Tierorganen auf

den Menschen – näher erläutert.

ERSTELLUNG

TRANSGENER TIERE

Aufgrund des langen Generationsintervalls

(Tabelle 1) ist die Erstellung

transgener Linien bei Nutztieren

ein sehr langwieriges Unternehmen.

Mit dem Gentransfer soll erreicht

werden, ein Genkonstrukt in allen

Körperzellen eines Tieres einschließlich

der Keimzellen zu integrieren

und zu exprimieren. Deshalb sind für

den Gentransfer bisher fast ausschließlich

frühe embryonale Entwicklungsstadien

verwendet worden.

Voraussetzung für einen erfolgreichen

Gentransfer ist ein funktionsfähiges

Genkonstrukt. Dafür muß ein

Strukturgen, also das Gen, das für

ein bestimmtes Protein kodiert, mit

einem geeigneten Regulationselement

(Promotor) zusammengebracht

werden. Man ist dabei nicht an Promotor-Elemente

der gleichen Tierart

gebunden.

Die Genkonstrukte sind bisher

überwiegend in frisch befruchtete Eizellen

(Zygoten) übertragen worden,

und zwar zu einem Zeitpunkt,

bei dem die Kerne des Spermiums

und der Eizelle noch nicht miteinander

verschmolzen sind, sondern sich

als Vorkerne getrennt in der Zygote

befinden. Das genetische Material

wurde durch Mikroinjektion in einen

der beiden Vorkerne eingebracht.

Die Eizelle hat einen Durchmesser

von rund 150 µm; der männliche

und weibliche Vorkern ist jeweils

etwa 8-10 µm groß. Für die Gen-

9

übertragung wird eine geeignete Injektionsnadel

unter mikroskopischer

Kontrolle in einen Vorkern vorgeschoben

und die DNA-Lösung mit

Tab. 1: Auswirkungen des Generationsintervalls auf die

Erstellung transgener Tiere

2/1998 FORSCHUNGSREPORT

Zeitpunkt nach Mikroinjektion

(in Monaten)

Maus Schaf Schwein Rind

Geschlechtsreife


Abb. 2: Schematische Darstellung des Kerntransfers mit

embryonalen Zellen (Oozyte = weibl. Keimzelle)

(a)

(c)

(e)

etwa 3.000 bis 5.000 Kopien des

jeweiligen Genkonstruktes mikroinjiziert

(Abb. 1). In der nachfolgenden

Verschmelzung der beiden Vorkerne

wird das mütterliche und väterliche

Erbgut neu kombiniert, so daß auch

das Fremdgen in das Genom des

Wirtes mit eingebaut werden kann.

Die Zygoten befinden sich zu

dem Zeitpunkt, an dem sie für die

Mikroinjektion benötigt werden,

noch im Eileiter und können über einen

operativen Eingriff durch Spülung

der Eileiter gewonnen werden.

Beim Rind ist dies sehr aufwendig,

deshalb werden dort überwiegend

in vitro erzeugte Embryonalstadien

verwendet. Die mikroinjizierten Eizellen

werden dann nach einer kurzzeitigen

in-vitro-Kultivierung, bei der

injektionsbedingte Schädigungen

(b)

(d)

(a) Metaphase II - Oozyte

(b) Metaphase II - Oozyte nach Entfernung der Chromosomen

(c) Spenderembryo mit 16 Blastomeren

(d) Entkernte Empfängeroozyte vor Transfer der Blastomere

(e) Oozyte und Blastomere nach Transfer

(f) Aufnahme der Blastomere im Ooplasma nach Elektrofusion und

Kernschwellung als Zeichen der Reprogrammierung

(f)

erkannt werden können, in die Eileiter

synchronisierter, das heißt zyklusgleicher

Empfängertiere übertragen.

Das gesamte Verfahren ist sehr

aufwendig und nur wenig effizient,

da durchschnittlich nur 1–4 % der

geborenen Nachkommen das

Fremdgen integriert haben und damit

als ‘transgen’ bezeichnet werden

können. Zudem erfolgt die Integration

zufällig in das Wirtsgenom,

FORSCHUNGSREPORT 2/1998

BIOTECHNOLOGIE

und die Expression des fremden

Gens kann durch das umgebende

Genom beeinflußt werden. Deshalb

wird intensiv nach effizienteren Alternativen

gesucht. Dazu müssen geeignete,

in der in-vitro-Kultur handhabbare

Zellen oder Zellinien verfügbar

sein. Diese scheinen inzwischen

bei landwirtschaftlichen Nutztieren

in Form von fetalen Fibroblasten

(Bindegewebszellen), möglicherweise

auch Keimzell-Vorläuferzellen,

vorhanden zu sein.

Erste Studien haben ergeben,

daß sich diese Zellen relativ leicht

genetisch verändern lassen und zudem

die Integration und Funktionsfähigkeit

des Transgens in vitro geprüft

werden kann. Der Kern einer

solchen transgenen Zelle wird in

eine Empfänger-Eizelle, deren Chromosomen

zuvor entfernt wurden,

eingesetzt (Abb. 2). Auf diese Weise

sind kürzlich erstmals transgene

Schafe und Rinder geboren worden.

DIE MILCHDRÜSE

ALS BIOREAKTOR

Für zahlreiche pharmazeutisch

wirksame Proteine, insbesondere

Blutgerinnungsfaktoren und andere

Blutproteine, überschreitet der Bedarf

bei weitem die heutigen Produktionsmöglichkeiten.

Diese Stoffe

werden überwiegend noch durch

Fraktionierung menschlichen Blutes

gewonnen. Trotz sorgfältigster Kontrollen

besteht dabei das Risiko der

Übertragung viraler Krankheitserreger,

wie Hepatitis B oder HIV. Aufgrund

der aufwendigen und teuren

Reinigungsverfahren sind die benötigten

Proteine zudem extrem teuer.

Durch den Mangel an diesen Proteinen

können Patienten statt der erforderlichen

prophylaktischen Behandlung

häufig nur sporadisch und therapeutisch

behandelt werden, was

erhebliche Beschwerden und Einbußen

in der Lebensqualität verursacht.

Mit Hilfe der Gentechnologie

wird weltweit nach alternativen Pro-

10

duktionswegen gesucht. Die Produktion

biologisch aktiver pharmazeutischer

Proteine mit Hilfe gentechnisch

veränderter Bakterien oder Hefen ist

jedoch meist nicht möglich, da diese

Mikroorganismen nicht die Fähigkeit

besitzen, die primären Genkonstrukte

innerhalb der Zelle korrekt

weiterzuverarbeiten. Proteine sind

nämlich mehr als die bloße Aneinanderreihung

von Aminosäuren, die

durch das Gen kodiert werden. Für

die biologische Wirksamkeit komplexer

Proteine sind auch bestimmte

Modifikationen, wie Glykosylierung,

ß-Hydroxilierungen oder Karboxilierungen,

notwendig. Die hierfür

benötigen Enzyme fehlen den Bakterienzellen

oder Hefen häufig.

Transgene Nutztiere wie Rind,

Schaf, Ziege, aber auch Schwein

produzieren große Mengen Milchproteine,

die leicht durch Melken zu

gewinnen sind. Beispielsweise beträgt

die Syntheserate der Milchdrüse

für endogene Proteine zum Laktationshöhepunkt

etwa 0,1 kg Protein/Tag

beim Schaf und 1 kg/Tag

beim Rind. Da diese enorme Syntheseleistung

auch eine hohe Fremdgenexpression

erwarten läßt, liegt

die Idee nahe, die Milchdrüse als

Bioreaktor zu verwenden. Die Milchdrüsenzellen

transgener Nutztiere

sind in der Lage, die erforderlichen

Modifikationen an den Fremdproteinen

durchzuführen, die für eine biologische

Aktivität erforderlich sind.


Abb. 1: Mikroinjektion in den Vorkern

einer Schafzygote bei 320facher mikroskopischer

Vergrößerung.

Allerdings ist der finanzielle Aufwand,

um ein exprimierendes Tier zu

erstellen, aufgrund der geringen Effizienz

des Gentransfers über Mikroinjektion

noch sehr hoch. Da die Genkonstrukte

aber nach den Mendel’schen

Regeln weitervererbt werden,

stehen nach einem entsprechenden

Zeitraum homozygote, also reinerbige

Individuen zur Verfügung. Nachdem

eine solche transgene Linie erst

einmal etabliert ist, sind die Haltungskosten

für die Tiere gering, auch

BIOTECHNOLOGIE

im Verhältnis zu anderen Produktionssystemen.

Die Proteine müssen aus

der Milch gewonnen, aufgereinigt

und als pharmazeutisch wirksame

Substanzen aufbereitet werden.

Inzwischen sind mehrere Proteine

in der Milchdrüse transgener Tiere

teilweise in beachtlichen Konzentrationen

produziert worden (Tabelle 2).

Prominentestes Beispiel ist sicherlich

die Produktion von �-Anti-Trypsin in

der Milchdrüse des transgenen Schafes

„Tracy” (Abb. 3). �-Anti-Trypsin ist

der Hauptgegenspieler des Enzyms

Elastase, das den Abbau während

des kontinuierlichen Ab- und Neuaufbaus

des Gewebes steuert. Ein genetisch

bedingter Mangel oder vollständiges

Fehlen von �-Anti-Trypsin

führt zu gesteigertem Gewebeabbau,

der besonders in der Lunge manifest

wird. Von diesem genetischen

Defekt sind in Europa und Amerika

etwa 100.000 Menschen betroffen.

Die benötigten Mengen an �-Anti-

Trypsin können durch Isolierung aus

menschlichem Blutplasma nicht gewonnen

werden.

Bei dem Schaf „Tracy” lag die Expressionshöhe

in der Milch bis zu

63 g pro Liter, bei durchschnittlich

35 g pro Liter während der gesamten

Laktation. Das aus der Milch aufgereinigte

Protein war vollständig

11

und korrekt glykosiliert und besaß

eine nahezu identische biologische

Aktivität wie das humane �-Anti-

Trypsin-Präparat.

Inzwischen sind neben dem �-

Anti-Trypsin auch der Tissue Plasminogen

Activator (TPA), eine Substanz,

die hochwirksam Blutgerinnsel

aufzulösen vermag, und Antithrombin

III, eine gerinnungshem-

mende Substanz, in der Milchdrüse

transgener Schafe und Ziegen produziert

und aufgereinigt worden.

Diese drei Substanzen befinden sich

bereits im fortgeschrittenen Stadium

der klinischen Prüfung. Bei deren positiven

Ausgang wird damit gerechnet,

daß sie im Jahre 2001 bis

2002 auf den Markt kommen. Dies

sind dann die ersten pharmazeutischen

Proteine, die aus der Milchdrüse

transgener Tiere für therapeutische

Zwecke bereitgestellt werden

Tab. 2: Transgene landwirtschaftliche Nutztiere mit milchdrüsenspezifischer Expression pharmazeutischer Proteine

Mikroinjizierte Nachkommen Transgene Nach- Expressionshöhe

Tierart Genkonstrukt übertragene Eizellen Anzahl/(%)* kommen/Exp.* (pro ml) Autoren

Schaf �-lac-hFIX 307 57 (18,6) 4/2 25 ng Simons et. al. (1988); Clark et al. (1989)

Schaf �-lac-hαAT 439 113 (25,7) 5/4 35 mg (bis 63 mg) Wright et al. (1991)

Schaf �-lac-hFVIII-MT-I 277 103 (37,2) 6/3 5 – 10 ng Niemann et al. (1996, 1997)

Schaf MAR �-lac-hFVIII-MT-I 255 94 (36,9) 4/1 mRNA Niemann et al. (1996)

Ziege mWAP-LA-tPA 203 29 (14,3) 2/1 2 – 3 mg Ebert et al. (1991)

Schwein mWAP-hPrC 320 26 ( 8,2) 7 1 mg Velander et al. (1992)

Rind �-cas-hLF 129 19 (14,7) 2/1 � 30 mg Lee and de Boer (1994);

Krimpenfort et al. (1991)

Rind �-cas-hERY 859 1 ( 0,1) 1/0 – Hyttinen et al. (1994)

�-lac = ß-Lactoglobulin

FIX = humaner Blutgerinnungsfaktor IX

hPrC = humanes Protein C

MAR = Matrix Attachment Regions

h�AT = humanes �-Anti-Trypsin

hLF = humanes Laktoferrin

�-cas = boviner Caseinpromotor

hFVIII = humaner Blutgerinnungsfaktor VIII

hERY = humanes Erythropoetin

mWAP = muriner saurer Molkenproteinpromotor

LA-tPA = Gewebe Plasminogen-Aktivator

MT-I = Murines Metallothionein I

* Die Angaben sind folgendermaßen zu verstehen: Aus 307 übertragenen Eizellen (im Fall der transgenen Schafe mit β-lac-hFIX-Genkonstrukt) sind 57 Nachkommen (= 18,6 %) hervorgegangen, davon

waren 4 Tiere transgen, von diesen exprimierten 2 das entsprechende Protein.

2/1998 FORSCHUNGSREPORT

Die Milchdrüse

als Bioreaktor:

Aus der Milch

transgener

Kühe, Schafe

und Ziegen

sollen pharmazeutisch

wirksame

Proteine

gewonnen

werden.


können. Angesichts dieser äußerst

komplexen und schwierigen Technologie

ist die kurze Entwicklungszeit

von annähernd 20 Jahren besonders

bemerkenswert. Diese Arbeiten

sind im wesentlichen durch zwei

Biotechnologie-Firmen, Genzyme

Transgenics in den USA und Pharmaceutical

Proteins Ltd. (PPL) in

Schottland, durchgeführt worden.

In eigenen Forschungsarbeiten

am FAL-Institut für Tierzucht und Tierverhalten

ist in engster Kooperation

mit der Arbeitsgruppe Zellbiologie

des Fraunhofer Instituts in Hannover

der menschliche Blutgerinnungsfaktor

VIII in der Milchdrüse transgener

Schafe exprimiert worden. Genetisch

bedingter Mangel oder vollständiges

Fehlen von Faktor VIII hat

das klinische Bild der Hämophilie A

zur Folge. Dabei handelt es sich um

die am weitesten verbreitete genetisch

bedingte Blutgerinnungsstörung

beim Menschen („Bluterkrankheit”).

Zur Behandlung werden

überwiegend Plasmapräparate eingesetzt,

die vielfach mit pathogenen

Viren kontaminiert und zudem mengenmäßig

völlig unzureichend verfügbar

sind.

Das Faktor VIII-Gen ist ein besonders

großes und extrem komplex reguliertes

Gen, was eine effiziente

Expression in der Milchdrüse transgener

Tiere besonders schwierig

macht. In den bisherigen Untersuchungen

ist gezeigt worden, daß

Faktor VIII-Foundertiere lebensfähig

sind und die Genkonstrukte von

transgenen Tieren weitervererbt werden,

daß das Genkonstrukt in der

Milchdrüse korrekt prozessiert wird

und biologische Wirksamkeit entfaltet.

In zukünftigen Forschungsarbeiten

soll die Expressionshöhe durch

neuartige Genkonstrukte erhöht werden.

Berechnungen haben ergeben,

daß bereits 20–25 Schafe den

gesamten Jahresbedarf der USA an

Faktor VIII (ca. 120 g) decken könnten,

und zwar unter der Voraussetzung

einer Expressionshöhe von

0,01 g/ltr. und einer Ausbeute von

nur 10 % des Proteins.

FORSCHUNGSREPORT 2/1998

BIOTECHNOLOGIE

XENOTRANSPLANTATION

Viele Menschen verdanken ihr Leben

der Übertragung eines geeigneten

Organs. In solchen Fällen existierte

keine alternative Behandlungsmöglichkeit,

und der Empfänger

wäre ohne die Organtransplantation

gestorben. Die großen medizinisch-technischen

Fortschritte bei

der Organtransplantation, die heute

das Überleben vieler Kranker gewährleisten,

haben jedoch weltweit

zu einem akuten Mangel an Spenderorganen

geführt. Während die

Nachfrage nach transplantierbaren

Organen jährlich um circa 15 %

steigt, ist die Bereitschaft zur Organspende

in etwa gleich geblieben

oder sogar gesunken. Schätzungen

in den USA haben ergeben,

daß für 45.000 Menschen, jünger

als 65 Jahre, eine Herztransplantation

notwendig ist, aber nur

2.000 menschliche Herzen pro Jahr

zur Verfügung stehen. Deshalb sterben

heute in jedem Jahr viele tausend

Patienten, die bei Verfügbarkeit

geeigneter Organe überleben

könnten.

Um diese immer größer werdende

Lücke zwischen Nachfrage und

Verfügbarkeit geeigneter Organe

schließen zu können, wird heute die

Xenotransplantation – das heißt

Übertragung von Organen zwischen

nichtverwandten Arten, zum

Beispiel von Tieren auf den Menschen

– als beste Lösung angesehen.

Dabei ist das Schwein offenbar

besonders geeignet, da dessen Organe

in etwa die gleiche Größe

und eine ähnliche Physiologie und

Anatomie wie die des Menschen

besitzen. Charakteristisch für das

Schwein sind außerdem kurze Reproduktionszyklen

und große Nachkommenzahlen

sowie schnelles

Wachstum. Darüber hinaus sind die

Haltungskosten auch unter hygienisch

hohem Standard relativ niedrig.

Die wesentliche immunologische

Hürde, die überwunden werden

muß, ist die hyperakute Abstoßung,

12

Abb. 3: Das transgene Schaf „Tracy” mit

Nachkommen im schottischen Roslin-

Institut

(Foto: Ges. für Biotechnische Forschung)

die innerhalb von Sekunden bis Minuten

nach Übertragung eines Xenotransplantats

eintritt. Im Falle der

Übertragung von Organen des

Schweins auf den Menschen reagieren

die menschlichen Antikörper

auf Antigene auf der Oberfläche

des Fremdorgans. Diese Antikörper

aktivieren das Komplementsystem,

eines der Hauptabwehrsysteme im

Blut des Empfängers, und die Antikörper-Komplementkomplexezerstören

die Gefäßinnenauskleidung

des Fremdorgans und damit letztlich

das Organ selbst.

Dementsprechend zielt die Strategie,

Schweine genetisch zu verändern,

im wesentlichen darauf ab,

diese hyperakute Abstoßungsreaktion

zu überwinden. Dies kann durch

Synthese humaner Komplementregulatoren

im Schwein offenbar erreicht

werden. Nach Transplantation in

den Empfänger würde das Schweineorgan

diese Regulatoren produzieren

und damit die Komplementattacke

des Empfängers ausschalten.

Inzwischen sind transgene

Schweine erstellt worden, die humane

Komplementregulatoren exprimieren

und deren Herzen in Primaten

übertragen worden sind. Die

durchschnittliche Überlebensrate betrug

30–60 Tage, während die


nichttransgenen Kontrollen bereits innerhalb

weniger Minuten zerstört

wurden. Empfängerprimaten mußten

allerdings mit immunsuppressiven

Medikamenten behandelt

werden, um die akute

Abstoßungsreaktion, die auch bei

der Transplantation menschlicher

Organe auftritt, zu beherrschen.

Eine andere Strategie für eine erfolgreiche

Xenotransplantation könnte

die Ausschaltung der auf der

Oberfläche der Schweineorgane

befindlichen antigenen Strukturen

betreffen. Diese sind als 1,3ß-Gal-

Epitope bekannt. Da jedoch bei

Nutztieren – anders als bei der

Maus – noch keine effektiven Verfahren

zum Knock-out (= Ausschaltung)

von Genen bekannt sind, wird

versucht, die Enzyme, die für die Bildung

dieser Epitope verantwortlich

sind, kompetetiv durch Überproduktion

eines anderen Enzyms zu unterdrücken.

UMSETZUNG

IN DIE PRAXIS

Am weitesten ist die Entwicklung

der Xenotransplantation bisher bei

der Firma Imutran, einer Tochter der

schweizer Firma Novartis, gediehen.

Sie besitzt bereits umfangreiche

Erfahrungen mit der Übertragung

von Herzen aus transgenen

Schweinen in Primaten. Allerdings

sind die beantragten klinischen Tests

zunächst zurückgestellt worden, um

weitere Erkenntnisse zur potentiellen

Übertragung von Krankheitserregern

zu gewinnen.

In den USA werden zur Zeit Experimente

durchgeführt, in denen

das Blut von leberkranken Patienten

durch eine außerhalb des Körpers

befindliche Schweineleber geführt

wird. Dies stellt eine Überbrückungsmaßnahme

dar, bis ein geeignetes

humanes Organ beschafft werden

kann.

Wesentlich für eine erfolgreiche

Anwendung der Xenotransplantation

wird die Klärung der Frage sein,

BIOTECHNOLOGIE

inwieweit endogene Retroviren vom

Xenotransplantat auf den Menschen

übergehen können. Es wird heute

davon ausgegangen, daß durch

entsprechend hohe hygienische

Standards und prophylaktische Behandlungen

das Risiko einer Übertragung

anderer Erreger weitgehend

ausgeschaltet werden kann.

Daneben wird auch bedeutsam

sein, inwieweit die Fremdorgane im

Empfänger ihre Aufgaben hinreichend

erfüllen. In einem größeren

Kooperationsprojekt mit mehreren

Arbeitsgruppen, unter anderem

auch an der Medizinischen Hochschule

Hannover, werden in eigenen

Forschungsarbeiten transgene

Schweine erstellt, die für Xenotransplantations-Forschungsarbeitenverwendet

werden können (Abb. 4). Erste

Ergebnisse zeigen, daß die eingesetzten

Transgene an die Nachkommen

weitergegeben und auch

exprimiert werden.

Prognosen besagen, daß die Xenotransplantation

im Verlaufe der

nächsten 8–10 Jahre klinisch einsetzbar

sein wird, wobei vor allem

Herz, Lunge und auch Niere verwendet

werden können. Bei der Leber

erscheint dies hingegen – wesentlich

bedingt durch die umfangreiche

Syntheseleistung biologisch

wirksamer Substanzen – fraglich.

Mit der Verfügbarkeit geeigneter Xenotransplantate

könnten viele der

bedrückenden Probleme, die durch

den Mangel an geeigneten Organen

auftreten, gemildert werden.

Dies ist auch angesichts der Tatsache

bedeutsam, daß alternative Verfahren,

wie künstliche Organe und

Zellinien, offenbar in absehbarer

Zeit nicht zur Verfügung stehen werden.

SCHLUßFOLGERUNGEN

Transgene Nutztiere bieten beachtliche

Perspektiven zur Lösung

dringender Fragen in der Humanmedizin.

Die Entwicklung auf diesem

Sektor ist erheblich weiter als

13

auf dem landwirtschaftlichen Anwendungssektor

für transgene Nutztiere.

Es ist davon auszugehen, daß

Produkte bzw. Organe transgener

Tiere innerhalb der nächsten

10 Jahre einen wichtigen Bestandteil

neuzeitlicher Therapieformen

ausmachen werden und zu beträchtlichen

Verbesserungen in der medizinischen

Versorgung bei zahlreichen

Patientengruppen beitragen

werden.

Jüngste Forschungsergebnisse, in

denen erstmals transgene Tiere über

die Verwendung transfizierter Zellen

und Kerntransfer erstellt wurden, lassen

vermuten, daß die Effizienz des

Gentransfers sowohl qualitativ als

auch quantitativ in absehbarer Zukunft

erheblich verbessert werden

wird. Dies wird auch die Entwicklung

von Anwendungsmodellen für

transgene Nutztiere mit Merkmalen

im engeren landwirtschaftlichen Sinne

möglich machen, zumal die

Kenntnisse über Gene und deren

Funktionen auch in diesem Bereich

stark im Zunehmen begriffen sind.

Aufgrund dieser vielversprechenden

Perspektiven sollte diese Technologie

deshalb intensiv weiterverfolgt

und verbessert werden. ■

Prof. Dr. Dr. habil. Heiner Niemann,

Bundesforschungsanstalt für Landwirtschaft

(FAL), Institut für Tierzucht

und Tierverhalten Mariensee,

31535 Neustadt a. Rbg.

2/1998 FORSCHUNGSREPORT

Abb. 4:

Transgene

Schweine im

FAL-Institut in

Mariensee.

