Vowel Patterns - Sound City Reading

Vowel PatternsRhyming ListsMixed ListsSentences

ie/shield....................................................................................................... 130i_e/pine ....................................................................................................... 135igh/night ..................................................................................................... 142ild/child ....................................................................................................... 144ind/find ....................................................................................................... 145ir/bird .......................................................................................................... 146o/ox ........................................................................................................... 151o/ocean ........................................................................................................ 156o/to ........................................................................................................... 159o/son ........................................................................................................... 150oa/boat ........................................................................................................ 161oe/toe ........................................................................................................... 166o_e/home .................................................................................................... 167o_e/love ....................................................................................................... 174oi/oil ........................................................................................................... 175old/gold ...................................................................................................... 180olk/yolk ....................................................................................................... 182oll/troll ........................................................................................................ 183olt/bolt ......................................................................................................... 185oo/book ....................................................................................................... 186oo/moon ...................................................................................................... 190oor/door ...................................................................................................... 196or/horse ....................................................................................................... 198or/mirror, or/sorry ................................................................................... 203other/mother .............................................................................................. 205ou/ouch ....................................................................................................... 206ou/soup ....................................................................................................... 211ou/country .................................................................................................. 214ou/shoulder ................................................................................................ 216ought/bought ............................................................................................. 219ould/should ................................................................................................ 220our/pour, our/journal .............................................................................. 221ow/cow ....................................................................................................... 225ow/snow ..................................................................................................... 230oy/boy ......................................................................................................... 233qua_/quarrel ............................................................................................... 234squa_/squash .............................................................................................. 235swa_/swan .................................................................................................. 238u/up ........................................................................................................... 239u/uniform, u/tulip .................................................................................... 245u/push ......................................................................................................... 246ue/glue, ue/cue ......................................................................................... 251u_e/flute, u_e/cube ................................................................................... 254

ui/fruit ......................................................................................................... 260ur/purse ...................................................................................................... 262wa_/wasp.................................................................................................... 267wor/worm ................................................................................................... 269y/my ........................................................................................................... 271y/candy ....................................................................................................... 274y/gymnastics .............................................................................................. 279ye/rye .......................................................................................................... 281y_e/type ...................................................................................................... 282

Word Study Activities1. Have students fold a piece of blank paper into sixths or eighths. Display wordsfor the students to copy. They should write one word in each box on the paperand illustrate it. Advanced students can write sentences in each box.2. Make a file folder game for students to use individually or in pairs. Use brightlycolored file folders. Choose words from the list for a phonogram pattern recentlytaught. Glue small pictures illustrating the words in the folder. (These can becopied from the letter pattern worksheets from Sound City Reading.) Purchase asmall specialty notepad. These can be purchased in school supply stores withvarious designs, such as boats, animals, barns, flowers, and so on. Write oneword on each figure. Glue the figures to poster board and cut them out. Laminateboth the folder and the figures. The student will read each word and place iton the correct picture in the file folder. It is helpful to make a file folder gamefor each phonogram that is studied. A student can use the folder independently,with a partner, or with the teacher.3. Post some of the words and have the students write each word in a sentence.4. Let the students choose a single word to use as a theme, and write a story or essayrelated to the word. Share the stories.5. Post a list of words and have the students write a story containing as many of thewords as possible. Share the stories.6. Post a list of words and have the students draw a picture showing as many of thewords as possible. For example a beach scene could show: a shell, a shark,shade under an umbrella, etc.) The student should use the posted words to labelthe items in the picture.7. Make a set of sorting cards. Choose the desired vowel pattern, and write eachword on a separate card. Have the students sort the cards, using classificationssuch as rhyming words, parts of speech, or various other categories.8. Use the letter pattern worksheets from Sound City Reading. The worksheets giveextra practice with many of the most common consonant and vowel patterns.Students match words and pictures, and copy words under the correct pictures.9. Use the phonogram patterns to create weekly spelling lists.10. Use a computer program to create crossword puzzles and word search puzzles forthe words on a phonogram list. Have the students do the puzzles. Or have studentscreate their own puzzles.11. Write words from a phonogram list on separate slips of paper. Have each childselect a slip and pantomime the word. The rest of the class guesses the word.12. Have students take turns spelling words from a phonogram list by positioningtheir bodies to form the shape of each letter in sequence.13. Select words from a list. Write each word on a separate unlined index card usingcolored markers. Write the vowel pattern being studied in a bright color, and theremaining letters in black. Have students take turns reading the cards. Studentsmay hold any cards that they read correctly.

Sentence Study Activities1) Copy the sentence pages onto transparencies to use with an overhead projectorfor working with an entire class. Uncover one sentence at a time for the class toread in unison.2) Write the sentences on class size chart pads for use with a large group. Use apointer to help students track the words.3) Type the pages in large print on horizontal sheets of legal size paper, puttingtwo or three sentences on a page. Punch holes in the top and make into a flipbook to use with a group. Use pastel colored paper to prevent the sheets underneathfrom showing through.4) Make enough copies of the sentences on a copy machine for each student tohave a personal copy. Have students take turns reading the sentences aloud,then have the class read the sentences in unison. This can also be done insmaller reading groups.5) Have students take turns reading the sentences to each other in pairs.6) Have students pick a favorite sentence to illustrate. They should write the sentenceat the bottom of a blank sheet of paper and draw a picture to go with it.Display these in the classroom or staple together to make a class booklet.7) Have students choose a sentence to use for creative writing. The student willcreate a story or essay that contains the sentence. Have the student illustrate thestory and read it out loud to the class.8) Make a learning center using the sentences. Write or type the sentences oncards or strips. Draw simple pictures to illustrate the sentences on separate indexcards. Have the students match each sentence with a picture.9) Write a set of sentences on sentence strips. Put each sentence on a differentcolor strip. Cut apart the strips, so that each word is on a separate piece. Arrangethe words in a pocket chart, out of order. Have students arrange one sentenceat a time so that it reads correctly.10) Create a reading worksheet. Type each sentence, leaving blanks for the wordscontaining the new sound pattern. List the missing words in a chart at the top ofthe page. Make a copy for each student. The student should read the sentencesand fill in each blank with the correct word. This can be quite challenging forstudents!