Mit den Tieren

werden

Möglichkeiten

der Xenotransplantation

erforscht.


In der Nutztierzucht hängt die

Zeit, die für eine meßbare Veränderung

von Merkmalen in Richtung des

Zuchtzieles benötigt wird, von verschiedenen

Faktoren ab. Wichtige

Fragen sind zum Beispiel: Wie stark

unterscheiden sich die Individuen einer

Population in Bezug auf das Selektionsmerkmal,

in welchem Maße

wird das Merkmal in der nächsten

Generation ausgeprägt und wie lange

brauchen die neugeborenen

Merkmalsträger, um selbst wieder

zur Zucht herangezogen zu werden.

Bei langer Tragezeit und geringer

Anzahl von Nachkommen pro Muttertier

dauert es entsprechend lange,

bis züchterisch auf veränderte

Umweltbedingungen oder neue Ansprüche

der Konsumenten reagiert

werden kann.

Leistungsmerkmale innerhalb einer

Tierpopulation werden über die

Keimzellen (Spermien und Eizellen)

an die folgende Generation weitergegeben.

Sind einzelne Individuen

der Population aufgrund herausragender

Leistungen in besonderem

Maße zur Zucht geeignet, führt eine

frühzeitige und verstärkte Nutzung

BIOTECHNOLOGIE

In-vitro-Erzeugung von

Rinderembryonen

Ultraschallgeleitete Entnahme von Eizellen beschleunigt den

Zuchterfolg

Thomas Greising (Dummerstorf)

Bei Kulturpflanzen sorgen leistungsfähige und angepaßte Sorten für einen hohen Ertrag.

Der Züchtung kommt hier eine Schlüsselstellung zu. Für die Nutztierhaltung liegen die

Dinge ähnlich. Doch während in der Pflanzenzüchtung mit kurzlebigen, in der Regel

einjährigen Arten gearbeitet wird, hat die Züchtung bei Nutztieren mit wesentlich längeren

Generationsintervallen zu kämpfen. Da zudem – gerade bei größeren Nutztieren wie Rindern

– die Zahl der Nachkommen relativ gering ist, dauert es lange, bis sich ein Züchtungsziel

in der Population stabil ausprägt. Mit biotechnologischen Methoden ist es möglich, sowohl

die Generationsintervalle zu verkürzen als auch die Nachkommensrate zu erhöhen.

FORSCHUNGSREPORT 2/1998

ihres Keimzellpotentials zu einer erhöhten

Anzahl von Nachkommen,

die Träger der Erbanlagen für dieses

Leistungsmerkmal sind.

In den letzten Jahren wurden moderne

biotechnische Verfahren zur

Kontrolle und Steuerung der Fortpflanzung

entwickelt, die den Tierzüchter

bei der Zucht gesunder,

fruchtbarer Tiere unterstützen können

und zu einem schnelleren Zuchterfolg

verhelfen.

DIE VATERTIERE

In der Rinderzucht ist es durch die

Entwicklung der künstlichen Besamung

möglich geworden, die

züchterischen Ressourcen ausgewählter

männlicher Tiere besser zu

nutzen. Kontinuierliche Samengewinnung

und Tiefgefrierkonservierung

verdünnter Ejakulatportionen

erlauben es, das genetische Potential

leistungsstarker Bullen in einem

weitaus stärkeren Maße zur Zucht

zu nutzen, als das zuvor durch den

natürlichen Deckakt möglich gewesen

ist.

14

SCHWIERIGKEITEN BEI

DER NUTZUNG WEIB-

LICHER KEIMZELLEN

Problematischer gestaltete sich

die verstärkte Nutzung des Keimzellpotentials

weiblicher Hochleistungsrinder.

Säugetiere verfügen bei ihrer

Geburt auf den Ovarien (Eierstöcken)

über etwa 400.000 Follikel

und in diesen Follikeln über je

eine Eizelle. Trotz dieser enorm

großen Zahl ist die Entwicklungsrate

zur befruchtungsfähigen Eizelle

äußerst gering. Bis auf wenige Ausnahmen

reift in jedem ovariellen Zyklus

beim Rind nur eine einzige Eizelle

soweit heran, daß sie befruch-


Umsetzen von tiefgefrierkonservierten

Embryonen aus der Gefriermaschine in

den Container

tet werden kann. Die Anzahl erzeugter

Nachkommen pro Kuh ist

daher relativ gering. Oft sind es

nicht mehr als fünf Kälber, die von einem

Muttertier geboren werden.

Damit ist die Möglichkeit, die Erbanlagen

weiblicher Hochleistungsrinder

auf konventionelle Weise

in der Zucht zu nutzen, sehr beschränkt.

BIOTECHNOLOGIE

DER EMBRYOTRANSFER

Anfang der 70er Jahre wurde das

Verfahren des Embryotransfers beim

Rind entwickelt.

Die sogenannte Superovulationsbehandlung

– ein Teilschritt dieses

Verfahrens – stellt einen wichtigen

Meilenstein bei der verstärkten Nutzung

des weiblichen Keimzellpotentials

dar. Unter Superovulation versteht

man die gezielte Behandlung

von Kühen und Färsen mit Hormonen,

die dazu führt, daß auf den

Ovarien dieser Tiere vermehrt Follikel

und damit befruchtungsfähige Eizellen

heranreifen. Nach der Ovulation

(Eisprung) werden durch künstliche

Besamung statt einem gleich

mehrere Embryonen erzeugt, die

durch Spülung von Eileiter und Uterus

aus dem Spendertier gewonnen

werden können.

Die Embryonen werden in Empfängertiere

transferiert und von ihnen

ausgetragen. Pro Behandlung und

Spendertier liegt die Erfolgsrate derzeit

bei etwa 5-7 transfertauglichen

Embryonen, von denen sich in der

Regel 2-3 zu Kälbern entwickeln.

Bei wiederholter Nutzung dieses

Verfahrens sind bis zu 100 Nachkommen

pro Kuh möglich.

Superovulation und Embryotransfer

tragen als Komplex dazu bei, die

Erbanlagen weiblicher Hochleistungstiere

in wesentlich stärkerem

Maße in die Gesamtpopulation einzubringen,

als es durch ‘klassische’

künstliche Besamung der Tiere möglich

wäre.

Abb. 1:

Die ultraschallgeleitete

Follikelaspiration

beim Rind.

A) Die Ultraschallsonde

wird durch den Tierarzt

fixiert und die

Aspirationskanüle

durch einen Helfer

eingeführt.

B) Ultraschallbild

eines Rinder-Ovars.

15

DIE FORSCHUNG

Obwohl Superovulation und Embryotransfer

beim Rind mittlerweile

feste Bestandteile der Arbeit von

Zuchtverbänden sind, wird weiter

an ihrer Optimierung gearbeitet.

Beiden Verfahren liegen äußerst

komplexe biologische Mechanismen

zugrunde, derenCharakterisierung

ein breites Methodenspektrumerfordert.

Die Untersuchungen

an lebenden

Tieren dienen

dabei als Grundlage

für die Erarbeitung

von Modellen

zur Simulation physiologischerVorgänge.

Ziel ist es, zelluläre

und systemischeRegulationsmechanismen

genauer

zu untersuchen und

zu entschlüsseln. Die komplexe Nutzung

zellphysiologischer, biochemischer

und klinischer Methoden trägt

neben dem wissenschaftlichen Erkenntnisgewinn

auch zur Entwicklung

von innovativen biotechnischen

Verfahren bei. Ein Beispiel hierfür ist

die ultraschallkontrollierte Entnahme

von Eizellen aus den Follikeln (Follikelaspiration),

die als Grundlage für

die In-vitro-Produktion von Embryonen

dient.

DIE TRANSVAGINALE

ULTRASCHALLGELEITETE

FOLLIKELASPIRATION

Superovulation und Embryotransfer

waren zunächst die einzigen

Möglichkeiten, das Eizellpotential

weiblicher Hochleistungsrinder in

verstärktem Maße zu Zucht zu nutzen.

Nach wie vor war man aber

darauf angewiesen, die Kühe künstlich

zu besamen und die Embryonen

durch Spülung von Eileiter und Uterus

zu gewinnen. Mit der Entwicklung

von In-vitro-Techniken zur Eizell-

2/1998 FORSCHUNGSREPORT

Laden des

Transfergerätes

mit einem

aufgetauten

TG-Embryo

vor der

Übertragung


Abb. 2:

Zwei Rinderembryonen

im

Stadium der

Blastozyste,

8 Tage nach der

Befruchtung

der Eizellen.

reifung, Befruchtung und Embryokultur

eröffnete sich die Möglichkeit,

Embryonen auch außerhalb des Organismus

zu erzeugen.

Das Problem bei der praktischen

Anwendung bestand allerdings darin,

daß zur Eizellgewinnung anfangs

nur die Ovarien geschlachteter

Rinder genutzt werden konnten.

Von lebenden Tieren ließen sich keine

frischen unbefruchteten Eizellen

gewinnen. Die sogenannte ultraschallgeleitete

Follikelaspiration hat

hier zu einem Durchbruch geführt.

Bei diesem Verfahren werden die

Ovarien des Eizellspenders und

eine transvaginal eingeführte Kanüle

mittels Ultraschallsonde auf einem

Monitor sichtbar gemacht (Abb. 1).

Dadurch kann der Tierarzt das Absaugen

von Follikelflüssigkeit und Eizellen

auf dem Bildschirm genau

verfolgen. Für die Spendertiere stellt

dieser Eingriff keine starke Belastung

dar, er kann daher in regelmäßigen

Abständen wiederholt werden.

UNTERSUCHUNGEN

AM FBN

Seit mehreren Jahren werden im

Forschungsbereich Fortpflanzungsbiologie

des Forschungsinstituts für

die Biologie landwirtschaftlicher

Nutztiere (FBN) in Dummerstorf

grundlagenorientierte Forschungsarbeiten

zur ultraschallgeleiteten Follikelaspiration

durchgeführt. Ein Team

von Wissenschaftlern untersucht derzeit

den Einfluß verschiedener Fakto-

FORSCHUNGSREPORT 2/1998

BIOTECHNOLOGIE

ren auf die Effizienz der Technik. Im

Vordergrund stehen dabei das Alter,

der Zyklusstand und die hormonelle

Behandlung der Tiere. Die gewonnenen

Daten geben Auskunft über

die Auswirkungen biologischer Einflußgrößen

auf die Anzahl und Qualität

der Eizellen. Die Optimierung

technischer Details wie Aspirationsdruck,

Ultraschallsonde und Aspirationssystem

soll dazu beitragen, die

Methode als neue Biotechnik in

größerem Rahmen als bisher für die

Praxis nutzbar zu machen. Gegenwärtig

können in Dummerstorf im

Mittel sechs reifungstaugliche Eizellen

pro Spendertier und Aspiration

gewonnen und für die Embryonenproduktion

in vitro genutzt werden.

Im Labor werden die gewonnenen

Eizellen in Abhängigkeit von

der hormonellen Vorbehandlung der

Tiere, vom Gewinnungszeitpunkt

und vom morphologischen Zustand

der Eizellen gereift. Bei ihrer Befruchtung

konnte ein Einfluß des Bullen

auf die Befruchtungsrate nachgewiesen

werden. Durch verschiedene

Medienzusätze soll die Effizienz der

Embryoproduktion optimiert werden.

Derzeit ist es möglich, aus den

gewonnen Eizellen im Durchschnitt

20 % Morulae und Blastozysten – erste

Entwicklungsstadien auf dem

Weg zum Embryo – zu erzeugen

(Abb. 2). Nachdem die ultraschall-

16

geleitete Follikelaspiration anfänglich

nur bei „Problemtieren” angewandt

worden ist, also bei Kühen,

die auf die Superovulationsbehandlung

nicht angesprochen haben

oder von denen aus anderen Gründen

keine Embryonen gewonnen

werden konnten, stehen mittlerweile

vor allem tragende Tiere bis zum

vierten Trächtigkeitsmonat sowie

Kälber und Jungtiere im Mittelpunkt

des Interesses der Forscher.

NUTZEN FÜR

DIE TIERZUCHT

Besonders vielversprechend im

Hinblick auf eine Beschleunigung

des Zuchtfortschrittes ist die Nutzung

von Tieren noch vor der Geschlechtsreife.

Durch die beschriebenen

Techniken wird es möglich,

Nachkommen auch von Tieren zu

erzeugen, die aufgrund ihres geringen

Alters noch nicht in der konventionellen

Zucht verwendet werden

können. Eine frühere Nutzung der

Jungtiere, das heißt eine Verkürzung

des Generationsintervalls, bedeutet

eine erhöhte Anzahl von Nachkommen

pro Muttertier und damit eine

größere Einflußnahme ihrerseits auf

den Zuchtfortschritt.

Diese Tatsache gewinnt besondere

Bedeutung im Zusammenhang mit


sogenannten MOET-Zuchtprogrammen.

Diese Programme sind dadurch

gekennzeichnet, daß die

Zucht ausschließlich innerhalb bestimmter

kleiner Kernpopulationen

stattfindet. Charakteristisch für diese

Programme ist die Tatsache, daß die

Prüfung des Zuchtfortschrittes nicht

anhand umfangreicher Nachkommengruppen

durchgeführt wird, sondern

stattdessen Prüfungsergebnisse

von Ahnen, Voll- und Halbgeschwistern

herangezogen werden. Ausschlaggebend

für die Zuverlässigkeit

einer so gefällten Selektionsentscheidung

ist die Anzahl und Aussagekraft

der Informationen über Eltern

und Geschwistertiere. Zwangsläufig

ergibt sich damit die Forderung

nach einer hohen Anzahl an Nachkommen

pro Elternpaar. Die Kombination

von ultraschallgeleiteter Follikelaspiration

und In-vitro-Techniken

zur Embryoproduktion stellt eine

Möglichkeit dar, dieser Forderung

gerecht zu werden.

RESÜMEE

Wissenschaftliche Erkenntnisse

haben mehr und mehr Eingang in

die moderne Tierzucht gefunden.

Damit ein rascher Wissens- und

Technologietransfer in die Praxis sichergestellt

wird, sollten Grundla-

BIOTECHNOLOGIE

genforschung und praktische Anwendung

nicht voneinander getrennt

werden.

Einzelne Methoden und Modelle

fortpflanzungsbiologischer Grundlagenforschung

bieten die Möglichkeit,

die Prozesse von Keimzellentwicklung

und Befruchtung bis hin zur

Wechselwirkung von Embryo und

Muttertier genauer zu durchdringen.

Für die praktische Nutzung dieses

Wissens ist es oft notwendig, verschiedene

Techniken innerhalb eines

biotechnischen Verfahrens zusammenzufügen.

Die Möglichkeit, durch ultraschallgeleitete

Follikelaspiration in regelmäßiger

Folge Eizellen vom lebenden

Tier zu gewinnen, eröffnet dem

17

Tierzüchter in Kombination mit den

In-vitro-Techniken der Reifung, Befruchtung

und Embryokultur sowie

dem Embryonentransfer neue Perspektiven.

Mit Hilfe dieses Methodenkomplexes

wird er in die Lage

versetzt, das Generationsintervall zu

verkürzen und das genetische Potential

weiblicher Hochleistungstiere

verstärkt für die Zucht zu nutzen.

Alle genannten biotechnischen

Verfahren haben derzeit einen

Stand erreicht, der ihre praktische

Nutzung möglich macht.

Nun kommt es darauf an, den aus

der Praxis erfolgenden Informationsrücklauf

in die fortlaufenden Forschungsarbeiten

zu integrieren, um

die Systeme weiter zu verbessern.

Wissenschaft und Praxis im Komplex

schaffen so die Möglichkeit,

den ökonomischen Anforderungen

in der Landwirtschaft weiter gerecht

zu werden. ■

Dr. Thomas Greising, Forschungsinstitut

für die Biologie landwirtschaftlicher

Nutztiere, Forschungsbereich

Fortpflanzungsbiologie, Wilhelm-

Stahl-Allee 2, 18196 Dummerstorf

2/1998 FORSCHUNGSREPORT

Rinderembryo

30 Tage nach

Befruchtung

(links: Größe

etwa 10 mm)

und 10 Tage

später (unten:

Größe 20 mm)


KONSERVIERUNG VON

WIRTSCHAFTSGETREIDE

In der Bundesrepublik Deutschland

werden regelmäßig 50-85 %

des Getreides in nicht lagerfähigem

Zustand mit Feuchten über 14 % gedroschen.

Um dem Verderb vorzubeugen,

müssen geeignete Konservierungsmaßnahmen

durchgeführt

werden. Solche Verfahren sollten an

die Feuchte des Ernteguts, den Verwendungszweck

und die vorhande-

BIOTECHNOLOGIE

Gesündere Tiere

durch besseres Futter

Christine Idler, Christian Fürll, Thomas Ziegler

und Reiner Brunsch (Potsdam-Bornim)

In der modernen Tierhaltung besteht ein großer Teil der eingesetzten Futtermittel aus

Konservaten. Dies trifft nicht nur auf Getreide in der Schweine- und Geflügelproduktion

zu, auch in der Rinderhaltung werden überwiegend Konservate – meist in Form

von Silagen und wirtschaftseigenem Getreide – verfüttert. Die Qualität dieses Futters

hängt einerseits von den Nährstoffen, Spurenelementen und Vitaminen ab, andererseits

aber auch von unerwünschten Stoffen wie Verschmutzungen oder Toxinen. Pilzbefall

und damit verbundene Mykotoxine (Gifte von Schimmelpilzen) stellen eine schleichende

Gefahr für die Leistungsfähigkeit und Gesundheit der Nutztiere dar. So wurde festgestellt,

daß Milchkühe weniger Futter aufnehmen, wenn die Silage Mykotoxine enthält.

In der Schweinezucht sind erhöhte Totgeburtenraten, schlechte Fruchtbarkeit und gestiegene

Ferkelverluste als Folge von Mykotoxinen im Mischfutter beobachtet worden.

Um derartiges zu vermeiden, muß die Verfahrenstechnik Voraussetzungen schaffen, die

eine Bildung unerwünschter Pilze in Futterkonservaten verhindern.

FORSCHUNGSREPORT 2/1998

ne technische Ausstattung angepaßt

sein, um die Kosten zu senken. Im Institut

für Agrartechnik Bornim (ATB)

werden verschiedene Verfahren zur

Konservierung von Futtergetreide untersucht

und bewertet. Im folgenden

werden drei unterschiedliche Ansätze

für neue Konservierungsverfahren

für Futtergetreide vorgestellt.

Chemische Konservierung

durch Milchsäure

Zur chemischen Konservierung

werden am häufigsten Propionsäure

oder Mischungen anderer Säuren

eingesetzt. Die Wirkungsweise dieser

Konservierungsmittel beruht auf

der Abtötung und/oder Inaktivierung

der am Korn anhaftenden Mikroorganismen.

Der Umgang mit Propionsäure ist

aus Gründen des Umwelt- und Arbeitsschutzes

nicht ganz unproblematisch.

Eine Alternative kann hier

Milchsäure sein. Sie ist als organische

Säure weniger aggressiv, besitzt

aber vergleichbare konservierende

Eigenschaften. Milchsäure

läßt sich nicht nur auf chemischem

18

Wege herstellen, sondern auch biotechnologisch

auf der Basis nachwachsender

Rohstoffe.

Die Eignung von Milchsäure als

Konservierungsmittel konnte am ATB

in verschiedenen Modellversuchen

an erntefeuchter beziehungsweise

Abb. 1: Einfluß von unterschiedlichen Säuren auf d

melpilzwachstum während der Lagerung von Gerst

nem Feuchtegehalt von 22 %

log Zellzahl in KbE/g FM 1

10 6

10 5

10 4

10 3

10 2

10

0

Schwellenwert

0 1 3 6

Lagerzeit in Monaten

ohne Zusatz 90 % Propionsäure 90 % Mil

1 KbE/g FM Koloniebildende Einheiten/Gramm Frischmasse


s Schime

mit ei-

9

hsäure

wiederbefeuchteter Gerste nachgewiesen

werden (vgl. Abb. 1). Aus

der Abbildung wird deutlich, daß

90 %ige Milchsäure in gleicher Aufwandmenge

wie Propionsäure die

Zahl der Schimmelpilze unterhalb eines

Schwellenwertes von 20.000

koloniebildenden Einheiten pro

Gramm Frischmasse reduzieren

kann. Aufwandmenge und Konzentration

müssen allerdings für eine

qualitätserhaltende einjährige Lagerung

noch optimiert werden. Mit der

Überprüfung der Ergebnisse in der

Praxis wird in diesem Jahr begonnen.

Sollten sich diese günstigen Resultate

in der Praxis bestätigen, stünde

damit dem Landwirt ein preiswertes

Verfahren (ca. 3 DM/dt) zur

Konservierung von Futtergetreide zur

Verfügung.

Bei der biotechnologischen Erzeugung

von Milchsäure mit Hilfe

von Bakterien ist es möglich, überwiegend

die physiologisch vorteil-

BIOTECHNOLOGIE

hafte L(+) - Milchsäure zu produzieren.

Es wird vermutet, daß diese Form

der Milchsäure in konserviertem Futter

probiotische Wirkungen entfaltet

und sich positiv auf die Gesundheit

der Tiere auswirkt. Dies soll in weiterführenden

Arbeiten näher untersucht

werden.

Lagerung unter

Luftabschluß

Eine weitere Möglichkeit ist die

Lagerung von geschrotetem Getreide

bis 20 % Feuchtegehalt unter Luftabschluß.

Dieses Verfahren erscheint

wegen der niedrigen Kosten

(2 DM/dt) und der geringen lagerbedingten

Verluste attraktiv. Seit 5

Jahren untersuchen wir diese Form

der Konservierung in verschiedenen

brandenburgischen Praxisbetrieben

bei erntefeuchter Gerste, Tritikale

und bei Roggen.

Die Verfahrensgestaltung gliedert

sich in folgende Prozesse: Annahme

des Getreides, Zerkleinern, Einlagern

in Fahrsilos, Verdichten des

Schrotes im Silo und Abdecken des

Silos mit Folie. Die Verfahrensabschnitte

„Zerkleinern” und „Verdichten”

wurden besonders intensiv bearbeitet.

Auf Grund der Verdauungsphysiologie

muß das Getreide für die

Schweinefütterung stärker zerkleinert

werden als für die Rinderfütterung.

Beim Schweinefutter sollten 50 %

der Getreidepartikel kleiner/gleich

1 mm sein, während beim Rinderfutter

4 mm ausreichend sind. Für die

Rinder sollte das Korn also lediglich

gequetscht sein, damit das Korninnere

zugänglich wird.

Die Zerkleinerung des Getreides

erfolgt am zweckmäßigsten mit einem

Doppelwalzenstuhl (Abb. 2,

S. 20).

Dieses Verfahren ist energetisch

wesentlich günstiger zu bewerten

als das sonst übliche Zerkleinern mit

Hilfe von Hammermühlen. Hohe Lagerungsdichten

sind nach der Zerkleinerung

eine Grundvoraussetzung

für das Gelingen der Konser-

19

vierung. Während bei fein zerkleinertem

Getreide durch Überfahren

mit schwerem Gerät Lagerungsdichten

bis ca. 1.000 kg/m 3 erzielt

werden können, liegen die Dichten

bei grob zerkleinertem Futter zwischen

700 kg/m 3 und 850 kg/m 3 .

Die Untersuchungen am ATB haben

ergeben, daß auch grob zerkleinertes

Getreide durch eine anaerobe

Lagerung konserviert wird. Bei allen

Versuchsansätzen konnte qualitätsgerechtes

Futter erzeugt werden.

Die Nährstoffverluste waren gering,

ebenso der Besatz an Verderbniserregern.

Der Gehalt an Ochratoxin A

– einem verbreiteten Mykotoxin, das

hauptsächlich von Schimmelpilzen

der Gattungen Penicillium und

Aspergillus gebildet wird – lag bei

allen Varianten unterhalb von

3 µg/kg. Dieser Wert wird zur Zeit

als EU-einheitlicher Grenzwert für

Ochratoxin A diskutiert. Der Energiebedarf

konnte um 65 % und die

Kosten um 15 DM/t gesenkt werden.