Basic Listaantam hat badat cap batsad fat mapcan man hadsat dad catnap Pat ranand fast dratsand past grasslandflagantswamask can’t plantstandraftcamp© 2009 by Kathryn J. Davis 11Vowel Patterns

aant_an_at_am_ap_ag_ab_ad_ax_as_al _ass _aff _ack© 2009 by Kathryn J. Davis 12Vowel Patterns

fan plan cat scatcan Stan bat spattan bran fat flatran Fran hat slatban scan mat bratJan span pat splatman clan rat dratNanpanvansattatvatDan© 2009 by Kathryn J. Davis 13Vowel Patterns

ham slam cap snapdam clam map slapjam gram nap clapPam swam lap flapSam scam tap trapram cram sap straptam dram gap scrapyam tram yapcamlamzaprap© 2009 by Kathryn J. Davis 14Vowel Patterns

ag stag tab crabrag snag nab stabtag flag gab scabwag brag dab slabsag drag jab blabgag crag lab flabhag swag cab grablag slag drabnagzag staff gas palgaff * as galjazzadd* has Al© 2009 by Kathryn J. Davis 15Vowel Patterns

dad grass back waxbad lass sack taxmad bass Jack faxsad mass lack laxhad sass pack flaxpad class rackfad pass tacklad glass trackglad brass crackclad crass slackBradsnackstack© 2009 by Kathryn J. Davis 16Vowel Patterns

āapronra ven ravenha ven haventa ken takena men amenba gel bagella tex latexba sic basicba sis basisba sin basinDa vid Davidha zel hazelna vel navella bel label© 2009 by Kathryn J. Davis 17Vowel Patterns

afatherfatherha hamamablahpapapajamasgrandpalavagrandmadramallamapecanspa© 2009 by Kathryn J. Davis 18Vowel Patterns

afatherMy father likes to cook.Papa sang a funny song. Ha ha ha !Blah ! I feel tired today.We like to go for a walk with grandpa.A mama cat keeps her kittens clean.Grandma will make some soup for us.We will have pecan pie for dessert.I will wear my red pajamas tonight.The lava was glowing as it went down thehill.© 2009 by Kathryn J. Davis 19Vowel Patterns

a_acrossaway agree awakearound alive acrossasleep allow assistalong amaze agoamong alike amountalone above aboutahead afraid anotherapart again against© 2009 by Kathryn J. Davis 20Vowel Patterns

a_acrossSam's dog ran away.We will run around the track.It is good to be alive.Brave men went into battle long ago.Do you agree with me ?She will not allow us to fight.This story will amaze you.Did you stay awake all night ?Jack will tell us about his trip.We can walk along the path by the river.Will you assist me with this work ?What time did you fall asleep last night ?© 2009 by Kathryn J. Davis 21Vowel Patterns

_asofacomma tuba okraextra Cuba togatundra scuba cobrapanda pupa quotaSanta puma boavilla area Americayucca idea Africazebra sofa Antarcticadata cola AsiaChina coma Russiatuna soda inertia© 2009 by Kathryn J. Davis 22Vowel Patterns

_asofaI have some extra books for you to read.My family will visit China this summer.A cobra is a dangerous snake.Zebras live in Africa.Pandas live in China.Don’t put your feet on the sofa.Mom fixed tuna fish sandwiches for lunch.Brad plays the tuba in the band.© 2009 by Kathryn J. Davis 23Vowel Patterns

ā_esafe_abe_ade_afe_ave_ake_ale_ame_ane_ape_are_ase_ate© 2009 by Kathryn J. Davis 24Vowel Patterns

ā_esafe_ane _ale _ameJane male sameDane pale camelane sale tamesane tale famepane bale gamebane kale lamemane hale namevane gale blameplane scale framecrane stale flameShane whale shame© 2009 by Kathryn J. Davis 25Vowel Patterns

ā_esafe_ade _ate _atefade ate platemade date gratejade fate slatewade gate spatebade hate skatespade late stateblade sate crategladematetrade Nate _abegrade pate Abeshade rate babe© 2009 by Kathryn J. Davis 27Vowel Patterns

ā_esafe_ave _are _arecave care sparesave dare scarerave bare sharegave hare snarepave mare flareDave rare blarewave ware glareslave pare comparebrave fare prepareshave stare beware* have * are softwaree© 2009 by Kathryn J. Davis 28Vowel Patterns

ā_esafe_aze _ase haze base becamedaze case basementfaze vase inhalegazeexhaleraze _afe createblaze safe interstategrazesafetyglaze© 2009 by Kathryn J. Davis 29Vowel Patterns

ā_esafesafe state became haresame brave inhale carelake plate exhale dareJane trade create staresale snake mistake sparetape skate escape scaremade blaze donate snaregate grape behave squarecave flame debate_arevase bathe bewarehaze paste preparesquare© 2009 by Kathryn J. Davis 30Vowel Patterns

ā_esafeI will take the vase to Jane.Fred ate a lot of cake.A snake is in the grass.Dad made a red kite.Kay set the grapes on the plate.Kent likes to swim in the lake.Bob has a date, but he is late.The fox ran into the cave.Mr. Smith went on a plane to visit his son.© 2009 by Kathryn J. Davis 31Vowel Patterns

āirain_aid_ail_ain_air_aise_aist_aint_ait_aith© 2009 by Kathryn J. Davis 32Vowel Patterns

āirain_ain _ain _aidrain stain aidpain plain laidlain grain maidmain brain paidvain grain raidgain drain braidi* again chain staidi* villain strain afraidi* chaplain sprain * saidi* bargain Spaintraine© 2009 by Kathryn J. Davis 33Vowel Patterns

āirain_ail _ail _airtail snail fairsail frail hairnail flail lairmail quail pairfailchairwail _aint flairtail faint stairsjailpaintpail saint _aimhail taint aimbailclaim© 2009 by Kathryn J. Davis 34Vowel Patterns

āirain_ait wait Maine rainbowbait faith abstaingait waist acclaimtrait Maize airmailplait waive containawait daisy curtailfairydespair_aise dairy disdainraise maiden exclaimpraise daily explainbraise rainy mermaid© 2009 by Kathryn J. Davis 35Vowel Patterns

āirainrain braid rainbow hairtail train airmail fairwait snail explain pairmaid stain mermaid lairfail paint daisy airmain waist afraid flairsail faith contain chairpaid praise remain stairsnail raise * againbait quail * villain* said chain * bargainairhair© 2009 by Kathryn J. Davis 36Vowel Patterns

āirainWill it rain?Yes, it will rain.Can a dog wag his tail?Yes, a dog can wag his tail.Did Dad paint the kitchen?Yes, Dad did paint the kitchen.Can a snail go fast?No, a snail can not go fast.Will we wait on the bus?Yes, we will wait on the bus.Will Tom go on the train?No, Tom will not go on the train.© 2009 by Kathryn J. Davis 37Vowel Patterns

älsaltsalt bald alwaysmalt scald almosthalt palm Walteralter calm Waldohalter almond walnutDon’t put too much salt on your food.In an emergency, always try to stay calm.Do you prefer walnuts or almonds?Waldo put the halter on the horse and led itout of the barn.That water is scalding hot.© 2009 by Kathryn J. Davis 38Vowel Patterns

älktalktalk walk stalkbalk calk chalkWe will walk around the lake.I will talk to you after class.The flower stalk is bent.A tiger stalks its prey at night.Brad will walk the dogs.I feel happy when we talk.Dad will calk the bathtub.A donkey will balk if it is afraid.Today we will draw with chalk.© 2009 by Kathryn J. Davis 39Vowel Patterns

ällball_allballcallfalltall_allsmallstallsquallinstallhallgall* shallmallpallwall© 2009 by Kathryn J. Davis 40Vowel Patterns

ällballall call walltall hall fallball mall smallstall* shallA ball is round.Tom will call Pam.Jan will stop at the mall.A mouse is small. But a T. Rex was tall.Bill will sit up on the wall.But Bill will not fall off.The horse is in the stall.© 2009 by Kathryn J. Davis 41Vowel Patterns

arbarn_ar_ard_arf_ark_arl_arm_arb_arp_art© 2009 by Kathryn J. Davis 42Vowel Patterns

arbarn_ar _ark _artcar ark artfar bark parttar mark cartbar dark dartjar lark tartmar hark Bartgar park startpar spark smartstar stark quartscarsparClarkMark© 2009 by Kathryn J. Davis 43Vowel Patterns

arbarn_ard _arn _arfcard barn scarfhard yarn dwarfyard darn _arllard warn Carlsnarl_arm _arparm harp farm carp targetharm tarp gardenwarm warp Marvinswarm* dollar© 2009 by Kathryn J. Davis 44Vowel Patterns

arbarncar farm barkfar part warmtar Mark scarfbar yarn smartjar card sparkstar harm startscar cart yardarm park targetart hard gardenbarn dark * are© 2009 by Kathryn J. Davis 45Vowel Patterns

arbarnTom has a big red barn at his farm.A black horse is in the barn.Our dog is in the yard.He barks at all the cats.Mark fell off a wall and broke his arm.Rick will park his car in the street.Jill has fun in art class.Mom will get red yarn at the mall.Pam will get a warm red scarf.The puppet contest will start at six.Dad will plant seeds in the garden.© 2009 by Kathryn J. Davis 46Vowel Patterns

ardollararcarrotdollar polar carrotcollar solar parrotbeggar molar parentnectar lunar barrelgrammar mortar carolpoplar cougar tariffpillar tartar parish* sugar popular Mary© 2009 by Kathryn J. Davis 47Vowel Patterns

äuPaul_aul_ause_aut_aunt_ault_aught_aunch_auce_auze© 2009 by Kathryn J. Davis 48Vowel Patterns

äuPaul_aul _aunt _aughtPaul aunt caughthaul haunt taughtmaul taunt naughtjauntfraught_aultdauntfault gaunt _aunchvault vaunt launchflauntpaunch_aucesaucehaunchstaunch© 2009 by Kathryn J. Davis 49Vowel Patterns