2/1998 FORSCHUNGSREPORT

Gerste 25 %

Feuchtigkeitsgehalt,

4 Wochen nach

Versuchsbeginn:

Mit

Propionsäure

behandelt

(oben),

unbehandelt

(unten)


Solarunterstützte Trocknung

Speziell in der Landwirtschaft bietet

sich die solare Lufterwärmung für

Trocknungszwecke an, da Ernteperiode

und Hauptenergieangebot der

Sonne im Jahresverlauf zeitlich zusammenfallen.

Bei der möglichst

kontinuierlich durchzuführenden

Satztrocknung von Getreide mit solar

erwärmter Luft muß jedoch auch

bei ungünstigen solaren Einstrahlungsverhältnissen

– also bei bedecktem

Himmel – ein rechtzeitiger

Trocknungsabschluß sichergestellt

sein, um Qualitätseinbußen durch

einsetzende Verderbnisprozesse zu

vermeiden. Im Institut für Agrartechnik

Bornim wird daher an einem

Sorptionsspeicher von solarem

Trocknungspotential gearbeitet, der

durch die Nutzung von Getreide als

Speichermedium neue Realisierungsmöglichkeiten

für die solar unterstützte

Trocknung eröffnet (vgl.

Abb. 3).

Das Prinzip der Sorptionsspeicherung

nutzt die latente Wärmeenergie

des in der Außenluft enthaltenen

Wasserdampfes. Bei der Entfeuchtung

des Speichers – tagsüber mit

solar erwärmter Luft – kühlt sich die

durchströmende Luft infolge der aufzubringenden

Desorptionswärme

ab. Bei der Befeuchtung des Speichers

hingegen – nachts durch

Außenluft – erwärmt sich die durchströmende

Luft durch die freigesetzte

Abb. 2: Doppelwalzenstuhl

FORSCHUNGSREPORT 2/1998

BIOTECHNOLOGIE

Abb. 3: Mehrfachnutzung von Solardach und Sorptionsspeicher für nachgeschaltete

Trocknungsprozesse (schematisch): A = Solardach, B = Sorptionsspeicher,

C = Mischkammer, D = Ventilator, E = Getreidetrocknung; F = Heutrocknung,

G = Holzhackschnitzeltrocknung, � = relative Luftfeuchte

Adsorptionswärme. Im Ergebnis

liegt die relative Feuchte der Speicheraustrittsluft

normalerweise immer

unterhalb der relativen Feuchte

der (nicht erwärmten) Außenluft.

Simulationsrechnungen zeigen,

daß trocknungsfähige Luft mit einer

relativen Feuchte von 65 % auch bei

extrem ungünstigen Witterungsbedingungen

über mehrere Wochen

hinweg Tag und Nacht ohne zusätzliche

Lufterwärmung bereitgestellt

werden kann. Getreide als Spei-

20

chermedium steht im landwirtschaftlichen

Betrieb konkurrenzlos preiswert

zur Verfügung und besitzt gegenüber

technischen Sorbentien,

wie zum Beispiel Silika-Gel, entscheidende

verfahrenstechnische

Vorteile. So verschlechtert Staub die

Sorptionseigenschaften von Silika-

Gel – aber nicht die von Getreide.

Mykotoxinbildung infolge von

Schimmelpilzwachstum im Inneren

des Speichers kann ausgeschlossen

werden, da schädigungsrelevante

Luftzustände praktisch nicht erreicht

werden; das Speichergetreide

bleibt „trocken”, das heißt unterhalb

des bezüglich der Verderbgefährdung

kritischen Wassergehaltes.

Diese Art der Trocknung ist nicht

nur für frisch geerntetes Getreide,

sondern auch für Saatgut, Heu oder

Holzhackschnitzel geeignet. Die

Wirtschaftlichkeit des Verfahrens

wird entscheidend von der Mehrfachnutzung

der Kollektor-Speicher-

Einheit für die nachgeschalteten

Trocknungsprozesse abhängen. Die

vergleichsweise kleine Menge an

Speichergetreide kann nach Abschluß

der Trocknungsperiode als

Viehfutter verwendet werden.


KONSERVIERUNG

VON HALMFUTTER

Grünfutter kann auf verschiedenem

Wege haltbar gemacht werden:

Neben der Bereitung von Heu

ist die Silierung das wichtigste Konservierungsverfahren.

Bei der Silierung

von Grünfutter treten insbesondere

bei schwer vergärbaren Futterstoffen

wie Gräsern und Leguminosen

sowie bei ungünstigen Witterungsbedingungen

immer wieder

Fehlgärungen auf. Diese können zu

erheblichen Qualitätsverlusten und

zur Beeinträchtigung der Tiergesundheit

führen. Viele Faktoren, die

die Silierung beeinflussen, zum Beispiel

die Anzahl der Milchsäurebakterien

im Gärgut oder die Konzentration

an fermentierbaren Kohlenhydraten,

sind zu Beginn des Prozesses

meist nicht optimal vorhanden.

Durch Zusatz von Siliermitteln kann

der Silierprozeß sichergestellt werden.

Neben chemischen Siliermitteln

werden aus Gründen des Arbeitsschutzes

und der Verträglichkeit in

der Tierernährung verstärkt Milchsäurebakterien

als Silage-Impfkulturen

verwendet. Eine Vielzahl solcher

Impfpräparate ist bereits auf dem

Abb. 4: Einfluß unterschiedlicher Bakteriengemische auf das Gärsäurespektrum

von Gras-Silagen nach 90tägiger Fermentation

80

70

60

50

40

30

20

10

0

Gehalt in g/kg TS

Markt. Doch auch bei ihrer Verwendung

bleibt der Siliererfolg zuweilen

aus. Ursache für die Unwirksamkeit

einiger Präparate sind häufig ungeeigneteMilchsäurebakterienstämme.

Die Suche nach wirksamen

Impfkulturen bleibt daher trotz der

Vielfalt der angebotenen Präparate

eine wichtige Aufgabe.

Im Institut für Agrartechnik wurden

über viele Jahre Milchsäurebakterien

isoliert und auf ihre Siliereignung zur

Konservierung von Gras untersucht.

Aus einem Pool von 250 Stämmen

hat sich ein Gemisch aus den Stämmen

Lactobacillus casei und Lactobacillus

rhamnosus ausgezeichnet.

Es beeinflußt das Gärsäurespektrum

positiv (hoher Gehalt an Milchsäure

und geringe Mengen an Buttersäure

und Ammoniak, vgl. Abb. 4) und

führt zu einer besseren Verdaulich-

21

keit der Rohnährstoffe. Seit zwei Jahren

wird diese Bakterienkombination

erfolgreich zur Gras-Silierung unter

Praxisbedingungen eingesetzt. In

diesem Jahr sind auf diese Weise

15.000 Tonnen Welsches Weidelgras

(Lolium multiflorum) in der

Agrargenossenschaft in Niederschöna

einsiliert worden. Zur Zeit

wird an einem Verfahren gearbeitet,

mit dem der Landwirt auf seinem Hof

diese Stämme selbst vermehren und

somit erhebliche Siliermittelkosten

Ammoniak Alkohol Milchsäure Essigsäure Buttersäure

■ ohne Zusatz

■ Bakteriengemisch: Lactobacillus casei, Lactobacillus rhamnosus

■ Bakteriengemisch: Lactobacillus casei, Lactobacillus delbrückii, Enterococcus faecium

pH-Werte

■ 4,14

■ 3,57

■ 3,64

einsparen kann. Die gegenwärtigen

Kosten von ca. 4 DM pro Tonne Siliergut

könnten sich auf 1-2 DM reduzieren.

Im nächsten Jahr wird eine

Pilotanlage dazu in der Agrargenossenschaft

in Niederschöna errichtet

werden.

Alle dargestellten Verfahren zielen

auf die Erzeugung von lagerfähigen,

qualitativ hochwertigen Futtermitteln.

Nährstoffreiches, mykotoxinfreies

Futter ist die Voraussetzung für

eine optimale Ernährung der Nutztiere

und die Erhaltung ihrer Gesundheit

sowie für die Erzeugung unbelasteter

Lebensmittel. ■

Dr. Christine Idler, Prof. Dr.-Ing. habil.

Christian Fürll, Dipl.-Ing. Thomas

Ziegler, Dr. Reiner Brunsch, Institut für

Agrartechnik Bornim e.V., Max-Eyth-

Allee 100, 14469 Potsdam-Bornim

2/1998 FORSCHUNGSREPORT


BIOTECHNOLOGIE

Biotechnologie in

der Käseherstellung

Klaus Pabst, Arnold Geis und Wilhelm Bockelmann (Kiel)

Milch ist nicht gleich Milch: Über den Weg der Tierzucht lassen sich Kühe selektieren,

deren Milch bestimmte Ansprüche hinsichtlich der Inhaltsstoffe erfüllt. Beispielsweise

ist es möglich, die Zusammensetzung des Eiweißes zu beeinflussen,

was die Ausbeute in der Käserei verbessern kann und zu mehr Milchgeld für die Landwirte

führt. In die Verarbeitungsprozesse der Milch haben moderne biotechnologische

Verfahren Einzug gehalten. So dürfen Käsereien gentechnisch hergestelltes Lab-Enzym

zum Dicklegen der Milch einsetzen. Sie müssen dies nicht deklarieren, weil es identisch

ist mit dem traditionell verwendeten Kälber-Lab. Ein wichtiger Prozeß der Käseherstellung

ist die Reifung, die dem Käse seinen typischen Charakter gibt. Die dabei ablaufenden

komplexen Vorgänge beginnt man zu verstehen. Im Rahmen von EU-Forschungsprogrammen

werden erste Versuche unternommen, den Reifungsvorgang mit Hilfe bestimmter

Starterkulturen zu optimieren.

BEDEUTUNG VON

MILCHPROTEINVARIANTEN

Milcheiweiß ist kein einheitlicher

Stoff, sondern aus verschiedenen

Casein- und Molkenproteinfraktionen

zusammengesetzt. In der Milch

liegen die Caseine in Micellen

(Abb. 1) vor, die durch �-Casein stabilisiert

werden. Die Molkenproteine

sind in Lösung.

Jedes Protein wird nach der Vorgabe

von 2 Allelen gebildet (gleichsinnige

Gene auf homologen Chromosomen),

die entsprechend des

väterlichen und mütterlichen Erbguts

verschieden sein können. Das kann

zu unterschiedlichen Aminosäuremustern

führen (Milchproteinvarianten).

Zwischen den einzelnen Rinderrassen

gibt es große Unterschiede

hinsichtlich der Häufigkeit bestimmter

Formen. Positiv wirksame

Allele sind relativ selten. Durch die

Auswahl der Zuchttiere kann ihre

Zahl jedoch angehoben werden.

Im Zusammenhang mit der Herstellung

von Käse ist das �-Casein

von großem Interesse, weil es auf

die Gerinnungseigenschaften der

FORSCHUNGSREPORT 2/1998

Milch wirkt. Kühe mit dem Genotyp

BB haben kleinere und gleichmäßiger

verteilte Micellen als solche mit

dem Genotyp AA. Mischerbige (heterozygote)

Tiere mit dem Genotyp

AB stehen zwischen den Extremen.

Fügt man den verschiedenen Milchtypen

das Gerinnungsenzym Lab

(Chymosin) zu, so gerinnt BB-Milch

schneller, weil die Gesamtoberfläche

der Micellen und damit die

Reaktionsfläche größer ist. Dadurch

entsteht relativ rasch ein dichtes

Netzwerk (Gallerte), in dem mehr

Casein gebunden werden kann.

DER PRAKTISCHE BEZUG

Versuche der Bundesanstalt für

Milchforschung (BAfM) – zunächst

im kleinen Maßstab mit Milch von

Kühen aus der Versuchsstation

Schaedtbek durchgeführt – deuteten

auf eine höhere Käseausbeute bei

der BB-Milch hin. Erkenntnisse dieser

Art können für die Käsereipraxis

von großer Bedeutung sein. Daher

wurden Versuche im Praxismaßstab

geplant, für die die Unterstützung

22

Abb. 1: Modell für den Aufbau einer

Casein-Micelle in der Milch.

von Landwirten und Molkereien notwendig

war.

Zunächst wurde von 2.868

Kühen aus 50 landwirtschaftlichen

Betrieben der Genotyp festgestellt.

153 Kühe mit dem �-Caseingenotyp

BB wurden extra gemolken (BB-

Milch). Die Milch von 542 Kühen

diente als Kontrolle. Die Abend- und

Morgengemelke wurden getrennt

mit einem Tanksammelwagen eingesammelt.

Die Adelbyer Nordfrieslandmilch

eG unterstützte diesen

Teil. Eine Feinkäserei in Sarzbüttel


(Dithmarschen) verarbeitete die

Milch zu Tilsiter Käse.

Die Milch wurde von Angler

Kühen (Abb. 2) in Schleswig-Holstein

gesammelt, weil etwa 12 %

der Kühe den erwünschten Genotyp

BB für das �-Casein haben, wohingegen

bei Schwarzbunten nur 2 %

vorkommen.

Aus der BB-Milch ließ sich 4,6 %

mehr Käse gewinnen als aus der

Kontrollmilch; die Rohstoffkosten wa-

ren um 0,01 DM/kg Milch niedriger.

Bei gleichen Produktionskosten

und gegebenem Käsepreis standen

damit rund 0,04 DM/kg Milch für

eine höhere Milchgeldauszahlung

und zur Begleichung möglicher

Züchtungskosten zur Verfügung.

Es zeigte sich auch, daß BB-Milch

eine höhere Hitzestabilität hat. Dies

könnte sich positiv auf die Qualität

erhitzter Produkte wie Milchpulver

und H-Milch auswirken.

23

BIOTECHNOLOGIE

Natürlich hat man sich gefragt,

ob die Tatsache, daß BB-Milch gebende

Tiere relativ selten vorkommen,

durch Mängel bei anderen

Merkmalen begründet ist, insbesondere

bei der Gesundheit. Jedoch haben

alle bisherigen Untersuchungen

ergeben, daß negative Zusammenhänge

nicht vorliegen. Solche Untersuchungen

sind nicht nur auf das eigene,

der BAfM zur Verfügung stehende

Material beschränkt, dieser

Frage ist auch international nachgegangen

worden. Nach dieser wichtigen

Antwort besteht die Möglichkeit,

Tiere mit geeignetem Genotyp

gezielt anzupaaren.

EFFEKTIVERE ZÜCHTUNG

DURCH BIOTECHNOLOGIE

Die Genotypisierung der Rinder

kann anhand von Milchproben erfolgen,

deren Proteine durch isoelektrische

Fokussierung aufgetrennt und

nach Anfärbung ausgewertet werden.

In einer Probe können alle Caseine

und Molkenproteine gleichzeitig

bestimmt werden. Mit molekularbiologischen

Techniken kann altersund

geschlechtsunabhängig auch

an Haar-, Sperma- oder Blutproben

eine direkte Analyse der DNA vorgenommen

und so genotypisiert

werden. Die Untersuchungskosten

liegen deutlich unter 100 DM pro

Tier. Natürlich können Tiere mit günstigem

Genotyp nur für den Einsatz

empfohlen werden, wenn die Zuchtwerte

für Leistung, Fruchtbarkeit und

Gesundheit möglichst positiv sind.

Gerade in Fällen, wo Rinder mit

erwünschten Proteinvarianten in der

Milch selten sind, greifen moderne

Methoden der Fortpflanzungsbiologie:

Bekannte Merkmalsträger aus

verschiedenen Gegenden der Welt

können unabhängig vom Standort

durch tiefgefrorenes Sperma angepaart

werden. Mit Hilfe der Superovulation

(vgl. Beitrag auf Seite 14)

läßt sich die Anzahl der Embryonen

und damit die Nachkommenzahl

steigern.

2/1998 FORSCHUNGSREPORT


Was ist für die Zukunft denkbar?

Entscheidend wird sein, in welchem

Maße Genwirkungen aufgeklärt

und genutzt werden können. Zum

Beispiel könnte die Menge eines bestimmten

Proteins in der Milch durch

das Einbringen von Mehrfachkopien

des zugehörigen Gens gesteigert

werden. Eine solche Steigerung

ließe sich auch mit Hilfe eines geeigneten

Promotors erreichen, also

einer DNA-Sequenz, die die Aktivität

eines Gens erhöhen kann.

BIOTECHNOLOGIE

In den letzten Jahrzehnten führten

weltweit steigende Käseproduktion

und rückläufige Kälberschlachtungen

zu einem Chymosinmangel.

Dieser Mangel konnte zum Teil

durch den Einsatz mikrobieller milchgerinnender

Enzyme ausgeglichen

werden, deren Eignung zur Käseherstellung

hinsichtlich Ausbeute und

Geschmack jedoch deutlich hinter

der von Kälberlab zurückblieb.

Anfang der 80er Jahre wurde das

Gen für Chymosin sequenziert, also

Abb. 2: Bei Angler Kühen finden sich relativ häufig Tiere, deren Milch kleine Casein-Micellen

und gute Gerinnungseigenschaften aufweist (Foto: I. Rossen)

CHYMOSINPRODUKTION

DURCH

MIKROORGANISMEN

Die für die Käseherstellung

benötigten Enzyme zur Milchgerinnung

(Lab-Enzym) wurden seit Menschengedenken

aus Mägen von säugenden

Kälbern gewonnen. Der

wässrige Extrakt aus diesen Mägen

enthält im wesentlichen Chymosin,

ein proteolytisches (eiweißspaltendes)

Enzym, welches das �-Casein

der Milch in spezifischer Weise hydrolysiert,

was zur Dicklegung der

Milch führt. Neben dieser Hauptkomponente

enthält Kälberlab weitere eiweißspaltende

Enzyme (z. B. Pepsine)

in geringeren Konzentrationen.

FORSCHUNGSREPORT 2/1998

die für die Bildung des Enzyms zugrundeliegende

genetische Information

entschlüsselt. Mit Methoden der

modernen Gentechnologie gelang

es mehreren Arbeitsgruppen, dieses

Gen in Mikroorganismen einzuführen

und diese zur Bildung des Enzyms

zu veranlassen.

Das Verfahren ist folgendermaßen

(Abb. 3): Die chromosomale DNA-

Sequenz des Gens wird in eine Boten-(messenger)

RNA (mRNA) übersetzt

und diese Nukleinsäure anschließend

mit Hilfe des Enzyms ‘Reverse

Transcriptase’ in die komplementäre

DNA (cDNA) umgeschrieben.

Diese DNA enthält die genetische

Information für eine Vorform

des Chymosins, das sogenannte

24

Pro-Chymosin. Die cDNA wird im

nächsten Schritt enzymatisch mit einem

speziellen Träger-DNA-Molekül

(Plasmidvektor) verbunden (kloniert).

Für diesen Zweck sind eine Vielzahl

von Vektoren verfügbar. Um eine effiziente

Synthese von Pro-Chymosin

zu gewährleisten, muß das Gen mit

geeigneten genetischen Kontrollsequenzen

(Promotoren) versehen werden.

Spezielle – induzierbare – Promotoren

erlauben sogar ein gezieltes

Ein- und Ausschalten der Enzymsynthese.

Die bei der Klonierung erhaltenen

DNA-Moleküle werden in einen geeigneten

Mikroorganismus eingeführt.

Für die Produktion von Chymosin

werden heute Bakterien (E. coli),

Hefen (Klyveromyces lactis) und

Schimmelpilze (Aspergillus niger)

verwendet.

Je nach Mikroorganismus und Art

des Genkonstruktes wird das gebildete

Pro-Chymosin entweder aus

den Mikroorganismenzellen oder

aus dem Fermentationsmedium isoliert

und anschließend mit herkömmlichen

biochemischen Methoden

gereinigt. In E. coli werden circa

300.000 Moleküle des Enzyms pro

Zelle gebildet, die sich zu unlöslichen

Partikeln (inclusion bodies) zusammenlagern.

Diese lassen sich

nach Aufbrechen der Bakterienzellen

leicht isolieren. Um aktives Enzym

zu erhalten, müssen diese Partikel

aufgelöst und das freigesetzte

Enzym renaturiert werden. Anschließend

läßt sich das Pro-Chymosin

bei niedrigem pH-Wert in aktives

Chymosin überführen.

Das durch gentechnisch veränderte

Mikroorganismen produzierte (rekombinante)

Chymosin wurde vor

seiner Zulassung intensiven biochemischen,

immunologischen und

toxikologischen Prüfungen unterzogen.

Dabei ergaben sich folgende Befunde:

Chymosin aus Kälberlab und

rekombinantes Chymosin sind identisch

bezüglich der molekularen

Masse der Proteine und deren physikochemischen

und immunologi-


schen Eigenschaften sowie der enzymatischen

Spezifität. Mikrobiell

erzeugte Chymosinpräparate wiesen

keine enzymatischen Fremdaktivitäten

auf, enthielten keine Produktionskeime

oder rekombinante DNA.

In Tierversuchen konnten keinerlei toxische

Substanzen nachgewiesen

werden. Bei Käsereiversuchen traten

bei der Herstellung verschiedener

Käsetypen keine relevanten Unterschiede

bezüglich Ausbeute, Textur,

Geruch, Geschmack und Reifung

der Käse auf.

Rekombinantes Chymosin ist daher

seit einigen Jahren in vielen Ländern

für den Einsatz in der Käseherstellung

zugelassen.

Aufgrund der zahlreichen Vorteile

dieser Produktionsweise, wie Unabhängigkeit

von Rohstoffmärkten,

hohe hygienische und technologische

Produkt- und Herstellungssicherheit,

umweltschonende Herstellungsweise

sowie die für einige wichtige

Märkte bedeutende Koscher- und

Vegetarierakzeptanz, ist es nicht verwunderlich,

daß in den USA etwa

90 % und in Großbritannien mehr

als 80 % der Käse bereits mit mikrobiell

gewonnenem Chymosin hergestellt

werden.

BIOTECHNOLOGIE

Abb. 3: Biosynthese des Milchgerinnungsenzyms Chymosin. Links der natürliche

Weg im Kälbermagen, rechts in Mikroorganismen, in die die Erbsubstanz

für die Enzymbildung überführt wurde

GENTECHNIK IN DER

KÄSEHERSTELLUNG

Bei der Produktion der meisten

Käse ist die Reifung ein kostenintensiver,

arbeits- und zeitaufwendiger

Vorgang. Die Optimierung dieses

Prozesses, insbesondere seine Beschleunigung,

ist daher seit Jahren

Ziel vielfacher Forschungsbemühungen.

Neben physikalischen und

chemischen Reaktionen ist besonders

die partielle Spaltung von

Milchproteinen ein wesentlicher Vorgang

bei der Reifung. Die Proteolyse

durch milcheigene Enzyme und

durch die Enzymsysteme der Startermikroorganismen

ist ein hochkomplexer

Vorgang, der erst in den letzten

Jahren, insbesondere durch multinationale

Forschungsarbeiten im

Rahmen mehrerer EU-Forschungsprogramme,

besser verstanden

wird.

Zur Aufklärung der grundlegenden

Mechanismen wurden verschiedene

proteolytische Enzyme aus

Starterbakterien identifiziert, gereinigt

und charakterisiert. Mit Hilfe

moderner molekularbiologischer

Techniken konnten die entsprechenden

Gene gefunden und entschlüs-

25

selt werden. Mit diesen Kenntnissen

wurden Starterbakterien, insbesondere

solche der Gattung Lactococcus,

gezielt in ihren proteolytischen

Aktivitäten verändert. Einige dieser

Mutanten, die die niederländische

Universität Groningen zur Verfügung

stellte, wurden an der Bundesanstalt

für Milchforschung für die Herstellung

von Versuchskäsen eingesetzt.

In einem ersten Schritt, der die

Grundlagen für eine Optimierung

der Käsereifung liefern soll, wurde

versucht, Aromaeigenschaften sensorisch

und biochemisch nachzuweisen

und mit der An- bzw. Abwesenheit

spezifischer Enzyme (Peptidasen)

zu korrelieren.