äuPaul_ause pause saucer automobilecause faucet Australiabecause laundry paupernaughtyexhaust_aud Laura audiencelaud autumn autographfraud August automaticauthorgauzemauveauthenticauburnsaunter© 2009 by Kathryn J. Davis 50Vowel Patterns

äuPaulPaul pause Augusthaul cause autumnaunt because authorhaunt sauce Audreylaunch saucer automobilefault faucet AustraliaLaura laundry applaud© 2009 by Kathryn J. Davis 51Vowel Patterns

äuPaulPaul will haul the rocks in his truck.Paul will haul the junk in his truck.Paul will haul a pig in his truck.Paul will haul a cow in his truck.Paul will haul the chickens in his truck.Paul will haul some topsoil in his truck.Paul will haul some corn in his truck.Paul will haul some wood in his truck.Dad will fix the water faucet.Audrey will wash her laundry today.Do you like taco sauce ?© 2009 by Kathryn J. Davis 52Vowel Patterns

äuPaulWho is the author of this book ?Mom will buy a cup and saucer.They will launch the rocket this morning.It is my fault that we lost the game.I am happy because it is spring.Kangaroos live in Australia.We need to repaint this automobile.Leaves fall off of the trees in autumn.The weather is very hot in August.© 2009 by Kathryn J. Davis 53Vowel Patterns

äwsaw_aw_awk_awl_awn© 2009 by Kathryn J. Davis 54Vowel Patterns

äwsaw_aw _aw _awnsaw claw lawnlaw draw dawnpaw slaw pawnraw thaw yawncaw straw drawnjaw flaw prawnyaw© 2009 by Kathryn J. Davis 55Vowel Patterns

äwsaw_awl _awk bawl hawk lawyercrawl gawk macawbrawl squawk Pawneedrawlsprawltrawltawnydrawertrawlerscrawlshawl© 2009 by Kathryn J. Davis 56Vowel Patterns

äwsawsaw draw hawkpaw claw shawljaw slaw fawnlaw straw lawnraw thaw crawllawyer awning squawkawful awesome sprawl© 2009 by Kathryn J. Davis 57Vowel Patterns

äwsawI saw a dog in a truck.I saw a pig in the shed.I saw a cat with claws.The dog saw me.The pig saw me.The cat saw me.I saw a fish in the pond. The fish saw me.I saw a fawn with spots. The fawn saw me.I saw a horse in the grass. The horse sawme.I saw a sheep on the lawn.me.The sheep sawI can draw a dog and a cat.He can draw a jeep and a truck.© 2009 by Kathryn J. Davis 58Vowel Patterns

āyplay_ay _ay _aybay ray brayday say trayFay way praygay x-ray frayhay play grayJay clay strayKay slay spraylaymayflaysplaynaypay© 2009 by Kathryn J. Davis 59Vowel Patterns

āyplayday play Sundayway pray Mondaylay stay Tuesdaymay clay Wednesdaysay fray Thursdayhay gray Fridayray slay Saturdaypay sway crayonbay stray mayorKay spray awayJay * says today© 2009 by Kathryn J. Davis 60Vowel Patterns

āyplayJay will go to the fair on Friday.Will this hen lay an egg?Kay will set the cups on the tray."I will spray the plants," said Tom.The gray cat ran away.Wayne will visit us on Sunday.I will play with Jack today.We will go this way.Ray likes to play tennis.© 2009 by Kathryn J. Davis 61Vowel Patterns

Basic Listeeggred get messlet bed wettell yes henEd well fellegg net betten pen Tedlegmenbend tent nestend went bestsenthelpsmellyelpnext© 2009 by Kathryn J. Davis 62Vowel Patterns

eegg_et_ed_en_eb_ex_eg_em_ep_egg_eff _ess _ell _eck© 2009 by Kathryn J. Davis 63Vowel Patterns

net hen bed spedget men red sledmet ten led bledlet pen fed fledpet Ben Ned Fredjet den Tedbet Ken wedvet yen Edsetglenyetfret© 2009 by Kathryn J. Davis 64Vowel Patterns

mess bell neck legBess well deck begless tell peck pegbless sell speck kegdress fell fleck Gregpress yell dregstresscressstressdellspellsmellquell© 2009 by Kathryn J. Davis 65Vowel Patterns

hem clef step flexstem Jeff pep hexstrepRexwebegg© 2009 by Kathryn J. Davis 66Vowel Patterns

ēemube she evenwe zero beginme hero beganThe bus trip will begin at ten.Mom will not let me get a pet.I can not get a dog.I can not get a cat.I can not even get a fish.Dad will let me swim in the pond.Jim is sad.He can not swim.Bob can run fast.He will be glad if he wins.© 2009 by Kathryn J. Davis 67Vowel Patterns

ēemue ven evene vil evile dict edictbe gin beginbe gan beganbe gun begunze ro zerohe ro herode cal decalhe lix helixre act reactre bus rebusVe nus Venusre lax relaxse rum serum© 2009 by Kathryn J. Davis 68Vowel Patterns

ecrochetcroquet chalet sachetbouquet ballet ricochetparquet cabaret attachéfillet gourmet appliquébuffet crochet plié© 2009 by Kathryn J. Davis 69Vowel Patterns

ecrochetMom will crochet a warm winter cap forme.Anita goes to ballet class every week.There were many delicious foods at thebuffet.The boys and girls enjoyed playing croqueton the lawn.We will stay at a chalet in the mountainson our vacation.I will order the fish fillet for dinner.© 2009 by Kathryn J. Davis 70Vowel Patterns

eaeat_ead_eaf_eak_eal_eam_ean_eap_ear_ease_eat_eave_east© 2009 by Kathryn J. Davis 71Vowel Patterns

eaeat_eat _ear _ealeat hear sealseat near mealbeat tear dealfeat sear zealheat year realmeat dear pealpeat hear tealneat rear vealtreat smear stealwheat spear squealpleatclear© 2009 by Kathryn J. Davis 72Vowel Patterns

eaeat_ea _ean _eaksea bean beakpea mean leaktea lean peakflea dean teakplea wean weakJeanspeak_eap clean sneakleap glean bleakheapstreakreap _eaf squeakleaf© 2009 by Kathryn J. Davis 73Vowel Patterns

eaeat_ead _eam _easeread seam leaselead ream creasebead team greaseplead beam easedreamtease_east gleam pleaseleastcreambeast stream _eaveyeast scream leavefeast steam weaveeastheave© 2009 by Kathryn J. Davis 74Vowel Patterns

eeeealeashbeaconeatzdiseasebeardzreasonwearyzseasondrearyteacupeatenleaderbeautifultreatmentheathtreatyleakyeasyzzeasily© 2009 by Kathryn J. Davis 75Vowel Patterns

eaeattea heat earsea read dearpea mean heareat dream nearleaf feast fearbeat speak clearmeal steal spearseat scream beardmeatrealleashfleapleasegreaseearear© 2009 by Kathryn J. Davis 76Vowel Patterns

eaeat1. Please eat your meat and your peas.2. Will you read this book to me ?3. I hear with my ears.4. We will leave the house at ten.5. My dog has fleas.6. Sam and I will help Dad rake the leaves.7. I will speak to Mrs. King today.8. Mom fixed a very good meal for us !9. Our puppy can walk on a leash.10. Don’t be mean to him !11. The elf had a long white beard and a redcap.© 2009 by Kathryn J. Davis 77Vowel Patterns

eāsteak_eak_ear_eah_eat© 2009 by Kathryn J. Davis 78Vowel Patterns

eāsteak_eaksteakbreak_earbeartearwear_eatgreatpearswear_eahyeah© 2009 by Kathryn J. Davis 79Vowel Patterns

eāsteaksteak bear swearbreakgreatyeahtearwearpearI will wear my red dress to the play.Dad will cook the steak on the grill.How did you break the window ?We all had a great time at the party.We saw a black bear at the zoo.A pear is a good snack.Do not tear the paper.earbear© 2009 by Kathryn J. Davis 80Vowel Patterns

eahead_ead _eaf _eant _ealm_eapt _east _eat _eaven_eather _eater _eath _ealth© 2009 by Kathryn J. Davis 81Vowel Patterns

eahead_ead _eather head leather readyread weather reallylead feather heavydead Heather healthybreadwealthytread _eaven stealthydread heaven steadyspread leaven sweatythreaddeadlyaheadinstead© 2009 by Kathryn J. Davis 82Vowel Patterns

eaheadhead dead spreadread deaf meantbread breath sweatweath er weatherfeath er featherbreak fast breakfastmead ow meadowhealth y healthywealth y wealthyread y readysweat er sweaterin stead insteada head ahead© 2009 by Kathryn J. Davis 83Vowel Patterns

eaheadBeth read a lot of books last summer.The plants got too dry. They are dead.Mom will spread the butter on the bread.Are we ready to go now?We will go after breakfast.I hope we will go to the park instead of themall.Our house is just ahead.I found a yellow feather in the grass.The weather is windy and wet today.Jane has a pretty blue sweater.The grass is green in the meadow.© 2009 by Kathryn J. Davis 84Vowel Patterns

earearly_eard_earl_earth_earn_earse_earch© 2009 by Kathryn J. Davis 85Vowel Patterns

earearly_earl _earn earl earn heardpearl yearn searchlearnresearchearly_earse _earth earnesthearse earth earnestlyrehearsedearth© 2009 by Kathryn J. Davis 86Vowel Patterns

earearlyearly heard earnestearth learn rehearseearn search pearlWhat will we learn about in school today?You can earn a lot of cash if you work hard.I heard a new song on the radio.We will search for the lost kitten.Try to come to school early every day.How large is the earth ?We will rehearse for the play at four o'clock.A pearl could be in this seashell.© 2009 by Kathryn J. Davis 87Vowel Patterns

ear ir worearlybirdwormThe early bird catches the worm.© 2009 by Kathryn J. Davis 88Vowel Patterns

ēefeet_ee_eeze_eese_eek_eet_eed_een_eem_eef_eel_eep© 2009 by Kathryn J. Davis 89Vowel Patterns

ēefeet_ee _eed _eepsee need deepbee feed jeeptee seed keepfee deed beepwee heed weepLee reed peeptree weed seepfree speed steepflee steed sleepglee bleed sweepthree greed creep© 2009 by Kathryn J. Davis 90Vowel Patterns

ēefeet_eek _eel _eenweek eel seenmeek peel teenleek heel keenseek reel peenpeek keel greenreek feel preencreek steel queensleekscreenGreek _eef * beenbeefreefi© 2009 by Kathryn J. Davis 91Vowel Patterns