Da es sich bei den eingesetzten

Mutanten der Starterbakterien um

gentechnisch veränderte Mikroorganismen

handelt, mußten gemäß

Gentechnikgesetz bestimmte räumliche

Voraussetzungen geschaffen

werden. Mit dem Bau eines S1-Labors,

in dem Käsereiversuche durchgeführt

werden können, wurden diese

gesetzlichen Vorgaben erfüllt. Die

Ergebnisse aus den ersten beiden

Versuchskäseproduktionen mit fünf

verschiedenen, in ihren Peptidase-

Aktivitäten veränderten Lactococcus-

Mutanten werden Ende 1998 vorgestellt.


Dr. K. Pabst, Institut für Chemie und

Physik; PD Dr. A. Geis, Dr. W.

Bockelmann, Institut für Mikrobiologie;

Bundesanstalt für Milchforschung,

Postfach 6069, 24121 Kiel

2/1998 FORSCHUNGSREPORT


Typische „Hürden” oder „Barrieren”

sind niedrige pH- und a w -Werte

(erhöhter Säuregrad und weniger mikrobiell

verfügbares Wasser). Unter

diesen Bedingungen können viele

Verderbniserreger nicht wachsen. Mikrobiologisch

gefährdet sind vor allem

Erzeugnisse, die nur wenige Barrieren

enthalten. So können

zum Beispiel Kochschinken- und

Brühwurstaufschnitt in Vakuumverpackung

(Abb. 1) trotz Pasteurisierung

und Kühlung leicht verderben,

da ihre pH- und a w -Hürden mit pH

6,2 und a w 0,98 nur wenig ausgeprägt

sind. Obwohl sich fast alle

Nahrungsmittel heute leicht durch chemische

Zusatzstoffe oder eine ausreichende

physikalische Behandlung mikrobiologisch

stabilisieren lassen,

steigt die Nachfrage nach „gesünderen”,

das heißt naturbelassenen, chemiefreien,

salz- und fettarmen Nahrungsmitteln

mit geringer Verarbeitungstiefe.

Solche Erzeugnisse sind jedoch

mikrobiologisch hochgradig instabil.

Sie müssen entweder relativ

schnell zum Verzehr gelangen oder

BIOTECHNOLOGIE

Biokonservierung von

Fleischerzeugnissen

Bacteriocinogene Milchsäurebakterien können

Pathogene hemmen

Lothar Kröckel (Kulmbach)

Fleisch verdirbt schnell. Wenn keine spezifischen Maßnahmen zur Verlängerung der

Haltbarkeit und zur Kontrolle pathogener Mikroorganismen ergriffen werden, kann

es rasch zu einem Gesundheitsrisiko für den Verbraucher werden. Eine verbesserte

Lagerstabilität von Fleischerzeugnissen erreicht man häufig durch eine Kombination unterschiedlicher

Konservierungsverfahren. Produkte, die ausreichend durch Trocknung,

Salz und Säure stabilisiert sind, etwa langgereifte Rohwürste, können auch ohne Kühlung

oder Erhitzung längere Zeit aufbewahrt werden. Erhitzte Fleischerzeugnisse verderben

während der Kühllagerung weniger schnell, wenn sie zusätzlich durch Salze oder

Genußsäuren stabilisiert sind. Die gezielte Kombination solcher Verfahren in der Produktentwicklung

ist als „Hürdentechnologie” bekannt geworden.

FORSCHUNGSREPORT 2/1998

geeignete „natürliche” Barrieren gegen

unerwünschte Mikroorganismen

(Krankheits- und Verderbniserreger)

enthalten. Am Institut für Mikrobiologie

und Toxikologie der Bundesanstalt

für Fleischforschung in Kulmbach erforschen

wir solche „natürlichen” Barrieren

für die Biokonservierung von

Fleisch und Fleischerzeugnissen.

26

STARTER- UND

SCHUTZKULTUREN

Speziell selektierte Milchsäurebakterien

werden seit Jahrzehnten als

Starterkulturen zur Herstellung der unterschiedlichsten

fermentierten Lebensmittel

eingesetzt. Bei der Herstellung

langgereifter Rohwürste (Salami;

Abb. 2) liefern diese Bakterien

aber nicht nur einen wesentlichen

technologischen Beitrag im Sinne einer

erwünschten Veränderung des

Rohmaterials, sondern sie verhindern

als „Schutzkulturen” gleichzeitig die

Vermehrung von unerwünschten Mikroorganismen

und bewirken so eine

natürliche Konservierung.

Milchsäurebakterien können aber

auch zur hygienischen Stabilisierung,

zum Beispiel von vakuumverpacktem

Brühwurst- und Kochschinkenauf-

Abb. 1:

VakuumverpackterBrühwurstundKochschinkenaufschnitt


Abb. 2:

Aufschnittplatte

mit

Rohwurst

schnitt eingesetzt werden. Die mikrobiologische

Sicherheit und Stabilität

dieser Erzeugnisse hängt wesentlich

von der Art und Menge der bakteriellen

Kontamination der Produkte

während des Aufschneidens und Verpackens

und von der Bevorratungstemperatur

der verkaufsfertigen Erzeugnisse

ab. In Abwesenheit einer

mikrobiellen Konkurrenzflora, zum

Beispiel aus Milchsäurebakterien,

kann bei 7 °C die humanpathogene

Bakterienart Listeria monocytogenes

noch gut wachsen und gesundheitlich

bedenkliche Keimzahlen von

10 3 –10 5 Mikroorganismen pro

Gramm Produkt erreichen.

Listeria monocytogenes ist in der

Umwelt weit verbreitet und wurde in

der Vergangenheit von vielen Lebensmitteln

– auch von Fleisch und

Fleischerzeugnissen – isoliert. In

Frischfleisch wird dieses GRAM-positive,

psychrotrophe (zum Wachstum

bei Kühltemperaturen befähigte) Bakterium

regelmäßig nachgewiesen.

Der Keim wurde aber auch in fermentierten

Rohwürsten gefunden.

In fleischverarbeitenden Betrieben

kann L. monocytogenes in Aufschneideräumen

zur Herstellung von

Aufschnittware vorkommen und

pasteurisierte Fleischerzeugnisse

während des Aufschneidens und Verpackens

rekontaminieren. Erkrankungen

des Menschen als Folge einer Infektion

durch Listerien kommen vergleichsweise

selten vor, sie dürfen

aber aufgrund der häufig schweren

Krankheitsverläufe (u. a. Hirnhautentzündung)

nicht unterschätzt werden.

Zu den von Milchsäurebakterien pro-

BIOTECHNOLOGIE

duzierten antagonistischen, das

heißt andere Mikroorganismen hemmenden

Substanzen gehören Milchund

Essigsäure, Kohlendioxid, Wasserstoffperoxid,

Diacetyl und Bacteriocine.

Für Fleisch und Fleischerzeugnisse

ist die Milchsäure in dieser

Beziehung am bedeutendsten,

da sie mengenmäßig dominiert und

die Vermehrung der meisten unerwünschten

Mikroorganismen

hemmt. Leider bleiben aber einige

pathogene Bakterien, etwa Listerien,

auch in Gegenwart von Milchsäure

lange Zeit lebensfähig.

BACTERIOCINE

Bei der Suche nach weiteren nutzbaren

antagonistischen Substanzen

konzentrierten wir uns daher auf die

sensorisch neutralen Bacteriocine.

Dabei handelt es sich um eiweißartige

Substanzen mit mehr oder weniger

breiter Hemmwirkung gegen andere

GRAM-positive Bakterien, die

von manchen Milchsäurebakterien in

das Außenmedium abgegeben werden.

Einige dieser gesundheitlich unbedenklichen

Bacteriocine sind hoch

wirksam gegen Listerien.

Von den bei Fleisch und Fleischerzeugnissen

„erwünschten” Milchsäurebakterien

sind die psychrotrophen

Bakterien Lactobacillus sakei

und Lactobacillus curvatus am besten

an das Substrat Fleisch angepaßt

(Abb. 3). Bestimmte Stämme dieser

Arten produzieren Bacteriocine, die

in der Lage sind, Listerien abzutöten

bzw. deren Vermehrung zu hemmen.

Einige dieser anti-listeriellen Bacteriocine,

insbesondere Sakacin A und

Sakacin P von Lactobacillus sakei

Stamm Lb706 und Stamm Lb674

und Curvacin 1071 von Lactobacillus

curvatus Stamm Lb1071, wurden

von uns charakterisiert und in Fleischerzeugnissen

getestet (Abb. 4).

Es handelt sich bei diesen Bacteriocinen

um kleine, hitzestabile, ribosomal

synthetisierte Peptide (= aus

nur wenigen Aminosäuren bestehende

„Mini-Eiweiße”), die nach Ab-

27

spaltung einer Präsequenz aus der

Bakterienzelle ausgeschleust werden.

Das Bacteriocin Sakacin P

bleibt in Fleischsaft, Hackfleisch und

Brühwurst biologisch aktiv und eignet

sich daher auch als Zusatzstoff.

Das Gencluster für die Produktion

des Sakacin P in L. sakei Lb674 wurde

kloniert und sequenziert. Ein

7.600 Basenpaare großes chromosomales

DNA-Fragment enthielt alle

für die Expression von Sakacin P in

Bacteriocin-negativen Stämmen von

L. sakei erforderlichen Gene (Abb.

5). Das Gencluster umfaßt sechs aufeinanderfolgende

Gene: sppK,

sppR, sppA, spiA, sppT und sppE.

Die beiden ersten Gene, sppK und

sppR, sind für die Regulation der Bacteriocinproduktion

von Bedeutung.

Die Gene sppA und spiA kodieren

ein Sakacin P Präprotein und ein Protein,

das Immunität gegen Sakacin P

verleiht. SppT und SppE zeigen starke

Ähnlichkeiten mit den Transportproteinen

anderer Bacteriocinsyste-

me. Diese Proteine dürften dafür zuständig

sein, das Sakacin P aus der

Zelle in das Außenmedium zu transportieren.

Die Bacteriocinproduktion

ist somit ein sehr komplexer Vorgang,

der aufwendigen Regulations-, Prozessierungs-

und Exportmechanismen

unterliegt.

EINSATZPOTENTIALE

Für die Biokonservierung von

Fleischerzeugnissen ist die Einführung

einer konkurrenzstarken Milchsäure-

2/1998 FORSCHUNGSREPORT

Abb. 3:

Laktobazillen

(Milchsäure-

Stäbchen) in

Salami unter

dem Elektronenmikroskop


akterien-Mikroflora aus L. sakei oder

L. curvatus – vorzugsweise mit der

Fähigkeit zur Bacteriocinbildung –

oder der direkte Einsatz von gereinigtem

anti-listeriellen Bacteriocin als Lebensmittelzusatzstoff

für kühlgelagerte,

verzehrsfertige Fleischerzeugnisse

denkbar.

Neben den „nützlichen” Lactobazillen

können auch andere Milchsäurebakterien

vorverpackten Kochschinken-

und Brühwurstaufschnitt besiedeln.

Sie sind meist unerwünscht, da

sie zu einem vorzeitigen Verderb der

Ware etwa durch Schleimbildung, einer

zu starken Säuerung oder anderen

Geschmacksabweichungen

führen können.

Da eine keimfreie Aufschneidetechnik

in der Praxis nicht möglich ist,

gelangen regelmäßig verschiedene

Mikroorganismen – harmlose, pathogene

und verderbniserregende – auf

die pasteurisierten Erzeugnisse. Bei

7 °C und in Abwesenheit von Sauerstoff

vermehren sich dann vor allem

psychrotrophe Milchsäurebakterien

und Listerien. Eine „gezielte” Rekontamination

mit sensorisch akzeptablen

Milchsäurebakterien-Stämmen, die

sowohl Listerien als auch unerwünschte

Milchsäurebakterien in

Schach halten, würde daher zu einer

besseren mikrobiologischen Sicherheit

und sensorischen Stabilität der

Produkte beitragen und möglicherweise

auch die Herstellung salz- und

nitritreduzierter Ware erlauben. Bei

der Herstellung von Rohwurst können

Bacteriocinbildner gleichzeitig als

Starter- und Schutzkultur von Nutzen

sein.

BIOTECHNOLOGIE

Abb. 4: Primärsequenz (Abfolge der Aminosäuren) von Sakacin A und P

1 10 20 30 40

1. ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM

2. KYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWATGGNAGWNK

(identische Aminosäurereste sind durch vertikale Striche gekennzeichnet)

FORSCHUNGSREPORT 2/1998

Bacteriocin Produzent

1. Sakacin A Lactobacillus sakei Lb706

2. Sakacin P Lactobacillus sakei Lb674

VAKUUMVERPACKTER

BRÜHWURSTAUFSCHNITT

Während der Kühllagerung von

vakuumverpacktem Brühwurstaufschnitt

produzierte L. sakei Lb674

(Sakacin P) ab einer Einsaatdichte

von 10 5 -10 6 Bakterien/g Wurst ausreichende

Konzentrationen von

Bacteriocin. Das Wachstum von Listeria

monocytogenes wurde verzögert

und in einigen Fällen vollständig

gehemmt (Abb. 6). Ähnliche Ergebnisse

wurden mit L. sakei Lb706 (Sakacin

A) erhalten. Bacteriocin-negative

Varianten dieser Stämme oder andere

aus Fleisch isolierte, Bacteriocin-negative

Milchsäurebakterien

verhinderten das Wachstum der Listerien

nicht. Die Inokulation von Schutzkulturen

in Anfangskeimzahlen von

10 5 -10 6 /g führte erwartungsgemäß

nach wenigen Tagen zu einer

Keimzahl von circa 10 8

Milchsäurebakterien/g. Die damit

einhergehende Milchsäureprodukti-

Abb. 5: Genkarte des Sakacin P Clusters

28

on und relativ geringe pH-Abnahme

zeigten keine sensorisch nachteiligen

Auswirkungen auf das Produkt.

Als Zusatzstoff zeigte gereinigtes

Bacteriocin (Sakacin P) in Abwesenheit

einer Schutzkultur einen deutlichen

Anfangseffekt auf L. monocytogenes

und reduzierte das Wachstum

während der Lagerung (Abb. 7). Allerdings

wurden die zu Beginn des

Versuchs eingebrachten Listerien

nicht völlig abgetötet. Nach einer

vollständigen Wachstumshemmung

in den ersten 3 Tagen konnten sich

überlebende Listerien auch in Anwesenheit

des Bacteriocins vermehren,

aber mit deutlich geringerer Rate als

in bacteriocinfreier Wurst. Wurden

Sakacin P-haltige Produkte zusätzlich

mit L. sakei Lb674 als Schutzkultur in

niedrigen Anfangskeimzahlen (10 2

Bakterien/g) beimpft, so wurde die

Vermehrung der Listerien noch stärker

gehemmt (Abb. 7). Innerhalb weniger

Tage erreichten die Milchsäurebakterien

genügend hohe Zellzahlen,

um den Bacteriocin-Effekt zu unterstützen.

Im weiteren Verlauf hemmten

sie die Listerien, die in Anwesenheit

des Bacteriocins überlebten und

vermehrungsfähig blieben.

Bacteriocinbildende Milchsäurebakterien

können also das Wachstum

von Listeria monocytogenes auf

„sensiblen” Fleischerzeugnissen verhindern,

wenn sie als Schutzkulturen

während des Aufschneidens in ausreichend

hohen Keimzahlen zugegeben

werden.

sppK sppR spiA sppT sppE

sppI sppA

(Auto-) Induktor

Organisation des Sakacin P Gen-Clusters in Lactobacillus sakei Lb 674

Regulation der

Bacteriocin-Produktion

(Prä-) Sakacin P

Strukturgen

Immunität gegen

Sakacin P

Bacteriocin-Export

und Prozessierung

1 kb


In der industriellen Praxis könnten

zum Beispiel die Aufschneidemaschinen

(Slicer) mit einer automatischen

Sprühvorrichtung für Schutzkulturen

nachgerüstet werden.

Bacteriocin-negative Milchsäurebakterien

sind unter gleichen Bedingungen

deutlich weniger wirksam.

Als Zusatzstoff zeigt Sakacin P zwar

Wirkung, kann aber das Wachstum

von Listeria monocytogenes nicht im

erwünschten Umfang verhindern.

ROHWURST

Die Stämme L. sakei Lb674 und L.

curvatus Lb1071 eignen sich auch

als Starterkulturen für Salami. Beide

Stämme führten bei 23 °C und den

üblichen Einimpfmengen (10 6 Bakterien/g)

zu einer schnellen Umrötung

und Säuerung der Produkte. Farbe

und Bindung der Erzeugnisse waren

ausgezeichnet. Geschmacklich waren

die Würste gut und leicht säurebetont.

Die Bacteriocinbildner blieben

im gesamten Reifeverlauf dominant

und zeigten auch sonst keine für

die Rohwurstherstellung ungünstigen

Eigenschaften.

Auch eine wesentlich geringere

Einsaatdichte von 10 3 /g L. sakei

Lb674 oder L. curvatus Lb1071 führte

im Laufe der Reifung schon zu ähnlich

positiven Ergebnissen. Die niedrigere

Anfangskeimzahl der zugesetzten

Milchsäurebakterien hatte

eine langsamere Abnahme des pH-

Wertes zur Folge. Dadurch wurde

eine mildere Säuerung der Würste

erreicht, die sensorisch häufig bevorzugt

wird.

L. sakei Lb674 produzierte kaum

Bacteriocin in Rohwurst, obwohl dieser

Stamm sonst alle wichtigen Selektionskriterien

für eine Starterkultur erfüllt.

L. curvatus Lb1071 war dagegen

in Rohwurst ein hervorragender

Bacteriocinproduzent. Listeria monocytogenes

konnte sich unter den gewählten

Versuchsbedingungen in der

Rohwurst nicht vermehren und nahm

im Laufe der Reifung in allen

Versuchschargen ab. Im Vergleich zu

BIOTECHNOLOGIE

einem kommerziellen L. curvatus-Starter

bewirkte L. curvatus Lb1071 eine

deutlich größere Reduktion der Listerien.

(Abb. 8).

AUSBLICK

Milchsäurebakterien spielen bei

der Herstellung von Rohwürsten eine

große Rolle. Starterkulturen werden

daher regelmäßig neu bewertet und

neuen Anforderungen angepaßt. Die

zunehmende Nachfrage nach schonend

verarbeiteten, verzehrsfertigen

Convenience-Produkten, die durch

Kühlung alleine nicht ausreichend hygienisch

stabilisiert werden können,

eröffnet zusätzliche Einsatzmöglichkeiten

für diese Bakterien als Schutzkulturen.

Ziel unserer Arbeiten ist es,

unter den vielen natürlich vorkommenden

Milchsäurebakterien diejenigen

zu finden, die über eine möglichst

optimale Kombination erwünschter

Eigenschaften verfügen,

diese Bakterien möglichst genau zu

charakterisieren und die Eignung dieser

Kulturen für traditionelle und neue

Anwendungsfelder zu demonstrieren.

Schutzkulturen mit der Fähigkeit

zur Bacteriocinbildung bieten neue

Möglichkeiten zur Verbesserung der

Sicherheit und Haltbarkeit konventioneller

Fleischerzeugnisse. Mit ihrer

Hilfe könnten neue Produkte entwickelt

werden, die milder und aufgrund

einer effektiven Unterdrückung

der Begleitflora „reiner” im Geschmack

sind.

Die meisten anti-listeriellen Bacteriocine

weisen in ihrem N-terminalen

Bereich die Aminosäure-Sequenz

‘YGNGV’ auf (vgl. Abb. 1). Die Rolle

weiterer Sequenzelemente ist noch

nicht ausreichend bekannt, so daß

die Suche nach weiteren natürlichen

– möglicherweise besseren –Varianten

interessant bleibt. ■

Dr. Lothar Kröckel, Bundesanstalt für

Fleischforschung, Institut für Mikrobiologie

und Toxikologie, E.-C.-Baumann-Str.

20, 95326 Kulmbach

29

Abb. 6: Vakuumverpackter Brühwurstaufschnitt (1)

7

6

5

4

3

2

1

0

log 10 L. monocytogenes/g

Bac -

ph-Verlauf

Bac +

pH-Wert

0 7 14 21 28

Tage

2/1998 FORSCHUNGSREPORT

7,0

6,5

6,0

5,5

5,0

zugesetzte

Milchsäurebakterien:

105 – 106 Zellen/g

Lagertemperatur:

7 °C

Verhalten von Listeria monocytogenes auf vakuumverpacktem Brühwurstaufschnitt in

Gegenwart bacteriocinogener (Bac + ) und nicht-bacteriocinogener (Bac – ) Milchsäurebakterien

(MSB)

Abb. 7: Vakuumverpackter Brühwurstaufschnitt (2)

8

7

6

5

4

3

2

1

log 10 L. monocytogenes/g

– MSB

+ MSB

zugesetzte

Milchsäurebakterien:

102 Zellen/g

(Stamm Lb674)

pH-Werte nach

28 Tagen:

pH 5,5 – 5,7

zugesetzte

Bacteriocinmenge:

500 – 1500 AU/g

(AU = Aktivitätseinheiten)

0

0 7 14

Tage

21 28

Verhalten von Listeria monocytogenes auf vakuumverpacktem Brühwurstaufschnitt mit

Sakacin P-Zusatz bei 7 °C, mit und ohne bacteriocinogene Milchsäurebakterien (MSB)

Abb. 8: Reifung von Salami

6

5

4

3

2

1

log 10 L. monocytogenes/g

zugesetzte

Milchsäurebakterien:

10 6 Zellen/g

Lactobacillus curvatus

Stamm Lc3 (Bac-)

Lactobacillus curvatus

Stamm Lb1071 (Bac+)

0

0 7 14 21 28 35

Tage

Verhalten von Listeria monocytogenes in Salami in Gegenwart bacteriocinogener Milchsäurebakterien

(Lb1071) und einer nicht-bacteriocinogenen Starterkultur (Lc3)


In Deutschland werden unter „Novel

Food” fast ausschließlich gentechnisch

modifizierte Lebensmittel verstanden.

Die Novel Food-Verordnung (Verordnung

EG Nr. 258/97 des Europäischen

Parlaments und des Rates

über neuartige Lebensmittel und Lebensmittelzutaten)

faßt allerdings eine

breite Palette unterschiedlichster Produkte

zusammen. Dabei handelt es

sich um Lebensmittel und Lebensmittelzutaten,

die bislang im gemeinsamen

EU-Markt noch nicht verzehrt wurden

LEBENSMITTEL

Kennzeichnung von

gentechnisch veränderten

Lebensmitteln

Klaus-Dieter Jany und Ralf Greiner (Karlsruhe)

Für neuartige Lebensmittel ist in der Europäischen Union am 15. Mai 1997 nach

langjährigen Verhandlungen die Novel Food-Verordnung in Kraft getreten. Diese Verordnung

regelt das Inverkehrbringen und die Etikettierung von neuartigen Lebensmitteln

in allen EU-Mitgliedstaaten nach einheitlichen Kriterien. Da die Handhabung in der

Praxis auf Probleme gestoßen ist, sind von der EU ergänzende Verordnungen erlassen

worden. Die Anlaufschwierigkeiten und Unsicherheiten und die gefundenen Lösungsansätze

schildert der folgende Beitrag.

FORSCHUNGSREPORT 2/1998

(z. B. Produkte aus Algen oder Mikroorganismen)

und sich sechs genau definierten

Kategorien zuordnen lassen.

Lediglich zwei betreffen die Gentechnik:

■ Lebensmittel, die selbst den gentechnisch

veränderten Organismus

(GVO) darstellen (z. B. Flavr-Savr-

Tomate) oder GVO enthalten (Joghurt

mit Lebendkulturen) und

■ Produkte, die aus GVO gewonnen

werden, aber den lebenden GVO

nicht mehr enthalten (z. B. Öl aus

herbizidtoleranten Sojabohnen).

30

In Artikel 8 der Novel Food-Verordnung

sind die Etikettierungsanforderungen

zur Unterrichtung der Verbraucher

festgelegt. Sie gelten für alle

neuartigen Lebensmittel und sind nicht

speziell auf gentechnisch modifizierte

Erzeugnisse ausgerichtet. In Tabelle 1

sind die Kennzeichnungskriterien aufgelistet.

Informiert werden die Verbraucher

über die jeweilige Veränderung und

das Verfahren. Die Etikettierung gilt

sowohl für verpackte als auch für offene

Ware sowie für Lebensmittel aus

der Gemeinschaftsverpflegung.


Grundsätzlich müssen alle Lebensmittel

und Lebensmittelzutaten gekennzeichnet

werden, die lebende GVO

sind oder enthalten. Ebenso müssen

Verbraucher durch eine entsprechende

Kennzeichnung informiert werden,

wenn das neuartige Erzeugnis im Vergleich

zum traditionellen Lebensmittel

Stoffe enthält, die die Gesundheit bestimmter

Menschen beeinflussen können

(z. B. neues oder erhöhtes allergenes

Potential), oder wenn gegen

Stoffe in dem neuen Lebensmittel ethische

oder religiöse Bedenken oder

aufgrund bestimmter Ernährungsformen

Vorbehalte bestehen. Dies könnte

zum Beispiel der Fall sein, wenn ein

tierisches Gen (Protein) in traditionell

vegetarischen Produkten oder ein

„Schweine-Gen” in Lebensmitteln für

Moslems vorhanden ist. Ebenso müssen

Erzeugnisse gekennzeichnet werden,

die sich von vergleichbaren traditionellen

Lebensmitteln unterscheiden,

das heißt, wenn sie nicht gleichwertig

sind (Artikel 8, Absatz 1a).

WAS BEDEUTET

„GLEICHWERTIG”?

Im Sinne der Novel Food-Verordnung

werden neuartige Lebensmittel

als nicht gleichwertig angesehen,

wenn sie gegenüber vergleichbaren

traditionellen Erzeugnissen Unterschiede

aufweisen, die sich analytisch

und auf der Basis einer wissenschaftlichen

Beurteilung feststellen lassen.

Offen blieb dabei allerdings die

Frage nach den Kriterien für die

Gleichwertigkeit und den Analysenmethoden.

Sehr leicht läßt sich eine

gezielte Veränderung anhand der

stofflichen Zusammensetzung nachweisen.

So müssen Öle mit einer veränderten

Fettsäurezusammensetzung

(z. B. höherer Gehalt an mehrfach

ungesättigten Fettsäuren) oder Stärken

mit verändertem Ver-zweigungsgrad

(z. B. vorwiegend Amylose oder Amylopektin)

stets gekennzeichnet werden,

denn sie unterscheiden sich von

den entsprechenden konventionellen

Erzeugnissen. Eine Kennzeichnung

LEBENSMITTEL

wird auch erforderlich, wenn in dem

Erzeugnis noch die neueingeführte

genetische Information (DNA) oder

das (die) neueingeführte(n) Protein(e)

nachweisbar enthalten sind. In diesen

Fällen ist das neuartige Erzeugnis in

seiner Zusammensetzung zu dem vergleichbaren

traditionellen nicht mehr

gleichwertig (der Begriff ‘nicht gleichwertig’

impliziert keine Wertung in

Richtung ‘schlechter’, sondern ist im

Sinne von ‘anders’ zu verstehen).

Eine Kennzeichnung ist nicht erforderlich,

wenn die Erzeugnisse keine

stofflichen oder ernährungsphysiologischen

Unterschiede zu konventionel-

Tab. 1: Kriterien für die Kennzeichnung

von Lebensmitteln nach der

Novel Food-Verordnung

Gekennzeichnet werden Erzeugnisse

■ die lebende GVO darstellen oder enthalten,

■ die die Gesundheit bestimmter Bevölkerungsgruppen

beeinflussen können,

■ gegen die ethische Vorbehalte bestehen,

■ die keine Gleichwertigkeit zu vergleichbaren

traditionellen Produkten

– in der Zusammensetzung,

– im Nährwert, in der nutritiven Wirkung,

– im Gebrauch, usw.

aufweisen.

31

len Produkten aufweisen. So enthalten

zum Beispiel raffinierte Öle aus transgenem

Raps, Mais und transgenen

Sojabohnen keine DNA und keine

Proteine mehr. Infolgedessen werden

sie sowohl in der Sicherheitsbeurteilung

als auch in der stofflichen Zusammensetzung

als gleichwertig zu

den konventionellen Ölen bewertet.

Gerade in dem Kriterium der

Gleichwertigkeit von Produkten sehen

viele Verbraucher und Kritiker der

Gentechnik einen Mangel der Novel

Food-Verordnung. Sie sind der Ansicht,

daß hierdurch viele Lebensmittel

von der Kennzeichnungsregelung ausgenommen

und die Verbraucher nicht

hinreichend über den Einsatz der

Gentechnik informiert werden. Hierbei

ist allerdings zu bedenken, daß

eine Kennzeichnung nur verläßlich

praktiziert werden kann, wenn sie

auch überprüfbar ist. Wenn aber in

einem hochaufbereiteten und gereinigten

Produkt wie raffiniertem Öl

oder raffiniertem Zucker die gentechnische

Veränderung nicht nachweisbar

ist, weil die in Frage kommenden

Stoffe (DNA oder Proteine)

gar nicht mehr vorhanden sind, ist

auch eine Kennzeichnung nicht mehr

sinnvoll.

2/1998 FORSCHUNGSREPORT


Abb. 1:

Schokoriegel mit

Cornflakes und

Stärke aus

transgenem

Mais. Die

Zutatenliste auf

der Rückseite

der Verpackung

enthält die

Deklaration

„aus genetisch

verändertem

Mais hergestellt”

(Fotos:

M. Welling)

SOJABOHNEN UND MAIS

Im Frühjahr 1997, kurz vor Inkrafttreten

der Novel Food-Verordnung, erhielten

herbizidtolerante Roundup

Ready Sojabohnen und insektenresistenter

Bt-Mais in der EU die Genehmigung

zum Inverkehrbringen nach

der Freisetzungsrichtline. In den

entsprechenden Entscheidungen

96/281/EG (Soja) und

97/98/EG (Mais) wurde keine spezielle

Kenntlichmachung der Produkte

vorgeschrieben. Wären sie nach der

Novel Food- Verordnung zugelassen

worden, so hätte zum Beispiel Sojaprotein

aus den herbizidtoleranten Sojabohnen

gekennzeichnet werden

müssen.

Da Soja- und Maisverarbeitungsprodukte

in sehr vielen Lebensmitteln

vorhanden sind, Verbraucher ein Anrecht

auf Information haben und auch

um Wettbewerbsverzerrungen für

möglicherweise folgende transgene

Soja- und Maisvarietäten abzubauen,

hat die EU-Kommission die Etikettierungsrichtlinie

ergänzt: Die bereits zugelassenen

Soja- und Maisprodukte

müssen ab 1. November 1997 ebenfalls

entsprechend Artikel 8 der Novel

FORSCHUNGSREPORT 2/1998

LEBENSMITTEL

Food-Verordnung gekennzeichnet

werden (Ergänzungsverordnung EG

1813/97).

Obwohl derartige Mais- und Sojaprodukte

auf dem Markt sind und die

Verordnung in Kraft getreten ist, lassen

sich kaum gekennzeichnete Lebensmittel

im Regal finden. Dies liegt daran,

daß weder bestimmt wurde, wie

die Etikettierung konkret vorzunehmen

sei, noch welche Nachweisverfahren

zum Tragen kommen sollen. Die Novel

Food-Verordnung ließ sich somit

nicht direkt anwenden. Weder Lebensmittelhersteller

noch Überwachungsbehörden

hatten klare Handlungsanweisungen.

Um hier Abhilfe

zu schaffen, legte die Kommission im

Dezember 1997 einen ergänzenden

Vorschlag zur Etikettierung für Sojaund

Maisprodukte vor. Richtungsweisend

für die wissenschaftliche Beurteilung

der Nichtgleichwertigkeit zwischen

neuartigen und konventionellen

Lebensmitteln und Lebensmittelzutaten

waren die Ausführungen zum DNAund

Proteinnachweis. Hiernach soll

bereits das Vorhandensein der neueingeführten

DNA das Kriterium der

Nichtgleichwertigkeit erfüllen. Dadurch

werden ganz im Sinne der Verbraucherinformation

eine größere Anzahl

von Lebensmitteln und Lebensmittelzutaten

erfaßt. Erst wenn die Identifikation

der neueingeführten DNA versagt,

soll das Proteinkriterium zum Tragen

kommen. Da DNA in Verarbeitungsprozessen

relativ häufig in ihre

Einzelbausteine zerlegt wird, erweitert

die Proteinanalytik den Etikettierungsumfang.

Diese Bestimmungen wurden in

eine sogenannte Ablöseverordnung

(EG Nr. 1139/98) hineingeschrieben.

Sie ist am 1. September 1998 in

Kraft getreten und löst die vorhergehende

Ergänzungsverordnung ab. Die

Ablöseverordnung gilt ausschließlich

für die beiden genannten Soja- und

Maisvarietäten „Roundup Ready Sojabohnen”

und „Novartis Bt-Mais 176”.

Es ist aber davon auszugehen, daß

diese Ausführungen demnächst auf

alle gentechnisch modifizierten Erzeugnisse

angewendet werden.

32

DIE KENNZEICHNUNG

Lebensmittel oder Lebensmittelzutaten

aus gentechnisch verändertem

Soja oder Mais müssen immer dann

gekennzeichnet werden, wenn sich

die neueingeführte DNA oder das

neueingeführte Protein im Endprodukt

– also dem Produkt, das für den Verbraucher

zum Verzehr bestimmt ist –

nachweisen läßt. In diesen Fällen

muß eine Kennzeichnung mit „aus genetisch

veränderten Sojabohnen hergestellt”

bzw. „aus genetisch verändertem

Mais hergestellt” erfolgen

(Abb. 1). Es müssen nicht beide neuen

Komponenten nachgewiesen werden.

Aber falls sich die neueingeführte

DNA nicht nachweisen läßt, muß

überprüft werden, ob in dem Produkt

noch das neue Protein enthalten ist.

Erst wenn die Nachweise für beide

Komponenten negativ ausfallen, ergibt

sich keine Kennzeichnungspflicht.

Gegenwärtig beschränkt sich

der Nachweis ausschließlich auf die

Detektion der neueingeführten DNA.

Für Soja und Mais stehen in Ringversuchen

überprüfte Verfahren zur Verfügung,

allerdings wurden die Nachweise

in weiterverarbeiteten Produkten

bislang noch nicht so intensiv bearbeitet.

Am Molekularbiologischen

Zentrum der Bundesforschungsanstalt

für Ernährung (BFE) ist für gentechnisch

modifiziertes Soja auch ein Proteinnachweis

entwickelt worden, der

zur Zeit weiter optimiert wird.

Zum Auffinden der veränderten

DNA ist die „Polymerase Chain Reaction”

(PCR) Methode der Wahl. Mit

ihr lassen sich einzelne DNA-Fragmente

exponentiell vervielfältigen und

im weiteren Verlauf identifizieren

(Abb. 2). Die PCR läßt sich mit einem

Kopiergerät im Büro vergleichen, das

von einer Vorlage beliebig viele identische

Kopien produzieren kann.

Die PCR ist ein hochempfindliches

Nachweisverfahren. Um zu verhindern,

daß jede kleine Verunreinigung

des Endprodukts mit neuer DNA zu

einer Kennzeichnung führt, soll ein

Schwellenwert eingeführt werden,

oberhalb dessen erst gekennzeichnet


werden muß. Gegenwärtig ist ein solcher

Schwellenwert noch nicht festgelegt.

In der Diskussion stehen relative

Werte zwischen 1–3 % der neueingeführten

DNA in Bezug auf den Gesamt-DNA-Gehalt.

In der Ablöseverordnung

ist auch eine Negativliste für

Produkte, die nicht gekennzeichnet zu

werden brauchen, aufgenommen

worden. Klassische Beispiele hierfür

sind raffinierte Öle aus Soja oder

Mais.

Zusatzstoffe (zum Beispiel Sojalecithin),

Aromen und Extraktionsmittel

werden von der Novel Food Verordnung

und auch von der Ablöseverordnung

nicht erfaßt. Sie unterliegen somit

auch keiner Kennzeichnung.

Nicht eindeutig ist die Stellung von

Enzymen, die als Verarbeitungshilfsstoffe

verwendet werden. In der EU-

Kommission wird aber bereits eine Regelung

für Enzyme diskutiert.

„GENTECHNIKFREI”

In der Präambel zur Novel Food-

Verordnung wird ausdrücklich darauf

hingewiesen, daß auch eine Kennzeichnung

derart erfolgen kann, daß

das Lebensmittel kein neuartiges Erzeugnis

im Sinne der Verordnung darstellt.

Eine Kennzeichnung „gentechnikfrei”

ist möglich. Auf europäischer

Ebene sind allerdings bis heute die

Begriffe „gentechnikfrei” oder „Ohne

Gentechnik” noch nicht definiert.

Österreich hat im nationalen Rahmen

schon eine entsprechende Regelung

eingeführt, und für Deutschland ist im

Juli 1998 vom Bundesrat eine Gesetzesvorlage

für die Etikettierung „Ohne

Gentechnik” verabschiedet worden.

Diese Regelung steht zur Notifizierung

durch die EU an. Gegenwärtig

werden die Begriffe sehr restriktiv verstanden.

Der Produzent/Vertreiber

muß lückenlos nachweisen können,

daß in keinem Herstellungsschritt –

vom Rohstoff bis zum Endprodukt –

die Gentechnik in irgendeiner Weise

bei dem Lebensmittel eine Rolle gespielt

hat. Nach der deutschen Regelung

dürfen Lebensmittel, die nachweislich

auf keiner Stufe der Herstellung

mit der Gentechnik in Berührung

gekommen sind, mit dem Begriff

„Ohne Gentechnik” gekennzeichnet

werden. Eine Auslobung mit „gentechnikfrei”

ist nicht erlaubt. „Ohne

Gentechnik” bedeutet hier, daß weder

Rohstoffe aus transgenen Pflanzen,

noch Enzyme oder Zusatzstoffe

und Aromen aus gentechnisch veränderten

Mikroorganismen für die Lebensmittelherstellung

verwendet werden.

In der Tierhaltung dürfen keine Futtermittel

oder Futtermittelzutaten aus

transgenen Organismen eingesetzt

werden. Eine Überprüfung ist hier

schwierig. So liefert eine Kuh, die mit

transgenem Soja- oder Rapsschrot

oder Mais gefüttert wurde, keine gentechnisch

veränderte Milch; diese ist

substantiell gleichwertig der Milch

von Kühen, die mit traditionellem Futter

gefüttert worden sind.

Ein analytischer Nachweis des Einsatzes

von transgenem Futter ist im tierischen

Endprodukt nicht möglich.

Hier muß man sich auf die Aufzeichnungspflicht

des Landwirts und die Erklärungen

der Futtermittellieferanten

verlassen.

Der Landwirt ist nicht verpflichtet,

DNA-Nachweise für die Futtermittel

durchführen zu lassen. Solange ein

Landwirt seinen Nutztieren Futter aus

nicht transgenen Pflanzen gibt und

das Futter mit Enzymen, Vitaminen,

Aminosäuren aus nicht transgenen Mikroorganismen

versetzt, kann er die

Erzeugnisse mit „Ohne Gentechnik”

33

LEBENSMITTEL

ausloben. Nicht geklärt ist, wie der

Landwirt mit der Kennzeichnung umgehen

muß, falls er – zum Beispiel in

den Wintermonaten – transgenes

Material zufüttert und dann später

wieder auf nicht transgenes Futter umstellt.

Die Verwendung von Arzneioder

Impfmitteln aus transgenen Organismen

haben keinen Einfluß auf

die Kennzeichnung.

Neu eingeführte DNA darf aber

auch in Lebensmitteln „Ohne Gentechnik”

vorhanden sein, solange

nachgewiesen werden kann, daß

diese DNA unbeabsichtigt oder aufgrund

unvermeidbarer Gegebenheiten

in das Produkt gelangt ist. Letztes

wäre zum Beispiel beim Sammeln

und Transport von konventionellem

Soja in Silos und Schiffen, die zuvor

transgene Sojabohnen enthielten. Es

ist unmöglich, unter wirtschaftlichen

Bedingungen eine Reinigung zu er-

zielen, die eine absolute „Gentechnikfreiheit”

der Anlagen garantieren

würde.

Verbraucher haben einen Anspruch

auf Information über Inhaltsstoffe und

Herstellungsverfahren ihrer Lebensmittel.

Die Etikettierung muß nicht nur

sachgerecht, sondern auch überprüfbar

sein. Kennzeichnung und Überprüfbarkeit,

das heißt die Nachweisbarkeit

der gentechnischen Modifikationen

und die richtige Etikettierung,

sind eng miteinander verbunden. ■

Prof. Dr. Klaus-Dieter Jany, Dr. Ralf

Greiner, Bundesforschungsanstalt für

Ernährung, Haid-und-Neu-Straße 9,

76131Karlsruhe

2/1998 FORSCHUNGSREPORT

Abb. 2:

Mit Hilfe der

PCR lassen sich

bestimmte –

also auch gentechnischeingefügte

– DNA-

Fragmente

vervielfältigen

und auf einem

Gel als Banden

sichtbar

machen.

Die Abbildung

zeigt eine PCR-

Untersuchung

von transgenem

Raps.


Abb. 1: Aufgabenstruktur des wissenschaftlichen Personals

an der Biologischen Bundesanstalt

3,6 %

2,6 %

25,0 %

2,6 %

10,7 % 20,9 %

Hoheitsaufgaben und unmittelbar

damit zusammenhängende

Forschung 65,3 %

■ Prüfung und Zulassung von

Pflanzenschutzmitteln

■ Geräteliste, Anwendungstechnik

■ Gentechnikgesetz

■ Chemikaliengesetz

■ Resistenzprüfung

■ Erstellung von Richtlinien und Grundsätzen

FORSCHUNG & ADMINISTRATION

Neuentwicklungen auf

dem Prüfstand

Über die Verzahnung von wissenschaftlichen Arbeiten

und behördlichen Entscheidungen

Wohlert Wohlers und Michael Welling (Braunschweig)

Unter den Bundesforschungsanstalten im Geschäftsbereich des Bundesministeriums

für Ernährung, Landwirtschaft und Forsten (BML) befinden sich Einrichtungen, die

gleichzeitig auch als selbständige Bundesoberbehörden tätig sind. Diese Doppelkonstruktion

spiegelt die Notwendigkeit wider, administrative Regelungen und Entscheidungen

auch in äußerst komplexen naturwissenschaftlich-technischen Bereichen treffen

zu müssen – und das gelingt oft nur, wenn auf wissenschaftlichen Sachverstand aus erster

Hand zurückgegriffen werden kann. Pflanzenschutzmittel zum Beispiel werden in

Deutschland von der Biologischen Bundesanstalt für Land- und Forstwirtschaft (BBA) zugelassen.

Die Entscheidung, ob und gegebenenfalls mit welchen Auflagen solche Zulassungen

erteilt werden – eine Aufgabe der BBA als Behörde – wäre ohne das wissenschaftliche

Fundament der BBA als Forschungsanstalt kaum tragfähig.

8,7 %

Die Aufgaben der Biologischen

Bundesanstalt sind im wesentlichen

im Pflanzenschutzgesetz festgelegt.

Dazu kommen Tätigkeiten, die sich

aus dem Gentechnikgesetz sowie

aus dem Chemikalien- und dem Bundesseuchengesetz

ergeben. Wie

stark die wissenschaftlichen und ad-

FORSCHUNGSREPORT 2/1998

26,0 %

Forschung, die mittelbar zu

Hoheitsaufgaben führt 34,7 %

Forschung zur Phytopathologie und

zum Pflanzenschutz

Forschungsmanagement, Bibliotheken,

sonstige

ministrativen Arbeitsfelder ineinandergreifen,

zeigen die folgenden

Beispiele. An der BBA sind fast zwei

Drittel des wissenschaftlichen Personals

mit hoheitlichen Pflichten betraut

(Abb. 1). Dabei ermöglicht die Verzahnung

von Forschung und Hoheitsaufgaben

ein für eine Behörde

schnelles Reagieren auf neue Entwicklungen

im Bereich der Wissenschaft.

PFLANZENSCHUTZ-

MITTELPRÜFUNG

Pflanzenschutzmittel dürfen in

Deutschland nur in Verkehr gebracht

werden, wenn sie durch die Biologische

Bundesanstalt geprüft und zugelassen

wurden. Die Einrichtungen

zweier anderer Ministerien – das

Umweltbundesamt (UBA) und das

Bundesinstitut für gesundheitlichen

Verbraucherschutz und Veterinärmedizin

(BgVV) – wirken dabei als Einvernehmensbehörden

mit.

34

Für inländische wie für importierte

Pflanzenschutzmittel gelten heute

hohe Anforderungen an den Schutz

von Mensch, Tier und Umwelt. Geprüft

wird nicht nur der Wirkstoff,

sondern auch das Pflanzenschutzmittel

als Ganzes mit all seinen Bestandteilen

einschließlich der Formulierungsstoffe

sowie seine Abbauprodukte.

Dabei beschränkt sich

eine Prüfung nicht nur auf das sorgfältige

Studium der von den Herstellern

gelieferten Unterlagen: Die

BBA-Wissenschaftler führen in einzelnen

Bereichen auch eigene Laborversuche

oder chemische Analysen

durch. Aufgrund der umfangreichen

Prüfvorschriften gehören Pflanzenschutzmittel

zu den am besten

untersuchten Chemikalien überhaupt.

Die Prüfung umfaßt fünf wichtige

Bereiche:

Wirksamkeit

Pflanzenschutzmittel müssen hinreichend

wirksam sein, sonst dürfen


FORSCHUNG & ADMINISTRATION

Die Widerstandsfähigkeit von Zierpflanzen gegen Krankheiten wird erforscht (hier:

Mehltau an Begonien)

sie von der Biologischen Bundesanstalt

nicht zugelassen werden. Dadurch

soll unter anderem eine unnötige

Umweltbelastung durch schlecht

wirksame Mittel verhindert werden.

Mit berücksichtigt wird bei der Prüfung

auch, daß die Pflanzenschutzmittel

zwar die Schaderreger verläßlich

bekämpfen, die behandelten

Kulturpflanzen aber nicht schädigen

sollen.

Da immer wieder Schadorganismen

mit Resistenzen auftreten, ist die

Wirksamkeitsprüfung ein dynamischer

Prozeß mit permanentem Forschungsbedarf.

Anwenderschutz

Es muß gewährleistet sein, daß

der Anwender – also der Landwirt,

Gärtner oder Förster – bei einer

sachgerechten und bestimmungsgemäßen

Anwendung nicht gefährdet

ist. Auch eine mögliche Langzeitgefährdung,

wie zum Beispiel

die Erkrankung an Krebs nach 20

oder 30 Jahren, muß nach jeweiligem

Stand der Forschung ausgeschlossen

sein.

Verbraucherschutz

Es muß sichergestellt sein, daß

die Rückstände von Pflanzenschutzmitteln

im Erntegut beziehungsweise

ihre Abbauprodukte so niedrig sind,

daß die Gesundheit der Verbraucherinnen

und Verbraucher nicht gefährdet

wird. Die Lebensmitteluntersuchungsämter

der Länder nehmen

auf den Märkten und in Geschäften

regelmäßig Proben und kontrollieren

sie auf Rückstände. In der BBA werden

diese Verfahren vor allem auf

ihre Praktikabilität hin geprüft, so

daß die Untersuchungsämter einheitliche

Methoden verwenden können.

Die Qualität heutiger Lebensmittel

ist, wie die Kontrollen zeigen, sehr

gut: Nur bei ca. 1 % der Untersuchungen

werden noch – meist geringfügige

– Überschreitungen der

Rückstands-Höchstmengen festgestellt

(Abb. 2).

Boden, Wasser, Luft

Das Verhalten der Pflanzenschutzmittel

im Boden, im Wasser und in

der Luft wird eingehend untersucht.