ēefeet_eet _eer _eemfeet deer seembeet jeer teemmeet peer deemsleet steer esteemfleet sneer redeemgreetskeet _eese _eezesweet geese freezetweetbreezestreet _eeth sneezeteethsqueeze© 2009 by Kathryn J. Davis 92Vowel Patterns

ēefeetfeet green agree cheerweek sleep redeem deerneed three esteem peersee speed beetle jeerkeep sweep steeple leerfeel queen needle veerbeef sweet levee sheerseem sneeze weevil steerteen freeze coffee sneerweep teeth decreeeerbee sheep degree* been cheese teepeecheer© 2009 by Kathryn J. Davis 93Vowel Patterns

ēefeetWe see a dog with big teeth.I see a deer in the grass.Josh will feed the dogs.Mom will go in the jeep.I will meet Beth at the pet shop.This week we will go and camp in a tent.Ron feels bad.He is sick.I can see three sheep on the hill.That cat has big feet.© 2009 by Kathryn J. Davis 94Vowel Patterns

ē_ethese_eze_ede_eke_eme_ene_ere_ese_eve_ete© 2009 by Kathryn J. Davis 95Vowel Patterns

ē_ethese_ete _ere _ememete here themePete mere extremecompete sere supremeconcrete adhere athlete * where thesedeplete * there Chinesecomplete * were conveneee_ede _eve benzeneSwede eve ekestampede Eve Zekeimpede Steve trapeze© 2009 by Kathryn J. Davis 96Vowel Patterns

ē_ethesePetethemeeveeveningZekehereadheretrapezeconcretestampedetheseathleteChinesemerecashmerecompletecompete* were* where* there© 2009 by Kathryn J. Davis 97Vowel Patterns

ē_etheseHere is a black cat.Here is a yellow cat.These cats can run up a tree.Here is a big dog.Here is a little dog.These dogs will run after the cats.The workmen will mix the concrete.What is the theme of this book ?Pete will complete his project today.Steve is a fine athlete.Eve likes to compete on her swim team.Kathy’s pet is just a mere puppy.Why did the cattle stampede ?© 2009 by Kathryn J. Davis 98Vowel Patterns

ēiceiling_eit_ein_eive_eik_eize_eir_eird_either_eipt© 2009 by Kathryn J. Davis 99Vowel Patterns

ēiceiling_eive _either receive either weirdeceive neither weirdconceivedeceitperceive _ein receiptproteincaffeineleisureseizesheikceiling© 2009 by Kathryn J. Davis 100Vowel Patterns

ēiceilingceiling weird deceiveeither leisure proteinneither receive caffeineseize sheik receiptA fly landed on the ceiling.Did you receive my letter ?The outlaws tried to seize his farmland.Neither my mother nor my father can gowith me.That boy tried to deceive me.What was that weird sound in the attic ?I enjoy reading in my leisure time.© 2009 by Kathryn J. Davis 101Vowel Patterns

eiveil_ein_eil_eintz h_eige_eign_eir© 2009 by Kathryn J. Davis 102Vowel Patterns

eiveil_ein _eign _eirvein reign heirrein deign theirskein feign theirsi* stein_eige _eint beige feint reindeerseine_eilveilsurveillanceinveigleobeisant© 2009 by Kathryn J. Davis 103Vowel Patterns

eiveilveil skein reignrein reindeer deignvein seine feigntheir feint beigetheirs heir surveillance© 2009 by Kathryn J. Davis 104Vowel Patterns

eiveilTheir class will sing first.I pulled gently on the horse’s reins.My new slacks are beige.The bride wore a white wedding gown and along veil.The prince was the only heir to the throne.I will need six skeins of yarn to knit asweater for you.Reindeer live in the north, where it is verycold in the winter.© 2009 by Kathryn J. Davis 105Vowel Patterns

eighsleighsleigh eight weightweigh eighty freightneigh eighteen * heightinveigh neighbor * sleightWe like to ride in a sleigh in the snow.The horse neighed when we came to the barn.She will weigh the baby every week.Our neighbors are out of town.A freight train can carry lumber and coal.There are eight apples in the bowl.We found eighteen red maple leaves.What is the weight of that big pumpkin ?© 2009 by Kathryn J. Davis 106Vowel Patterns

erher_er_erd_erf_erk_erse_erm_erb_ern_ert© 2009 by Kathryn J. Davis 107Vowel Patterns

erher_er _erse _erther verse pertper terse Bert* were_erk _erb _erfjerk verb serfperkHerbclerk herb _ermterm_ern _erth bermfern berth _erdsternherd© 2009 by Kathryn J. Davis 108Vowel Patterns

erhererberrylet ter letter berrylad der ladder ferrysum mer summer merrybut ter butter cherrygut ter gutter heronsis ter sister errorriv er river terrorev er ever terriblenev er never periscopeaf ter after strawberryun der under blackberryo ver over raspberryloc ker locker herringdress er dresser Jerry* an swer answer Sherry© 2009 by Kathryn J. Davis 109Vowel Patterns

erherButter melts if it gets hot.Jan will plant a fern under the tree.We saw a herd of sheep at the farm.Can we swim in the river ?After we swim, we will rest.Supper will be at six.Will Dad ever let us get a dog ?No, he will never let us get a pet.Dad went up the ladder to fix the gutter.Bert can jump over the high bar at the track.I saw his sister at the mall.Her mom paid the clerk.I will send her a letter.© 2009 by Kathryn J. Davis 110Vowel Patterns