Die Bodenfruchtbarkeit darf durch

Pflanzenschutzmittel nicht beeinträchtigt

werden. Beim Trinkwasser

besteht ein so hohes Reinheitsgebot,

daß von einem Quasi-Nullwert gesprochen

werden kann: Die erlaubte

Rückstands-Höchstmenge eines

Pflanzenschutzmittelwirkstoffs im

Trinkwasser beträgt 0,1 µg pro Liter

(entspricht 1 Teil auf 10 Milliarden)

und bewegt sich damit nahe an der

derzeitigen Nachweisgrenze.

35

Abtrift von Pflanzenschutzmitteln

ist seit langem ein Forschungsgebiet

in der Biologischen Bundesanstalt.

In welchem Ausmaß Pflanzenschutzmittel

verdunsten können, wurde hingegen

erst vor einigen Jahren durch

umfangreiche und schwierige Versuche

festgestellt.

Zeitgemäße Analyseverfahren

sind der Schlüssel für Untersuchungen

zum Verbleib der Präparate. Am

BBA-Institut für ökologische Chemie

wurde zum Beispiel eine Methode

entwickelt, mit der 180 Pflanzenschutzmittel-Wirkstoffe

in einem einzigen

Arbeitsgang nachgewiesen

werden können.

Belebte Umwelt

Die Eigenschaften der Pflanzenschutzmittel

auf die belebte Umwelt

Abb. 2: Rückstände von Pflanzenschutzmitteln in Obst

und Gemüse bzw. in Getreide (Untersuchungsergebnisse

für das Jahr 1996)

Obst und Gemüse

Obst und Gemüse

inländische Erzeugung

ausländische Erzeugung

1 % 4 %

31 % 34 %

68 % 62 %

10 %

Getreide

inländische Erzeugung

0,33 %

90 %

45 %

Proben ohne Rückstände (nicht bestimmbar)

Proben mit Rückständen bis einschl. der Höchstmenge

Proben mit Rückständen über der Höchstmenge

sind ein wichtiges und entscheidendes

Prüfgebiet, da beim ‘Spritzen’

meist nicht nur die Schaderreger getroffen

werden, sondern auch sogenannte

Nicht-Zielorganismen. Um

die Auswirkungen von Pflanzenschutzmitteln

in dieser Hinsicht abschätzen

zu können, muß jedes

2/1998 FORSCHUNGSREPORT

Getreide

ausländische Erzeugung

5 %

50 %


Gentechnik:

Mit einer

„Genkanone”

lassen sich

fremde Gene in

die Zellen von

einkeimblättrigen

Pflanzen

(z. B. Mais)

hineinschießen

FORSCHUNG & ADMINISTRATION

Präparat eine Reihe von Tests durchlaufen.

Dabei werden bestimmte Organismen

stellvertretend für die Vielzahl

der in Frage kommenden Arten

als Prüfobjekte ausgewählt. Richtlinien

für diese Tests werden von BBA-

Wissenschaftlern – teils in internationaler

Zusammenarbeit – entwickelt

und erprobt. Bestehende Richtlinien

werden nach dem jeweils neuesten

Wissensstand überarbeitet. In diesen

Regelwerken sind zum Beispiel

die Versuchstiere, die Versuchsdurchführung

und die Auswertung der

Tests beschrieben, so daß standardisierte

Prüfungen möglich sind.

Die Tests erfolgen in einem Stufensystem:

Am Beginn stehen Laborversuche,

in denen die direkte Giftigkeit

(Toxizität) oder stark schwächende

Effekte ermittelt werden.

Langjährige Erfahrungen haben gezeigt,

daß diese Versuche in der Regel

den „worst case”, also den härtesten

Test darstellen. Werden hier

keine Gefährdungen festgestellt, so

kann davon ausgegangen werden,

daß die Mittel unter natürlichen Freilandbedingungen

erst recht keine

gravierenden Auswirkungen auf die

getestete Art haben. Ist eine eindeutige

Bewertung aufgrund dieser Labortests

nicht möglich, so können

aufwendigere Versuche unter praxisnahen

Bedingungen folgen (z. B. im

Freilandkäfig oder auf dem Feld).

FORSCHUNGSREPORT 2/1998

Bedenkliche Mittel werden entweder

nicht zugelassen oder sind so

gekennzeichnet, daß ein Anwender

erkennt, ob beispielsweise Bienen

oder Marienkäfer und andere Nützlinge

geschädigt werden können.

Auflagen und Anwendungsbestimmungen

sollen gewährleisten, daß

bestimmte Gefährdungen, zum Beispiel

ein Eintrag in Gewässer, nicht

eintreten können. Ihre Übertretung

kann mit Bußgeld bis 100.000 DM

geahndet werden.

VERFAHREN IM

UMBRUCH

Zum 1. Juli 1998 ist eine Neufassung

des Pflanzenschutzgesetzes in

Kraft getreten, die die Richtlinie

91/414/EWG der Europäischen

Union zur Harmonisierung der

Pflanzenschutzmittelzulassung in deutsches

Recht umsetzt. Zwar ist eine einheitliche

EU-Zulassung unter anderem

wegen der großen klimatischen Unterschiede

in Europa nicht vorgesehen,

jedoch müssen die Mitgliedstaaten

Zulassungen aus anderen Staaten

übernehmen, wenn keine gravierenden

Gründe dagegen stehen. Es können

künftig nur Mittel zugelassen werden,

deren Wirkstoffe EU-weit geprüft

und akzeptiert sind.

PRÜFUNG VON

PFLANZENSCHUTZ-

GERÄTEN

Pflanzenschutzgeräte müssen

gleichmäßig arbeiten und sicher für

den Landwirt, Winzer oder Gärtner

sein. Die BBA prüft die schriftlich eingereichten

Erklärungen und Unterlagen

für neue Geräte. Die Gerätetypen

werden in die Pflanzenschutzgeräteliste

eingetragen und im

Bundesanzeiger bekanntgegeben.

Nur die in dieser Liste verzeichneten

Typen dürfen in Deutschland verkauft

werden. Die Sicherheitsanforderungen

für Pflanzenschutzgeräte sollen

EU-weit harmonisiert werden. Auch

36

Der Kompostwurm Eisenia foetida ist

Prüfobjekt, um die Auswirkungen von

Pflanzenschutzmitteln auf Bodenorganismen

zu beurteilen (Foto: H. Kula)

hier trägt die BBA mit eigenen Forschungen

dazu bei, einheitliche Regelungen

zu erarbeiten.

GENTECHNISCHE

SICHERHEIT

Die Regelungen zum Schutz der

menschlichen Gesundheit und der

Umwelt bei der Freisetzung und dem

Inverkehrbringen gentechnisch veränderter

Organismen sind EU-weit

harmonisiert.

Die Biologische Bundesanstalt

muß – ebenso wie das Umweltbundesamt

und in bestimmten Fällen

auch die Bundesforschungsanstalt

für Viruskrankheiten der Tiere – vor

jeder Freisetzung in Deutschland ihr

Einvernehmen geben, bevor ein entsprechender

Antrag vom Berliner

Robert-Koch-Institut genehmigt wird.

Auch auf diesem Gebiet ist eine umfassende

Begleitforschung unerläß-


FORSCHUNG & ADMINISTRATION

lich, um gentechnische Sicherheitsfragen

kompetent beurteilen zu können.

Innerhalb der BBA wird federführend

vom Institut für Pflanzenviro-

Pestizide oder Pflanzenschutzmittel?

Statt „Pflanzenschutzmittel” wird

häufig das Wort „Pestizid”

verwendet. Es leitet sich aus

dem Englischen ab und umfaßt

dort auch Mittel gegen Hygieneschädlinge

und Lästlinge,

z. B. Flöhe und Stechmücken

(englisch: pests). Im Englischen

gibt es unseren Begriff Pflanzenschutzmittel

nicht, obwohl EUweit

neuerdings der Ausdruck

„plant protection products”

verwendet wird. „Pestizid” stellt

einen ungenauen Begriff dar

und sollte deshalb vermieden

werden. Im Gegensatz dazu

sind die Begriffe „Herbizid”

(gegen Unkräuter/Ungräser,

engl. herbs), „Fungizid”

(gegen Pilze) und „Insektizid”

(gegen Insekten) unstrittig.

logie, Mikrobiologie und biologische

Sicherheit in Braunschweig für

jeden Freisetzungsantrag eine umfassende

Sicherheitsbewertung vorgenommen.

Die Züchter müssen genaue

Angaben machen über die

verwendeten gentechnischen Methoden

und über die Herkunft der

neuen Gene. Die Gesamteigenschaften

der transgenen Organismen

sowie mögliche Auswirkungen

auf den Naturhaushalt werden aufgrund

der gelieferten Informationen

und des durch eigene Arbeiten gewonnenen

Fachwissens abgeschätzt.

Beim Inverkehrbringen von

gentechnisch veränderten Organismen

durch Mitgliedstaaten der EU

wirkt die BBA ebenfalls mit. In Europa

wurden bisher für sechs verschiedene

Kulturarten Genehmigungen

erteilt, unter anderem für die viel diskutierte

herbizidtolerante Sojabohne

und für insektenresistenten Mais (Bt-

Auch

Pflanzenschutzgeräte

wie dieses

Recyclinggerät für

den Weinbau müssen

gesetzliche

Anforderungen

erfüllen

Mais). International liegen inzwischen

umfangreiche Erfahrungen mit

gentechnisch veränderten Kulturpflanzen

vor. 1998 wurden sie weltweit

bereits auf rund 28 Mio. ha

kommerziell angebaut, wobei die

USA mit etwa 20 Mio. ha Anbaufläche

führend sind.

Die in Deutschland durchgeführten

Freilandversuche mit transgenen

Pflanzen werden von Forschungsprojekten

begleitet, die auch ökologische

Fragestellungen mit einbeziehen

und wertvolle Daten für die Beurteilung

eventueller Langzeitauswirkungen

liefern. Das BBA-Institut für in-

37

tegrierten Pflanzenschutz in Kleinmachnow

betreut beispielsweise einen

mehrjährigen Feldversuch mit

transgenem Raps und Mais, bei

dem verschiedene Pflanzenschutzaspekte

im Mittelpunkt stehen. Durch

solche praxisnahen Untersuchungen

läßt sich abschätzen, wie sich gentechnisch

veränderte Kulturpflanzen

in moderne Pflanzenschutzkonzepte

einbinden lassen.

FORSCHUNG

FÜR VERBRAUCHER

UND UMWELT

Viele wissenschaftliche Arbeiten

an der BBA fließen unmittelbar in die

ihr gesetzlich übertragenen hoheitlichen

Aufgaben ein. Die Anforderungen

an die Zulassung von

Pflanzenschutzmitteln werden ständig

optimiert und an den Stand der

Forschung angepaßt. Molekularbiologische

Arbeiten erlauben es,

Entwicklungen im Bereich der Gentechnik

beurteilen und bewerten zu

können. Praktische Feldversuche geben

Auskunft über den Erfolg neuer

Ansätze im Pflanzenschutz.

Die Forschungen bilden damit die

Grundlage für Entscheidungen zum

Wohl der Verbraucher und des Naturhaushalts.


Dr. W. Wohlers, Dr. M. Welling,

Biologische Bundesanstalt für Landund

Forstwirtschaft, Messeweg 11-

12, 38104 Braunschweig

2/1998 FORSCHUNGSREPORT


WALDBÖDEN

SIND LEBENDIG

Etwa 4.000 bis 5.000 gut sichtbare

Bodentiere (> 2 mm) wurden in

Waldbodenfallen je Quadratmeter

pro Jahr gefangen (vgl. Abb. 1).

Rechnet man noch die mit bloßem

Auge unsichtbaren Lebewesen hinzu,

ergeben sich sogar Individuenzahlen

in Größenordnungen von Billionen

(10 12 ). Für diese Lebewesen

stellt der Waldboden den notwendigen

Lebensraum dar.

Gleichzeitig sind die Waldbodenlebewesen

aber auch für das

Zustandekommen der Böden und

den Erhalt der Bodenfruchtbarkeit

eine unabdingbare Voraussetzung.

Sie ernähren sich von der alljährlich

anfallenden Blattstreu und wandeln

dabei (manchmal erst nach mehreren

„Fraß-Hierarchien”) die in den

pflanzlichen Resten gespeicherten

Nährstoffe in pflanzenverfügbare

Stoffe (Mineralien) um.

Abhängig von den Standortbedingungen

geschieht dieser Abbau

unterschiedlich schnell. Etwa fünf

Jahre dauert es zum Beispiel, bis in

WALDÖKOLOGIE

Zustand der

deutschen Waldböden

Auswirkungen anthropogener Einflüsse

Barbara Wolff, Winfried Riek und Petra Hennig (Eberswalde)

Die Böden der deutschen Wälder haben sich in den letzten Jahrzehnten deutlich verändert.

Vor allem durch hohe Fremdstoffeinträge aus der Atmosphäre ist die Funktionsfähigkeit

der Waldböden – regional in unterschiedlichem Ausmaß – beeinträchtigt.

Um die Rolle des Bodens im Zusammenhang mit den Immissionsbelastungen

der Waldökosysteme regional differenziert beurteilen zu können, wurde im Zeitraum

von 1987-1993 eine bundesweite Bodenzustandserhebung im Wald (BZE) durchgeführt.

Durch die anschließende Zusammenführung ausgewählter Inventurdaten konnte

an der Bundesforschungsanstalt für Forst- und Holzwirtschaft (BFH) erstmalig eine nach

einheitlichen Kriterien erhobene nationale Datenbasis über den Waldbodenzustand und

die Ernährungssituation der Waldbäume aufgebaut werden.

FORSCHUNGSREPORT 2/1998

einem typischen Buchenwald die

Blattstrukturen in der Bodenstreu

weitgehend zerstört sind, und erst

nach weiteren fünf Jahren entstehen

mineralische Substanzen und lösliche

Humusstoffe, welche die

Abb. 1: Anzahl von Waldbodentieren pro Quadratmeter und Jahr. Durchschnittliche

Fangsummen aus 24 in vier Waldgebieten aufgestellten Bodenfallen

(Photoeklektoren) (Graphik: U. Schulz)

38


WALDÖKOLOGIE

39

schwarze Färbung der obersten Mineralbodenschicht

verursachen (vgl.

Abb. 2). In einem Auwald wird dagegen

die Streu bereits in einem

Jahr abgebaut.

Im Verlauf der Evolution haben

sich unterschiedliche Waldökosystemtypen

an die verschiedensten

Standortverhältnisse angepaßt, immer

jedoch ist der Boden die Schaltstelle

für den Stoffkreislauf in Wäldern.

Hier findet das ökologische

Zusammenspiel von biologischen

(Tiere, Pflanzen), chemischen (z. B.

Nährelementvorräte, Schadstoffkon-

Abb. 2: Der Bohrkern zeigt die obersten

Bodenschichten mit Blattstreu, zunehmender

Zersetzung des organischen Materials

und schwarzer Humusschicht

zentrationen) und physikalischen

(z. B. Wasser, Luft) Faktoren statt,

dessen Ergebnis in der Bodenfruchtbarkeit

zum Ausdruck kommt. Obwohl

die im Boden wirksamen Regelmechanismen

längst noch nicht

alle erforscht sind, haben die Erfahrungen

der Vergangenheit gezeigt,

daß massive oder langanhaltende

Eingriffe in dieses biologische Regelsystem

gravierende Auswirkungen

auch auf das Waldwachstum haben.

2/1998 FORSCHUNGSREPORT


WALDBÖDEN SIND SAUER

Unter natürlichen Bedingungen

wird Säure bei mikrobiellen Stoffumwandlungsprozessen,

bei der Atmung

der Wurzeln und der Festlegung

von Nährelementen in der Biomasse

gebildet. Auch periodische

Störungen, wie etwa das Zusam-

Abb. 3: Bodenprofil in einem Buchenmischwald:

Der Bodentyp ist ein Sandbraun-

Podsol; die vertikale Störung rührt von

einem alten Wurzelkanal her

menbrechen alter Waldbestände,

können aufgrund der dann beschleunigt

ablaufenden Mineralisierung

der Humusschicht eine Erhöhung

der Bodenacidität bewirken.

Waldböden sind daher von

Natur aus stets saurer als Ackerböden.

Allerdings stellt diese natürliche

Säurelast kein Problem für die Wälder

dar: Die Waldböden können im

Normalfall darauf mit chemischen

Reaktionen reagieren, das heißt, sie

FORSCHUNGSREPORT 2/1998

WALDÖKOLOGIE

sind in der Lage, die Säure abzupuffern.

WALDBÖDEN

WERDEN BEOBACHTET

Untersuchungen aus den letzten

20 Jahren in verschiedenen Waldökosystemen

zeigen ernsthafte und

außergewöhnlich schnell ablaufende

Veränderungen des chemischen

Waldbodenzustandes – verursacht

durch Fremdstoffeinträge aus der Atmosphäre.

Überdies kamen viele interdisziplinäre

Forschungsprogramme zu

dem Ergebnis, daß auch die seit

Mitte der 70er Jahre in Deutschland

großflächig auftretenden Waldschäden

(Kronenverlichtungen) vielerorts

auf Luftschadstoffe, die in den Boden

eingetragen wurden, zurückzuführen

sind. Von dem Filter-, Pufferund

Stoffumwandlungsvermögen

der Waldböden hängt es nämlich

letztlich ab, ob die im Laufe der Jahre

angesammelten Fremdstoffe zu

ernsthaften Störungen der Lebensgemeinschaft

Wald führen.

BUNDESWEITE BODEN-

ZUSTANDSERHEBUNG

IM WALD (BZE)

Um die Rolle des Bodens im Zusammenhang

mit den Immissionsbelastungen

der Waldökosysteme

regional differenziert beurteilen zu

können, wurde von 1987 bis 1993

eine bundesweite Bodenzustandserhebung

im Wald (BZE) durchgeführt.

Dies geschah in Ergänzung

zur jährlichen Waldzustandserhebung.

Über ganz Deutschland wurde

dafür ein regelmäßiges Gitternetz

mit einer Maschenweite von 8x8 km

gelegt. Jeder Gitternetzschnittpunkt

stellt heute einen BZE-Stichprobenpunkt

dar: Genau dort bzw. in der

nahen Umgebung dieses Punktes

wurde ein Bodenprofil gegraben

(Abb. 3), Bodenproben und Humus-

40

proben entnommen sowie der

Waldzustand eingeschätzt. Überdies

wurden Nadel-/Blattproben

gewonnen, um auch die

Ernährungssituation der Waldbäume

untersuchen zu können.

Die BZE war Teil des bundesweiten

Umweltmonitorings im Wald.

Sie erfolgte in Regie der jeweiligen

Bundesländer. Ausgewählte Inventurdaten

wurden am BFH-Institut für

Forstökologie und Walderfassung in

Eberswalde zusammengeführt und

ausgewertet. Dadurch war es erstmalig

möglich, eine nach einheitlichen

Kriterien erhobene und nach

vergleichbaren Methoden analysierte

nationale Datenbasis über den

Waldbodenzustand und die

Ernährungssituation der Waldbäume

aufzubauen.

Die vorliegenden Kennwerte erlauben

regional differenzierte Aussagen

über:

■ das Ausmaß von Bodenversauerung

und Basenverarmung,

■ die Akkumulation von Schadstoffen,

■ Risiken für Grund- und Quellwasser,

■ Ungleichgewichte in der Baumernährung.

Abb. 4: Zusammenhang zwischen pH-Wert und

Basensättigung. In einem relativ engen Bereich

um pH 4 kommt es zu einem starken Umschwung

in der Basensättigung

Basensättigung (%)

100

90

80

70

karbonathaltige

neutrale Böden

60

Bereich hoher

Versauerungs-

50

40

dynamik

30 extrem

20

10

0

saure

Böden

2,5 3 3,5 4 4,5 5 5,5 6 6,5 7

pH-Wert in 0-10 cm Tiefe


Entnahme einer Bodenprobe

Neben der Dokumentation des

aktuellen Waldboden- und

Ernährungszustandes liefert die BZE

– vor allem im Zusammenhang mit

künftigen Folge-Inventuren – Aussagen

über Ausmaß, Dynamik und

räumliche Verbreitung von Bodenveränderungen.

WALDBÖDEN

WERDEN SAURER

Fallstudien haben zu dem Schluß

geführt, daß anthropogene, säurebildende

Stoffeinträge („Saurer Regen”)

die bodeninternen Puffersysteme

überfordern können.

Ein Indiz für den Säurezustand

des Bodens ist der pH-Wert. Er beschreibt

die im Boden vorhandene

Säurestärke. Absinkende pH-Werte

weisen darauf hin, daß die Säurebelastung

die Pufferrate der Böden

übersteigt. Ab einem pH unter 4,2

(Aluminium-Pufferbereich) gelangen

zunehmend für Lebewesen schädliche

Aluminium- (Al 3+ ), Eisen- (Fe 3+ )

und Wasserstoff-Ionen (H + ) in die

Bodenlösung. Weil Säureeinträge

auch zu stofflichen Umwandlungen

im Boden führen können, ohne daß

sich der pH-Wert merklich ändert, ist

der pH-Wert allein noch kein aussagefähiger

Kennwert zur Beschreibung

von Versauerungserscheinun-

WALDÖKOLOGIE

gen. Die Basensättigung – das heißt

der Anteil der austauschbar gebundenen

basischen Nährelemente – ist

dagegen ein guter Weiser für die

Säureneutralisationskapazität der

Böden. Mit ihr läßt sich bei Berücksichtigung

des Ausgangsgesteins

die Elastizität gegenüber weiteren

Säureeinträgen beurteilen (vgl. Abb.

4).

Entsprechend der geochemischen,

klimatischen und nutzungsgeschichtlichen

Vielfalt der deutschen

Waldböden war für den Säure-/Basenzustand

eine hohe Variabilität zu

erwarten. Gemessen an den erheblichen

Unterschieden im Mineralbestand

der einzelnen Gesteine

(= Substrate) sind die aktuellen substratspezifischen

Unterschiede im

Oberboden (bis in 30 cm Tiefe)

aber ausgesprochen gering. Lediglich

die Kalkstandorte sowie Böden

auf Basalt bzw. Diabas zeichnen

sich durch eine bessere Ausstattung

mit Nährelementen sowie höhere

pH-Werte aus.

Mehr als 80 % der untersuchten

carbonatfreien Standorte befinden

sich bis in die Tiefe von 30 cm in

dem für viele Bodenlebewesen

ungünstigen Aluminium- oder Eisenpufferbereich

(pH < 4.2), mehr als

60 % weisen geringe bis sehr

geringe Basensättigungen auf

(BS < 15 %). Tendenziell höhere

pH-Werte, die nicht auf das Substrat

zurückgeführt werden können, kennzeichnen

das Nordostdeutsche Tiefland

(vgl. Abb. 5). Dies wird auf die

hier in der Vergangenheit vergleichsweise

geringeren Säuredepositionen

in Verbindung mit hohen Einträgen

basischer Flugaschen zurückgeführt.

Generell nimmt der Basenanteil

mit zunehmender Tiefe zu. Im Unterboden

(bis 140 cm Tiefe) weisen

noch etwa ein Drittel der BZE-Standorte

hohe Pufferreserven auf; insgesamt

überwiegen aber geringe

bis mäßige Basensättigungsgrade

(BS 5–30 %).

Die BZE-Stichprobe belegt, daß

mit Ausnahme der Kalkstandorte von

41

einer flächendeckenden, weitgehend

substratunabhängigen Versauerung

und Basenverarmung im

Oberboden ausgegangen werden

muß.

DIE BODENFRUCHTBARKEIT

LEIDET

Nimmt der pH-Wert ab, können

wichtige Bodenlebewesen nicht

mehr an der Zersetzung der Bodenstreu

teilhaben. Die Streu sammelt

sich, und die darin enthaltenen

Nährstoffe werden (zumindest vorübergehend)

dem Stoffkreislauf entzogen.