neutroneūEuropeEurope lieutenant neutralfeud lieu neuronfeudal deuce neutronpseudo neuter queuerheumatic sleuth euchremaneuver streusel Eugeneeulogy eureka leukemianeurotic neuritis neurosesneutrino teutonic milieuZeus© 2009 by Kathryn J. Davis 111Vowel Patterns

neutroneūEuropeEurope is a continent that is west of Asia.Mom baked apple streusel for dessert.Eureka ! I think I’ve got it !It will take a famous sleuth to solve thismystery.The lieutenant directed the soldiers toprepare for battle maneuvers.Eugene is hoping to discover a cure forleukemia.Rheumatic fever is a dangerous disease.Those two families have been in a feud formany years.I wish to remain neutral about thisargument.© 2009 by Kathryn J. Davis 112Vowel Patterns

flewewfewnewflewgrewknewblewdrewchewstewcrewshrewthrewjewelrysewerAndrewLewismildew* sew few* sewing cashew© 2009 by Kathryn J. Davis 113Vowel Patterns

flewewfew_ew _ew dew flew jewelfew blew jewelryhew stew Newtonmew spew crewelnew grew sewerpew drew cashewyview brew AndrewcrewLewiso* sew strew mildewthrew© 2009 by Kathryn J. Davis 114Vowel Patterns

flewewfewKate has some new shoes.The birds flew to the large oak tree.I knew he would want to go with us.Sally drew a large dog and a small cat.Dogs like to chew on bones.You may eat a few grapes.Greg works at a jewelry store.We had beef stew for supper.Sam threw the ball across home plate.The flowers grew tall in the warm sun.The wind blew the leaves across the yard.© 2009 by Kathryn J. Davis 115Vowel Patterns

ēykeykey chimney Audreydonkey whiskey Bradleymonkey jersey Jeffreymoney turkey paisleyhoney surrey baloneyalley parsley odysseygalley barley journeyvalley trolley medleyjockey volleyball hackneyhockey kidney curtsey© 2009 by Kathryn J. Davis 116Vowel Patterns

ēykeyA donkey is not as tall as a horse.The river is in a valley between those hills.Ron lost the key to his locker.We will go downtown on the trolley.We found a stray cat in the alley.Mom will add parsley to the soup.Bradley will play volleyball tonight.His group has red jerseys.Audrey likes to have a baloney sandwich forlunch.© 2009 by Kathryn J. Davis 117Vowel Patterns

eytheythey hey conveyhey prey obeyHey!This is not the right way to go.Jim will obey his mom and dad.Kids like to play.They like to run and jump.They like to find bugs in the grass.They like to slide.© 2009 by Kathryn J. Davis 118Vowel Patterns

Basic Listiinin mix didif pig fixit hill bitbig miss kidsix Bill Jimhit him sitwill sip fillfitlist lift windmilk spill tripstillslip© 2009 by Kathryn J. Davis 119Vowel Patterns

iin_it_ip_im_id_ig_in_ib_ix_is_iff_ill_iss_ick© 2009 by Kathryn J. Davis 120Vowel Patterns

sit split zip skipbit grit tip sniplit flit hip slipkit skit rip fliphit slit lip clipfit quit dip blippit spit sip dripwit yip gripnit pip tripkipstrip© 2009 by Kathryn J. Davis 121Vowel Patterns

him swim rib missTim slim bib kissJim trim fib hissKim brim nib blissdim skim crib Swissvim grim glibprimis quiz mitt skiffhistifffizzmiffsniff© 2009 by Kathryn J. Davis 122Vowel Patterns

pin fix lid pigfin six kid bigwin mix hid digtin nix bid wigsin rid figbin did jigkin skid zigspin slid rigskin grid giggrintwintwigbrig© 2009 by Kathryn J. Davis 123Vowel Patterns

kick trick fill dilllick stick will billpick click hill quillsick brick gill stillRick flick mill spillDick slick pill skillNick prick sill grillquick crick kill drilltick till twillwick Jill swillBillfrill© 2009 by Kathryn J. Davis 124Vowel Patterns

iislandI hi pintHi !I am Sam.I can run fast.I can swim.I can jump.I can help.I can rest.© 2009 by Kathryn J. Davis 125Vowel Patterns

iislandi tem itemi con iconi bex ibexi bis ibisdi et dietsi lo siloO hi oOhiobi ped bipedvi rus virussi ren sirensi nus sinusri pen ripenli lac lilacli bel libelwi den widen© 2009 by Kathryn J. Davis 126Vowel Patterns

ipizzapizza machine skipita marine trioLisa Anita patioTina policeman radioRita taxi polioLisa rides in a taxi to go to work.Do you know how to fix this copy machine ?A policeman helped the little old man acrossthe road.Anita likes to hear songs on the radio.Rita is eating pizza for lunch on the patio.Their family likes to ski in the winter.© 2009 by Kathryn J. Davis 127Vowel Patterns

ioniononion union juniormillion opinion seniortrillion scallion saviorbullion companion dominionviewJack will slice an onion to serve with thehamburgers.There must be a trillion stars in the sky.Mary is a junior and Laura is a senior inhigh school.In your opinion, how should we solve thisproblem?A king has dominion over all of his kingdom.Audrey will chop some scallions to put in thesoup.© 2009 by Kathryn J. Davis 128Vowel Patterns