Die BZE-Auswertung hat gezeigt,

daß sich vor allem bei denjenigen

Standorten, die schon von

Natur aus nährstoffarm sind, derzeit

der überwiegende Anteil der kurzbis

mittelfristig verfügbaren Nährele-

mente in der Humusauflage und

nicht mehr im Mineralboden befindet.

Durch die gleichzeitig zu beobachtende

Basenauswaschung aus

dem Mineralboden geraten die

Waldökosysteme in eine zunehmend

instabile Versorgungssituation.

Insbesondere für Magnesium stellen

sich bereits heute – schwerpunktmäßig

in den Mittelgebirgslagen –

Mangelsituationen ein.

Bei der Bewertung der Ernährungssituation

der Waldbäume anhand

der Nadel-/Blattanalysedaten

deutet sich überdies vor allem im

nördlichen Teil Deutschlands eine

Überernährung mit Stickstoff an. Zu-

2/1998 FORSCHUNGSREPORT

Bodenproben

werden im

Labor für die

chemische

Analyse

vorbereitet


FORSCHUNGSREPORT 2/1998

WALDÖKOLOGIE

Abb. 5: Räumliche Verteilung der pH-Werte (in 10-30 cm Bodentiefe) im deutschen Bundesgebiet

42


dem weisen alle beprobten Kiefern

und Buchen sowie 59 % der Fichten

erhöhte Schwefelgehalte auf, so

daß von einer flächendeckenden,

wenn auch regional unterschiedlich

hohen, Schwefel-Immissionseinwirkung

auszugehen ist.

Die großräumige Immissionsbelastung

der Waldböden zeigt sich

auch bei der Betrachtung der

Schwermetallgehalte in der Humusauflage.

Auf 25 % bzw. 38 % der

BZE-Standorte wurden Blei- und

Kupfergehalte gemessen, die für

wichtige Bodenorganismen im Stoffkreislauf

der Wälder giftig sind.

DIE WASSERQUALITÄT

LEIDET

Waldböden speichern das Niederschlagswasser

und geben es nur

langsam wieder ab. Im Verlauf der

Versickerung durch den Waldboden

wird das Niederschlagswasser von

Schadstoffen gereinigt. Diese Filterwirkung

von Waldstandorten ist für

die Trinkwassergewinnung von essentieller

Bedeutung.

Heute ist jedoch festzustellen,

daß die mit der Bodenversauerung

einhergehende Mobilisierung von

Aluminium, Eisen und Mangan zu

erhöhten Konzentrationen dieser Elemente

im abfließenden Sicker- und

Oberflächenwasser der Wälder

führt.

Überdies stellt die Verlagerung

von versauerungsbedingt mobilisierten

Schwermetallen ein Gefahrenpotential

für die Hydrosphäre dar.

Die BZE-Auswertungen legen den

Schluß nahe, daß in Belastungsgebieten

mit hohen Schwermetalleinträgen

aus der Atmosphäre davon

auszugehen ist, daß bei den beobachteten

niedrigen pH-Werten im

Oberboden bereits größere Mengen

Zink und Cadmium ausgewaschen

worden sind.

Angesichts der bedeutenden luftverfrachteten

Stickstoffeinträge in

Wälder und der Ansammlung von

Stickstoff in den Humusauflagen der

WALDÖKOLOGIE

sauren Waldböden muß außerdem

bei einem beschleunigtem Humusvorratsabbau

mit erhöhten Nitratausträgen

aus den betroffenen Waldökosystemen

gerechnet werden.

DIE WALDÖKOSYSTEME

SIND GESTÖRT

Wie die bundesweite Bodenzustandserhebung

im Wald (BZE) gezeigt

hat, sind die Filter-, Puffer- und

Stoffumwandlungseigenschaften der

Waldböden in vielen Regionen gestört.

Erste integrierende Auswertungen

von bodenchemischen und

ernährungskundlichen Daten sowie

den Ergebnissen der terrestrischen

Waldzustandserhebung haben zudem

Zusammenhänge zwischen

dem Bodenzustand, dem Ernährungszustand

und der Vitalität der

Waldbäume deutlich werden lassen.

Natürlich sind längst noch nicht

alle Wirkungsmechanismen in

Waldökosystemen bekannt. Durch

die BZE konnte aber bereits jetzt sicher

festgestellt werden, daß viele

Waldböden ihre Aufgabe in einem

funktionierenden Waldökosystem

nur noch eingeschränkt wahrnehmen

können. Die Selbstregulationsfähigkeit

der Wälder ist überschritten,

Vitalitätseinbußen der Waldbäume

sind die Folge. Nur durch

ein konsequentes, aber behutsames,

umweltbewußtes Handeln wird es

möglich sein, die eingetretenen

Schäden teilweise zu beheben.

Für die Forstwirtschaft bedeutet

dies, aus standortangepaßten,

IMPRESSUM

FORSCHUNGSREPORT

Ernährung – Landwirtschaft –

Forsten

2/1998 (Heft 18)

Herausgeber:

Senat der Bundesforschungsanstalten

im Geschäftsbereich des Bundesministeriums

für Ernährung,

Landwirtschaft und Forsten

43

Schriftleitung & Redaktion:

Dr. M. Welling

Geschäftsstelle des Senats

der Bundesforschungsanstalten

c/o Biologische Bundesanstalt für

Land- und Forstwirtschaft,

Messeweg 11/12,

38104 Braunschweig

Tel.: 0531 / 299-3396

Fax: 0531 / 299-3001

E-mail: senat@bba.de

Redaktionsbeirat:

Dr. P.W. Wohlers, BBA Braunschweig

Dr. H. Brüning, BAZ Grünbach

möglichst tiefwurzelnden Baumarten

stabile und – soweit standörtlich

möglich – artenreiche Mischbestände

herauszupflegen. Humusschonende

Bewirtschaftungsweisen, die

Vermeidung von Kahlschlägen sowie

die Verringerung überhöhter

Wildbestände sind dabei unbedingt

zu berücksichtigen.

Allerdings können Waldbewirtschaftungsverfahren

– ebenso wie

Bodenschutzkalkungen und Ergänzungsdüngungen

– die Probleme

nur begrenzt entschärfen. Eine weitere

Reduzierung von Luftschadstof-

fen und eine konsequente Luftreinhaltepolitik

sind daher für die Erhaltung

der Waldökosysteme zwingend

erforderlich. ■

Dr. B. Wolff, Dr. W. Riek und P. Hennig,

Bundesforschungsanstalt für

Forst- und Holzwirtschaft, Institut für

Forstökologie und Walderfassung,

Postfach 10 01 47, 16201 Eberswalde

Online-Redaktion:

TAKO

Auf dem Äckerchen 11

53343 Wachtberg

Tel.: 0228 / 9323213

E-mail: frohberg@tako.de

Konzeption, Satz und

Druck:

AgroConcept GmbH

Clemens-August-Str. 12-14

53115 Bonn

Tel.: 0228/969426-0

Fax: 0228/630311

Internet-Adresse:

http://www.dainet.de/senat/

Bildnachweis:

AgroConcept GmbH, Bonn

D. Fraatz, BBA Braunschweig

M. Welling, Braunschweig

Erscheinungsweise:

Der ForschungsReport erscheint

zweimal jährlich

Nachdruck, auch auszugsweise,

mit Quellenangabe zulässig

(Belegexemplar erbeten)

ISSN 0931-2277

Druck auf chlorfrei gebleichtem

Papier

2/1998 FORSCHUNGSREPORT

Die Bodenversauerung

kann

Oberflächengewässer

in

Wäldern

beeinträchtigen


Das Institut für

Tierzucht und

Tierverhalten

ist ein

ehemaliges

Klostergut,

eingebettet in

den dörflichen

Charakter ca.

20 km

nordwestlich

von Hannover

UMSTRUKTURIERUNG

Seit dem 1. Januar 1998 werden

das Institut für Tierzucht und Tierverhalten

Mariensee und das Institut für

Kleintierforschung Celle/Merbitz als

Institut für Tierzucht und Tierverhalten

Mariensee mit vier Außenstandorten

(Trenthorst/Wulmenau, Celle, Höfer,

Merbitz) weitergeführt. Die Außenstandorte

werden in Folge des Rahmenkonzeptes

des BML nach einem

mehrstufigen Umsetzungskonzept in

den nächsten Jahren geschlossen, wobei

die Aufgaben an die FAL-Standorte

Mariensee und Braunschweig (Geflügelernährung)

verlegt werden.

Auch fachliche Gründe sprechen für

eine Umstrukturierung der Nutztierforschung

der FAL mit Konzentration am

Standort Mariensee: Bestehende, hi-

PORTRAIT

BUNDESFORSCHUNGSANSTALT FÜR LANDWIRTSCHAFT (FAL)

Institut für Tierzucht und Tierverhalten

Mariensee

Rund 63 % der Verkaufserlöse der deutschen Landwirtschaft (ca. 38 Mrd. DM) stammen

aus der tierischen Produktion. Die Hauptzielsetzung ist eine international

wettbewerbsfähige Erzeugung hochwertiger Produkte für den menschlichen Konsum

unter Berücksichtigung von Verbraucherwünschen, Gesundheit und Schutz der Tiere,

Erhaltung der genetischen Vielfalt sowie Umweltverträglichkeit. Dabei ist die Tierproduktion

auf eine ebenso wettbewerbsfähige wie innovative Forschung angewiesen. Das

Institut für Tierzucht und Tierverhalten Mariensee erarbeitet als Ressortforschungsinstitut

auf den genannten Gebieten wissenschaftliche Grundlagen als Entscheidungshilfe für

das BML und erweitert den wissenschaftlichen Erkenntnisstand.

FORSCHUNGSREPORT 2/1998

storisch begründete Grenzen zwischen

Groß- und Kleintierforschung

sind nicht länger aufrecht zu erhalten.

Wissensbasis, Fragen, Problemstellungen

und Methodenrepertoire sind

sehr ähnlich; Effizienz, Verbesserung

und Optimierung der Nutzung verfügbarer

Ressourcen durch fachliche und

räumliche Zusammenführung von fünf

auf einen Standort lassen eine Verbesserung

der wissenschaftlichen Effizienz,

der interdisziplinär-fachlichen Interaktion

und der Wahrnehmung von

Ressortaufgaben erwarten.

Die künftigen Arbeitsschwerpunkte

sind im „Wissenschaftlichen und organisatorischen

Konzept der FAL für

das Institut für Tierzucht und Tierverhalten”

aus dem Jahre 1997 niedergelegt

und nachfolgend verkürzt wiedergegeben.

44

FORSCHUNGSSCHWERPUNKTE

Genetik und

Genetische Ressourcen

■ Züchtungs- und Populationsgenetik:

Erarbeitung methodischer und theoretischer

Kenntnisse vor allem im

Bereich statistischer Modelle für die

Tierzucht; Anwendung genetischstatistischer

Verfahren unter Nutzung

neuer biotechnologischer Entwicklungen;

Planung und Bewertung

von Zuchtprogrammen; Weiterentwicklung

von wissenschaftlichen

Grundlagen der Leistungsprüfung;

Züchterische Einflüsse auf Verhaltensmerkmale(Verhaltensgenetik).

■ Molekulargenetik und molekulare

Marker: Nutzung molekularbiologischer

Verfahren für die Züchtung;

Aufklärung der Zusammenhänge

von Struktur, Organisation und

Funktion von Genen als Voraussetzung

für den Gentransfer bei landwirtschaftlichen

Nutztieren.

■ Tiergenetische Ressourcen: Nutzung

populationsgenetischer und

molekulargenetischer Verfahren zur

Identifizierung von Populationen;

Erarbeitung von Methoden und

Strategien zur Erhaltung nutztiergenetischer

Ressourcen.

Nutztierphysiologie

■ Erarbeitung systemphysiologischer

Zusammenhänge der Körperfunktion

landwirtschaftlicher Nutztiere:

Regulation des prä- und postnatalen

Wachstums, Regulation der Reproduktion,

Regulation des Verhaltens.

■ Erforschung molekularer und physiologischer,

besonders endokriner

Regelsysteme: von Wachstum, Reproduktion

und Adaptation und

von Verhaltensäußerungen.


Produktqualität von landwirtschaftlichen

Nutztieren ist mit Hilfe der Computertomographie

bereits am lebenden Tier

feststellbar

■ Leistungsphysiologie der Tierproduktion:

zur Erkennung und Bewertung

von physiologischen Grenzen.

■ Biologische Folgenabschätzung:

von bio- und gentechnischen Verfahren,

von züchtungsbedingten

Veränderungen genomischer Expression.

■ Entwicklung von Methoden in der

Nutztierphysiologie: zur Abschätzung

des Bedarfs der Tiere, zum

Schutz der Tiere.

Biotechnologie

■ Entwicklung neuer Verwendungsmöglichkeiten

und Nutzung landwirtschaftlicher

Nutztiere (transgene

Tiermodelle als Produktionsalternativen).

■ Biotechnologie-Folgeabschätzung

zum Schutz von Tier und Konsument

(Molekulare und zellbiologische

Regulation der frühen Embryonalentwicklung

und Differenzierung

– Genexpression).

■ Entwicklung von Biotechnologien

zur Erhaltung tiergenetischer Ressourcen

(Reifung und Befruchtung

von Oocyten und in vitro Entwicklung

von Embryonen).

■ Entwicklung biotechnischer Verfahren

als Beitrag zur Sicherung der

Ernährung der Weltbevölkerung.

Haltung und Tierschutz

■ Bewertung, Weiterentwicklung

und Optimierung von Haltungs-

PORTRAIT

systemen unter Gesichtspunkten

des biologischen Bedarfs, der Tiergesundheit,

der Ökologie und der

Ökonomie.

■ Ermittlung des biologischen Bedarfs

unter besonderer Berücksichtigung

von Motivation, Furcht, Verhaltensontogenese,

-adaptation,

-rhythmizität und -expression bei

Haltung und Transport.

■ Untersuchungen zum Einfluß und

zur Bedeutung natürlicher und technisch

bedingter Umweltfaktoren

auf Funktion und Verhalten von

Nutztieren.

■ Methodische Entwicklungen insbesondere

zu tierschutzrelevanten

Fragestellungen.

Prozeß- und

Produktqualität

■ Interaktionen zwischen Produktqualität,

Umwelt, Haltungsverfahren,

Leistungsfähigkeit, Gesundheit und

Hygiene.

■ Magnet-Resonanz-Analysen von

Körperzusammensetzung und von

Qualitätsmerkmalen während des

Wachstums und bei der Fleischerzeugung.

■ Neue Methoden und Überprüfung

der Qualitätsbewertung, Tiergesundheit

und Bestandshygiene.

■ Entwicklung, Erprobung und Einführung

molekularbiologischer Methoden

für die Diagnostik und Epidemiologie

tier-, produkt- und prozeßhygienisch

relevanter bakterieller

Erreger.

INFRASTRUKTUR

Das Aufgabenspektrum des Instituts

ist nur über eine Verstärkung des planmäßigen

Wissenschaftlerstammes

durch zahlreiche Gastwissenschaftler

aus dem In- und Ausland sowie durch

Drittmittel zu bewältigen. Darüber hinaus

wird eine intensive Zusammenarbeit

mit universitären und außeruniversitären

Einrichtungen im In- und Ausland

gepflegt.

Neben Standardlaboratorien, (Biophysikalische

Meßwerterfassung,

45

Molekularbiologie bis zur Sicherheitsstufe

2, Hormonanalytik, Zellkultur,

Mikrobiologie, Histologie, Verhaltensforschung

einschließlich Bioakustik)

verfügt das Institut über spezielle Versuchseinrichtungen

für landwirtschaftliche

Nutztiere (Magnet-Resonanz-Tomographie

für Tiere, Hochgeschwindigkeitslaufband,

Operationsräume,

Klimastall, Brüterei, Schlachtanlagen

u.a.m.).

Die Versuchswirtschaften stehen für

die versuchsmäßige Unterbringung

und Versorgung von Rindern, Schafen,

Schweinen, Pferden sowie Geflügel

und Kaninchen mit modernen Stallungen,

Ausläufen und schlagkräftiger

Außenwirtschaft bereit.

Das Institut nimmt Diplomanden,

Doktoranden und Postdocs auf. Es ist

anerkannte Weiterbildungsstätte für

Tierärzte zum Fachtierarzt für Physiologie

und Physiologische Chemie, Mikrobiologie

sowie Reproduktionsmedizin.

Außerdem ist es Ausbildungsstätte

für Biologielaboranten, land-

wirtschaftlich technische Assistenten/innen

(Schwerpunkt Tierproduktion),

für Tierwirte (Geflügel), für Handwerker

(Feinmechaniker), landwirtschaftliche

Gehilfen und Landmaschinenmechaniker.


Prof. Dr. sc. agr. Dr. habil. Dr. h.c.

Franz Ellendorff (M.Sc.), Bundesforschungsanstalt

für Landwirtschaft

(FAL), Institut für Tierzucht und Tierverhalten,

Höltystraße 10, 31535 Neustadt

2/1998 FORSCHUNGSREPORT

Forschungsarbeiten

zur

Erhaltung

genetischer

Ressourcen

(hier das

Schwarzbunte

Niederungsrind)

und zur

umweltgerechtenFlächenbewirtschaftung

werden

durch größere

Tierbestände

und Flächen

ermöglicht


Dem Institut für landwirtschaftliche

Kulturen (ILK) stehen nach dem Feinkonzept

2005 für die Forschung im

Ressortbereich des Bundesministeriums

für Ernährung, Landwirtschaft

und Forsten (BML) 35 Personalstellen

aus Haushaltsmitteln zur Verfügung,

davon zwölf Wissenschaftlerstellen.

Aus Drittmitteln sind zur Zeit weitere

acht wissenschaftliche und technische

Mitarbeiter angestellt.

Das ILK unterhält circa 2600 m 2

Gewächshausfläche, zum Teil als klimatisierbareKabinengewächshäuser

und S1-Gentechnik-Arbeitsbereiche,

sowie rund 900 m 2 Molekularbiologie-,

Biotechnologie-, Radionuklid-,

Resistenzlaborflächen sowie

sonstige Arbeitsräume. Gemeinsam

mit dem Nachbarinstitut werden

52 ha Versuchsfläche einschließlich

Freisetzungsflächen bewirtschaftet.

AUFGABEN

Das ILK hat die Aufgabe, für ausgewählte

landwirtschaftliche Kulturarten

genetisch definiertes Basismaterial

zu erstellen und effiziente Züchtungsmethoden

zu erarbeiten. Hierbei

stehen Aspekte der gesunden

PORTRAIT

BUNDESANSTALT FÜR ZÜCHTUNGSFORSCHUNG AN KULTURPFLANZEN

Institut für landwirtschaftliche

Kulturen, Groß Lüsewitz

Mit der Gründung der Bundesanstalt

für Züchtungsforschung an Kulturpflanzen

(BAZ) am 1. Januar 1992

wurden am Standort Groß Lüsewitz bei Rostock

drei Institute eingerichtet: Das Institut

für Streßphysiologie und Rohstoffqualität,

das Institut für Züchtung landwirtschaftlicher

Kulturpflanzen und das Institut für

Züchtungsmethodik landwirtschaftlicher

Kulturpflanzen. Die beiden letztgenannten

Institute wurden im Mai 1998 zum Institut

für landwirtschaftliche Kulturen zusammengefaßt.

Merkmalsgene für die markergestützte Selektion werden isoliert und charakterisiert

FORSCHUNGSREPORT 2/1998

Pflanze, der Produktqualität sowie

der nachwachsenden Rohstoffe im

Vordergrund.

Die Auswahl der bearbeiteten

landwirtschaftlichen Kulturpflanzen

orientiert sich am langfristigen Forschungsbedarf

sowie an den regionalen

ökologischen und pflanzenbaulich-züchterisch

relevanten Gegebenheiten.

Die gegenwärtig bearbeiteten

ca. 30 Forschungsprojekte

befassen sich mit Raps und anderen

Brassicaceen, Kartoffel, Gerste, Roggen,

Hafer, Triticale und Weidelgräsern.

ERSTELLUNG VON

BASISMATERIAL

Das ILK erstellt Ausgangsmaterial

für die Pflanzenzüchtung mit genetisch

definierten Merkmalen. Dafür

werden sowohl klassische als auch

biotechnologische und gentechnische

Methoden angewendet.

Arbeitsschwerpunkte bei der Kartoffel

sind dauerhafte Resistenzen gegenüber

dem Pilz Phytophthora infestans

und Erregern der Knollenfäulen,

Kaltlagerungseignung im Hinblick

auf die Kartoffelverarbeitung und in

46

begrenztem Maße die Züchtung auf

diploider Valenzstufe. Die Resistenzzüchtung

bedient sich zum einen

langfristig angelegter Kreuzungs- und

Selektionsprogramme, um aus verwandten,

kreuzbaren Wildarten der

Kartoffel wertvolle Resistenzgene in

das Genom der Kulturkartoffel einzulagern.

Zum anderen werden auch

nicht kreuzbare Solanum-Arten als

Resistenzquelle genutzt, indem durch

die Fusion zellwandloser Pflanzenzellen

(Protoplastenfusion) die Genome

verschiedener Partner miteinander

kombiniert werden.

Die züchterischen Aktivitäten bei

Raps konzentrieren sich gegenwärtig

auf die Bearbeitung der Ölqualität

und die Nutzung der Selbstinkompatibilität

als System der Befruchtungskontrolle.

Für die Verwendung als

nachwachsender Rohstoff können

Rapsformen erzeugt werden, die besonders

hohe Gehalte an bestimmten

Fettsäuren im Samenöl aufweisen.

Hierzu werden am ILK neben klassisch-züchterischen

auch gentechnische

Methoden angewandt, um

durch die Übertragung von Genen

aus ölreichen Wildpflanzen oder anderen

Organismen das hohe natürliche

Öl-Ertragspotential von Raps mit


der Fähigkeit zur Synthese spezifischer

Fettsäuren zu kombinieren.

Die Aktivitäten bei Getreide und

Gräsern konzentrieren sich auf die

Erzeugung krankheitsresistenten Materials

unter Berücksichtigung der

agronomischen Leistungsmerkmale.

Schwerpunkte sind das Screening

von Genbankmaterial und dessen

Nutzung als genetische Ressource für

Resistenzgene gegenüber Blattkrankheiten

bei Roggen und Weidelgras,

Virusresistenz bei Hafer sowie gegenüber

Ähren- und Blattkrankheiten

bei Triticale.

ERARBEITUNG VON

ZÜCHTUNGSMETHODEN

Eine Reihe züchtungsmethodisch

ausgerichteter Arbeiten befaßt sich

mit der Entwicklung molekularer Marker

für die markergestützte Selektion

auf Resistenz- und Qualitätsmerkmale.

Möglichkeiten zum Einsatz der

Selbstinkompatibilität oder gentechnisch

erzeugter männlicher Sterilität

für die Züchtung bei Raps sind Gegenstand

weiterer Projekte.

Züchtungsmethodisch orientiert

sind auch Arbeiten, die sich mit der

PORTRAIT

Sich aus Mikrosporen entwickelnde Raps-

Embryonen in Flüssigmedium

Entwicklung molekularer Nachweismethoden

zur Identifizierung transgener

Pflanzen im Züchtungsprozeß

oder mit der Isolierung von Genen für

die Befruchtungskontrolle bei Gräsern

befassen. Im Bereich der biotechnologischen

Verfahren wird nach

Möglichkeiten gesucht, die züchterisch

nutzbare genetische Variabilität

bei Solanaceen und Brassicaceen

durch Fusion von Protoplasten (zellwandlose

Zellen) zu verbreitern. In

weiteren Arbeiten werden Methoden

Test auf Braunfäuleresistenz von Kartoffelknollen. Äußere Reihen: anfällige Genotypen

mit gering bzw. stark ausgeprägter Verbräunung; mittlere Reihe: BAZ-Zuchtstamm mit

hoher Resistenz

47

zur gentechnischen Bearbeitung von

Kulturpflanzen optimiert.

ARBEITSGRUPPEN

Drei Arbeitsgruppen widmen sich

den unterschiedlichen methodischen

Aspekten der Forschungsprojekte.

Die einzelnen Projekte werden integriert

– das heißt möglichst unter Beteiligung

jeder Arbeitsgruppe – bearbeitet.

Am Beispiel der Forschungsarbeiten

am Raps soll dies illustriert

werden.

In der AG „Biotechnologie” wird

Raps mit Genkonstrukten unterschiedlicher

Art transformiert, um die Ölqualität

entsprechend den jeweiligen

Zuchtzielen modifizieren zu können.

Die transformierten Gewebe werden

in vitro zu vollständigen Pflanzen regeneriert

und den beteiligten externen

Partnern für züchterische Arbeiten

zur Verfügung gestellt.

Die AG „Molekulare Züchtungsmethoden”

charakterisiert transgene

Rapslinien hinsichtlich der Anzahl

eingefügter Genkopien. Für spezifische

Transgene werden PCR-Assays

entwickelt und optimiert, so daß mit

ihnen Typisierungen mit hohem Probendurchsatz

möglich sind.

Die AG „Züchtung/Basismaterial”

führt mehrjährige Freisetzungsversuche

mit dem Ziel durch, die Merkmalsausprägung

der eingeführten

Gene unter Freilandbedingungen zu

testen. Hierzu werden größere Mengen

an Rapssamen im Feld produziert

und zum einen im eigenen Labor

in ihrer Fettsäurezusammensetzung

charakterisiert. Zum anderen werden

Samenpartien im Pilotmaßstab an Ölmühlen

weitergegeben, welche die

technologischen Parameter des transgenen

Materials im Hinblick auf dessen

industrielle Nutzung als nachwachsender

Rohstoff testen. ■

Priv.-Doz. Dr. Peter Wehling, Bundesanstalt

für Züchtungsforschung an

Kulturpflanzen, Institut für landwirtschaftliche

Kulturen, Rudolf-Schick-

Platz 1, 18190 Groß Lüsewitz

2/1998 FORSCHUNGSREPORT


Biotechnologische

Verfahren

könnten in

Zukunft

die Tierkennzeichnung

durch

Ohrmarken

ergänzen

Bundesanstalt für

Fleischforschung und

Bundesforschungsanstalt für

Viruskrankheiten der Tiere

Immunologische

Ohrmarke für

Rinder

Biomarkierung als Alternative für die

Herkunftssicherung?

Wissenschaftler der Bundesanstalt

für Fleischforschung und der

Bundesforschungsanstalt für Viruskrankheiten

der Tiere arbeiten zusammen

an einem neuen, immunologischen

Verfahren, mit dem sich

die Herkunft von Rindern und Rindfleischprodukten

überprüfen und

zweifelsfrei nachweisen lassen soll.

Hintergrund ist der „Rinderwahnsinn”

BSE. Die Geschehnisse rund

um diese Seuche haben das Vertrauen

der Verbraucher in die Unbedenklichkeit

von Lebensmitteln tierischer

Herkunft, speziell Rindfleisch,

stark beeinträchtigt.

Der Herkunftssicherung und Kennzeichnung

von Nutztieren kommt in

diesem Zusammenhang eine steigende

Bedeutung zu. Seit Anfang

1998 gelten EU-weit einheitliche

Vorschriften für die Kennzeichnung

und Registrierung von Rindern. So

müssen Kälber jetzt mit zwei Ohrmarken

markiert werden, außerdem

gibt es Tierpässe sowie neue Meldeund

Registrierverfahren. Begleitet

FORSCHUNGSREPORT 2/1998

NACHRICHTEN

werden diese Maßnahmen von der

Rindfleischetikettierung.

Ein Problem solcher konventioneller

Dokumentationssysteme könnte –

neben dem vergleichsweise hohen

bürokratischen Aufwand – in einer

fehlenden Fälschungssicherheit liegen

(falsche Bescheinigungen, Daten

etc.). Darüber hinaus kann die

Herkunft von Produkten wie Milch

und Fleisch nicht zweifelsfrei überprüft

werden.

Vor diesem Hintergrund ist die Entwicklung

von anderen Markierungsverfahren

interessant, mit denen

Nutztiere wie auch Lebensmittel auf

natürliche Weise gekennzeichnet

und ihre Herkunft zurückverfolgt werden

können.

Die Wissenschaftler aus Kulmbach

und Tübingen setzen hier auf

eine gezielte Biomarkierung. Das

Verfahren basiert auf der Antikörperreaktion

von Tieren nach Applikation

von definierten Immunogenen

und ist vergleichbar mit den Vorgängen

bei einer aktiven Schutzimpfung.

Würden Kälber mit Immunogenen

behandelt, die eine gute Antikörperbildung

hervorrufen und denen

die Tiere natürlicherweise nie

ausgesetzt sind, dann wäre über einen

einfachen Nachweis der Antikörper

im Blut jederzeit ein Rückschluß

auf das verwendete Immunogen

möglich.

Auf dieser Basis wäre eine immunologische

Kennzeichnung von Tieren

in Erzeugerringen, Qualitätsprogrammen,

einzelnen Bundesländern

oder Staaten denkbar, wobei als

Biomarker bestimmte Peptid-Immunogene

einzeln oder in Kombination

in Frage kommen. Da sich Anti-Peptid-Antikörper

auch in Milch und

Tropfsaft von Fleisch nachweisen lassen,

wäre auf diese Weise nicht nur

eine Kennzeichnung der Tiere

selbst, sondern auch der von ihnen

stammenden Lebensmittel möglich.

Das neu entwickelte Verfahren ist

den Wissenschaftlern mittlerweile

patentiert worden.

(M. Gareis, BAFF und M. Groschup,

BFAV)

48

Bundesforschungsanstalt für

Landwirtschaft (FAL)

Molekularbiologe

der FAL erhielt zwei

Förderpreise

Neue Methode zur Diagnostik von Salmonellen

entwickelt

Dr. Stefan Schwarz vom FAL-Institut

für Tierzucht und Tierverhalten ist

im vergangenen Jahr für seine Forschung

auf dem Gebiet der Tiergesundheit

gleich doppelt ausgezeichnet

worden. Für seine Arbeiten zur

molekularen Typisierung von Salmonellen

sowie zur Struktur, Regulation

und Übertragbarkeit von Resistenzen

bei Bakterien wurde ihm der

Förderpreis der Akademie für Tiergesundheit

verliehen. Zusätzlich hat

ihn die Deutsche Veterinärmedizinische

Gesellschaft mit dem Preis zur

Förderung von Nachwuchswissenschaftlern

geehrt. Sie würdigte damit

seine Untersuchungen über Mechanismen

der Rekombination von

Resistenzplasmiden sowie seine Arbeiten

auf dem Gebiet der molekularen

Epidemiologie. Der habilitierte

Tierarzt ist seit Oktober 1992 am Institutsstandort

Celle tätig, wo er den

Forschungsbereich ‘Molekulare Diagnostik’

aufgebaut und inzwischen

zu internationaler Anerkennung geführt

hat. (FAL)

Zentralstelle für

Agrardokumentation und

-information

Neuer

Informationsservice

der ZADI eröffnet

Mit FIZ-AGRAR auf online-Recherche

Ab sofort bietet die ZADI mit der

Einstiegsseite FIZ-AGRAR (Fachinformationszentrum

Ernährung, Landund

Forstwirtschaft) das gesamte

Spektrum der Agrardatenbanken,

die auf ihrem Datenbankserver lie-


Das

neue

Gewächshaus

in

Großbeeren

gen, zur online-Recherche an. Unter

http://www.fiz-agrar.de ist der Service

zu erreichen.

Die Menüstruktur von FIZ-AGRAR

unterscheidet die Datenbanken einerseits

nach Fachgebieten wie

Pflanzenproduktion, Tierproduktion,

Ökonomie, andererseits nach Inhaltstypen

wie Literatur, Fakten und Projekten.

Zur Zeit werden 147 Datenbanken

auf dem Server der ZADI

betrieben. Zu jeder Datenbank liegt

auf FIZ-AGRAR eine Kurzbeschreibung

der Inhalte mit Angaben zu

Umfang, Datenproduzent, Update-

Intervall und Zugangsbedingungen

vor. Mit FIZ-AGRAR verfügt der

Agrarbereich der Bundesrepublik

über eine strukturierte Sammlung

wissenschaftlich fundierter Datenbanken

mit einfach zu bedienenden

Benutzeroberflächen. (ZADI)

Institut für Gemüse- und

Zierpflanzenbau e.V.

Kabinengewächshaus

eingeweiht

Am 3. Juli 1998 wurde im Institut

für Gemüse- und Zierpflanzenbau

e.V. (IGZ) am Standort Großbeeren

bei Berlin eine neue Klimagewächshausanlage

in Betrieb genommen.

Das Gewächshaus ist mit 16 Klimakammern

à 64 m 2 ausgestattet. Die

Wissenschaftler planen unter anderem,

dort die Reaktionen von Pflanzen

auf verschiedene Bedingungen

in der Umgebung des Sprosses, teilweise

in Kombination mit den Bedingungen

in der Wurzelumgebung,

zu untersuchen. Dazu sind so-

NACHRICHTEN

wohl die mikroklimatischen Bedingungen

als auch die Wasser- und

Nährstoffversorgung in den Kabinen

unabhängig untereinander regelbar.

Das IGZ hat die Aufgabe, wissenschaftliche

Grundlagen für die

Produktion von Gemüse und Zierpflanzen

im Spannungsfeld zwischen

Ertrag, Umwelt und Qualität

zu schaffen. Die Kabinengewächshausanlage

bietet den Forschern

dazu viele neue Möglichkeiten nach

neuestem Stand der Technik. (BML)

Bundesministerium für

Ernährung, Landwirtschaft und

Forsten

Förderungsgrundsätze

jetzt im

Internet

Gemeinschaftsaufgabe „Verbesserung

der Agrarstruktur und des

Küstenschutzes”

Die aktuellen Förderungsgrundsätze

des Rahmenplans der Gemeinschaftsaufgabe

„Verbesserung der

Agrarstruktur und des Küstenschutzes”

(GAK) sind mit weiteren Informationen

zur GAK in das Deutsche

Agrarinformationsnetz (DAINet)

eingespeist worden. Die Internet-

Adresse lautet: http://www.

dainet.de/bml/gak. Bei der Gemeinschaftsaufgabe

„Verbesserung

der Agrarstruktur und des Küstenschutzes”

handelt es sich um das

wichtigste Instrument der nationalen

Förderung der Agrarstruktur. Die

GAK umfaßt eine Anzahl von Förderungsrichtlinien,

die jährlich vom

Bund und den Ländern gemeinsam in

49

einem Rahmenplan verabschiedet

werden. Gefördert werden unter anderem

benachteiligte Gebiete, extensive

Produktionsmaßnahmen, die

Dorferneuerung sowie Flurbereinigung

und Flurneuordnung.

Die Durchführung der Förderungsmaßnahmen

ist Aufgabe der Länder.

Finanziert werden die Maßnahmen

zu 60 % vom Bund und zu 40 % von

den Ländern; beim Küstenschutz ist

der Bund zu 70 % beteiligt. 1973,

also vor genau 25 Jahren, wurde der

erste Rahmenplan umgesetzt. (BML)

Bundesforschungsanstalt für

Fischerei

Deutsches

Forschungsschiff

auf der

EXPO 98

Eine Forschungsexpedition

in das Gebiet

der Iberischen Tiefsee

hat die Bundesforschungsanstalt

für Fischerei

(BFAFi) in der

Zeit vom 14.08.-

24.09.1998 durchgeführt.

Am Ende dieser Reise lief das

Fischereiforschungsschiff „Walther

Herwig III” Lissabon an, wo es die

deutsche Fischereiforschung als Beitrag

auf der EXPO 98 vorstellte. Die

Präsentation war ein großer Erfolg. In

drei Tagen konnten mehr als 13.000

Besucher das Forschungsschiff besichtigen.

Die Schiffsbrücke, der Maschinenraum,

die Laboratorien, das Forschungsgerät

und eine Posterausstellung

begeisterten das multinationale

Publikum.

Daneben gab es einen kleinen

Empfang, zu dem portugiesische

Meeresforscher, Vertreter der Deutschen

Botschaft und Wissenschaftler

des Marine Habitat Committee des Internationalen

Rates für Meeresforschung

(ICES), der zur gleichen Zeit in

Cascais nahe Lissabon tagte, geladen

waren. (H.-S. Jenke, BFAFi)

2/1998 FORSCHUNGSREPORT

Mehrere

Tausend

Besucher

informierten

sich an Bord der

„Walther

Herwig III”

in Lissabon über

die deutsche

Fischereiforschung


Der Amerikaner

Clive James

informierte in

seinem

Eröffnungsvortrag

über

globale

Aspekte der

Vermarktung

transgener

Kulturpflanzen

(Foto: G. Freyer)

Biologische Bundesanstalt für

Land- und Forstwirtschaft

Biologische

Sicherheit bei

transgenen

Organismen

Internationales Symposium in Braunschweig

„The Biosafety Results of Field

Tests of Genetically Modified Plants

and Microorganisms”: Unter diesem

Titel haben sich

zum fünften Mal

Wissenschaftler

aus zahlreichen

Nationen zu einemErfahrungsaustausch

über

die Sicherheit

bei gentechnischveränderten

Pflanzen und

Mikroorganismenzusammengefunden.

Das

Symposium, das

vom 6.-10. September

1998 in

Braunschweig

stattfand, war

von der Biologischen Bundesanstalt

für Land- und Forstwirtschaft (BBA)

unter Beteiligung des United States

Department of Agriculture (USDA)

und der Europäischen Kommission

organisiert worden.

Vor dem Hintergrund

der rasanten Entwicklung

der Gentechnik –

1998 wurden weltweit

auf rund 28 Mio. ha

gentechnisch veränderte

Pflanzen angebaut –

bot das Symposium

den etwa 250 Experten

ein Forum zur Diskussion

von Fragen der

biologischen Sicherheitsforschung,

der Sicherheitsbewertung

und der Standortbe-

FORSCHUNGSREPORT 2/1998

TAGUNGEN

stimmung. Auf der Tagung wurde

deutlich gemacht, daß sich das Risikopotential

für Mensch, Tier und Umwelt

aufgrund der bisherigen Erfahrungen

als wesentlich geringer herausgestellt

hat als anfänglich angenommen.

Die umfangreichen Freilandstudien

mit gentechnisch veränderten

Pflanzen und Mikroorganismen

und der weltweite kommerzielle

Anbau transgener Pflanzen haben

bisher zu keinen negativen Auswirkungen

geführt. Es wurde bestätigt,

daß die Anwendung der Gentechnik

in der Landwirtschaft keine neuen

Risiken gegenüber anderen Techniken

birgt, die in der modernen Lebensmittelproduktion

und -verarbeitung

eingesetzt werden.

Eine Bewertung der transgenen

Pflanzen sollte aus wissenschaftlicher

Sicht produktspezifisch in einer

Fall-für-Fall Betrachtung erfolgen. Bedingt

durch die schnelle Entwicklung

und Nutzung neuer Eigenschaften

(z. B. Salzresistenz, Trockentoleranz,

Herstellung von Pharmaka in

Pflanzen) muß auch die Sicherheitsbewertung

ständig erweitert werden.

Daher sind entsprechende Forschungsarbeiten

und der Informations-

und Erfahrungsaustausch außerordentlich

wichtig. Es wurde beschlossen,

sich weiterhin in regelmäßigen

Abständen zu treffen: Das

6. Symposium soll im Jahr 2000 in

Kanada, das 7. Symposium 2002

in China stattfinden. (BML, BBA)

Transgene Kulturpflanzen 1996 – 98

30

25

20

15

10

5

0

Millionen Hektar

1,7

11

50

27,8

1996 1997 1998

Anbaufläche von transgenen Kulturpflanzen weltweit

(ohne China) in Mio. ha (Quelle: Clive James, ISAAA).

Zum Vergleich:

Gesamte Ackerbaufläche Deutschlands: 12 Mio. ha

Bundesanstalt für

Fleischforschung

Gentechnik und

Ernährung

BAFF bot ein Forum für die Diskussion

von Zweifeln und Erwartungen

„Novel Food – Gentechnik –

Ernährung” war der Titel einer Podiumsdiskussion,

mit der die Bundesanstalt

für Fleischforschung ihre diesjährige

„Kulmbacher Woche” – eine

Veranstaltung rund um das Lebensmittel

Fleisch – begann. Acht Vertreter

aus Wissenschaft, Rechtsbereich,

Verwaltung und Politik legten hier

ihre Ansichten dar. Gleichsam als

Motto stand dem Streitgespräch der

Satz voran, mit dem Professor Hans

Steinhart von der Universität Hamburg

die Situation kennzeichnete:

Mögen viele für oder gegen die Gentechnik

sein, aufzuhalten ist sie nicht.

Vor diesem Hintergrund war geradezu

zwangsläufig der Begriff „gentechnikfrei”

auf dem Tisch. Eine solche

Deklaration läßt die EU für Lebensmittel

zu, die kein neuartiges Erzeugnis

im Sinne der Novel Food

Verordnung sind. Die Wissenschaftler

waren sich allerdings einig, daß

sich das Nichtvorhandensein einer

Eigenschaft der wissenschaftlichen

Untersuchung entzieht. Die Deklaration

„gentechnikfrei” kann daher nur

als politischer Ansatz begründet werden.

Dieses Problem hat seine Ursachen

unter anderem in den Nachweismethoden.

Diese können nur

greifen, wenn bekannt ist, wonach

gesucht werden soll. Das sei aber

gerade nur bei Lebensmitteln mit gentechnischen

Veränderungen gegeben,

erklärte Professor Knuth Heller

von der Bundesanstalt für Milchforschung

in Kiel. Solche Veränderungen

erfolgen immer in eng definierten

Bereichen der Erbmasse und

drücken sich folgerichtig auch nur in

einem engen Spektrum von Merkmalen

aus. Sie können daher relativ

leicht analytisch nachgewiesen und

kontrolliert werden. Dr. Ralf Greiner


von der Bundesforschungsanstalt für

Ernährung in Karlsruhe relativierte

diese Sicherheit jedoch im Hinblick

darauf, daß in hochverarbeiteten

Produkten ein Nachweis selbst bei

Kenntnis der Veränderung häufig

nicht mehr möglich sei. Aus dieser

Sicht werde beispielsweise die Aussage

des „gentechnikfreien Tomatenmarks”

schwer nachzuprüfen sein.

Die Ausführungen verdeutlichten,

daß sich zwar eine Übertretung der

Deklaration „gentechnikfrei” unter

günstigen Bedingungen nachweisen

ließe, nicht aber ihre Einhaltung. In

einem Punkt wird es aber doch

größere Sicherheit geben: Gentechnisch

veränderte Produkte bedürfen

einer Zulassung. In diesem Rahmen

werden sie auf Herz und Nieren mit

modernen Analysemethoden geprüft.

Dabei geht es vor allem auch um

das, was die Verbraucher besonders

bewegt: um Allergien. Nach einhelliger

Aussage der Wissenschaftler

sind gerade gentechnisch veränderte

Lebensmittel in positivem Sinne „Novel

Food”, also neuartig. Denn erst

diese Lebensmittel werden konsequent

auf ihre allergieauslösende

Wirkung geprüft. Sie sind damit in

dieser Hinsicht sicherer als manches,

was sonst auf den Tisch kommt. Trotzdem

wurde von Dr. Wilbert Himmighofen

vom Bundesernährungsministerium

(BML) bekräftigt, daß keine

Technologie – auch nicht die Gentechnik

– ohne Risiken sei. Nicht alles

zu machen, was machbar ist, ethische

Grenzen einzuhalten und eben

Risiken zu erkennen und zu kontrollieren,

das mache diese für die Welternährung

künftig so wichtige Wissenschaft

auch sozial verträglich.

Allerdings sehen die Kulmbacher

Fleischforscher für das von ihnen betreute

Lebensmittel die Situation ohnedies

nicht so aufgeregt. „Was wir

an Qualitätsmerkmalen von Fleisch

auch auf lange Sicht erwarten können”,

so schloß der Leiter der BAFF,

Professor Klaus Troeger, die Diskussion,

„das erreichen wir wie bisher mit

ganz normaler Tierzucht und Tierhaltung”.

(BAFF)

TAGUNGEN

Biologische Bundesanstalt für

Land- und Forstwirtschaft

Pflanzenschutz im

Ökolandbau

Wissenschaftler diskutierten mit Verbandsvertretern

und Praktikern

Am 18. Juni 1998 führte die Biologische

Bundesanstalt für Land- und

Forstwirtschaft (BBA) ein Fachgespräch

zu dem Themenkreis „Pflanzenschutz

im ökologischen Landbau

– Probleme und Lösungsansätze” in

Kleinmachnow durch. Im ersten Teil

der Veranstaltung wurden vor dem

Hintergrund der ab 1. Juli 1998 geltenden

neuen Regelungen im Pflanzenschutzgesetz

der Stand und die

Probleme der Registrierung und Anwendung

von Pflanzenstärkungsmitteln

im ökologischen Landbau diskutiert.

Im zweiten Teil wurde die Behandlung

von Getreidesaatgut mit

niederenergetischen Elektronen als

Möglichkeit der Beseitigung von

Schadorganismen, die am Saatgut

anhaften, erörtert. Dabei zeigte

sich, daß weiterer Forschungsbedarf

vorhanden ist, insbesondere zur

Klärung mittel- und langfristiger Auswirkungen

dieser Behandlung auf

die Saatgutqualität. (BML)

Senatsarbeitsgruppe

„Qualitätsgerechte und

umweltverträgliche

Agrarproduktion”

Workshop über

„Nachhaltige

Landwirtschaft”

Vom 20.–22. April 1999 lädt

die Arbeitsgruppe „Qualitätsgerechte

und umweltverträgliche Agrarproduktion”

des Senats der Bundesforschungsanstalten

zu einem Workshop

über nachhaltige Landwirtschaft

nach Braunschweig ein.

Tagungsort wird das Forum der FAL

in Braunschweig-Völkenrode sein.

51

Auf dem Workshop sollen der Stand

der Forschung zur Nachhaltigkeit in

der Landwirtschaft aufgezeigt sowie

neue Methoden und Trends vorgestellt

werden. Dabei wird der Bogen

gespannt von integrierten Verfahren

der Tier- und Pflanzenproduktion

über Ressourcenschonung und Stoffkreisläufe

bis hin zu sozioökonomischen

Aspekten. Ein großzügiger

Zeitrahmen soll genügend Platz für

Diskussionen lassen. Ziel ist es, sich

durch die Erarbeitung von Bewertungskriterien

dem unscharfen, aber

vielgebrauchten Begriff „Nachhaltigkeit”

zu nähern. Darüber hinaus

soll der Workshop als Informationsdrehscheibe

und Projektbörse dienen

und damit zur Zusammenarbeit

anregen. (Senat)

Institut für Agrartechnik

Bornim e. V.

Computer-

Bildanalyse in der

Landwirtschaft

Zum fünften Mal in Folge findet

am Institut für Agrartechnik Bornim

e. V. (ATB) ein Workshop zur Anwendung

der Computer-Bildanalyse

in der Landwirtschaft statt. Die zusammen

mit der Senatsarbeitsgruppe

„Qualitätsgerechte und umweltverträgliche

Agrarproduktion”

organisierte Arbeitstagung ist für

den 04. Mai 1999 in Potsdam

geplant. Ziel des Workshops, der

sich vorwiegend an Wissenschaftler

und Ingenieure aus Forschungseinrichtungen

richtet, ist der Austausch

von Informationen und Erfahrungen

zu spezifischen Anwendungen der

Computer-Bildanalyse. Schwerpunkte

sind die Erkennung von Pflanzen

und Pflanzenbeständen, die Klassifikation

biologischer Objekte und die

Auswertung von Bildinformationen.

Interessenten können sich an

Dr. Bernd Herold vom ATB in Potsdam-Bornim

wenden (e-mail:

bherold@atb-potsdam.de) . (ATB)

2/1998 FORSCHUNGSREPORT


Senat der Bundesforschungsanstalten im Geschäftsbereich

des Bundesministeriums für Ernährung, Landwirtschaft und Forsten