iepiepie spies diedlie cries criedtie tries replieddie flies * friendI like to eat apple pie.She will tie a red bow in her hair.You should not tell a lie.Mom won’t let the dog lie on the couch.When her pet died, she cried all night.My friend always tries to do his best.A hawk flies very fast.If you don't water the plants, they will die.© 2009 by Kathryn J. Davis 129Vowel Patterns

iēshield_ie_ief_ield_ier_ieve_iece_iek_iest_iege© 2009 by Kathryn J. Davis 130Vowel Patterns

iēshield_ield _ieve _ierceshield believe fiercefield relieve pierceyieldwieldreprieveachievegrieve_iefchiefthievesthief _iece _ierbrief niece piergrief piece tierreliefapiece© 2009 by Kathryn J. Davis 131Vowel Patterns

iē_iegesiegebesiegeliegeshieldcookierookieeeriemöviepriestmedievalshriekhygienecollieCharlieDonnieJulieMarie* friend Willie* sieve pixie© 2009 by Kathryn J. Davis 132Vowel Patterns

iēshieldshield piece collie pierfield niece eerie tieryield priest movie bierwield fiend Charlie piercethief shriek Julie fiercebrief frieze Mariegrief siege cookiechief liege rookielien belief hygienemien relief achieve* friend believe relieveierpier© 2009 by Kathryn J. Davis 133Vowel Patterns

iēshieldThe fire chief helped the firemen fight thefire.We played soccer on the field at the park.The brave knight went after the fiercedragon with only his sword and shield.A thief stole my friend’s gold ring.Would you like a piece of cherry pie?No, I would like to have some cookies.My niece is a friendly girl. Her name isJulie.This program will be brief.I believe that Charlie is right about that.We went to see an eerie movie last night.© 2009 by Kathryn J. Davis 134Vowel Patterns

i_epine_ide_ife_ike_ile_ime_ine_ipe_ire_ite_ive_ize© 2009 by Kathryn J. Davis 135Vowel Patterns

i_epine_ine _ike _ipepine like pipeline bike ripefine Mike wipemine hike swipenine pike gripevine spike stripespinestriketwine_ibeswine _ize tribeshine size bribewhine prize scribe© 2009 by Kathryn J. Davis 136Vowel Patterns

i_epine_ide _ile _imehide mile timewide pile dimebide Nile limeride file rimeside tile mimetide vile slimeslide rile crimeglide stile grimebride smile primepridewhilestride© 2009 by Kathryn J. Davis 137Vowel Patterns

i_epine_ite _ive _irebite dive firekite hive hiresite five diremite drive mirespite * live siresmite * give tiretritewirequite _ife irewhite life spiresprite wife shirestrifesquire© 2009 by Kathryn J. Davis 138Vowel Patterns

i_efiremenfirehouseinsideoutsideupsideinvitedesireentireexpireigniteumpirepineinquiresidewayssidewalkadmirebesidedividedivineempirepoliteretirerevise© 2009 by Kathryn J. Davis 139Vowel Patterns

i_epinelike ride smilekite nine shinefine life bridesidepilebike dime firemile size tirehide drive wirefive slide hiretimeprizehikestripewhitequiteirefire© 2009 by Kathryn J. Davis 140Vowel Patterns

i_epineI like to go down the slide.I like to ride a bike.I like white dogs and cats.I like to win a prize.I like to smile.I like to hike five miles.I like to get a dime.I like to play hide and seek.I like to play with Mike.I like to fly a kite.I like to drive a jeep.© 2009 by Kathryn J. Davis 141Vowel Patterns

ighnight_ightfightlightmightnightright_ightblightslightflightplight* heightsighttightknightbrightfright_ighhighsighnigh© 2009 by Kathryn J. Davis 142Vowel Patterns

ighnighthigh fight slightsigh might brightnight tight frightlight sight frightenright flight delightThis is a dark night.The stars are bright at night.The light bulb is off.A jet can go up high in the clouds.We might play ball at the park today.Mark held the pen in his right hand.Jeff and Sam must not fight.© 2009 by Kathryn J. Davis 143Vowel Patterns

ildchildchild wild mildgrandchild wildfire mildlychildlike wildcat wildlyHer youngest child is six years old.A wolf is a wild animal.We have had a mild winter this year.Her grandchild is coming to visit today.The firefighters could not control the wildfireon the mountain.We enjoy seeing the wildflowers when wewalk in the meadow.The farmer saw the paw prints of a wildcatin the mud by the creek.© 2009 by Kathryn J. Davis 144Vowel Patterns

indfindfind blind rewind windkind grind behind hindbind mind remind rindBe kind to the little girls.The miller will grind the wheat for the littlered hen.This dog is blind. It cannot see.Please wind the yarn into a ball.I will stand behind you in line.Will you remind me to do my homework ?A bee stung the dog on his hind leg.© 2009 by Kathryn J. Davis 145Vowel Patterns

irbird_ir_ird_irl_irm_irp_irr_irt_irth_irst© 2009 by Kathryn J. Davis 146Vowel Patterns

irbird_ir _irt _irlsir dirt girlfir skirt swirlstir shirt twirlwhir flirt whirlsquirt_ird _irm _irthbird firm birththird squirm mirth© 2009 by Kathryn J. Davis 147Vowel Patterns

ir_irstfirstthirstbirdthirstydirtysquirrel_irksmirkshirkquirkbirthdayblackbirdstirrupthirtythirteen_irrwhirrshirrdirect* spirit* mirror© 2009 by Kathryn J. Davis 148Vowel Patterns

irbirdgirlsirbirdskirtdirtthirstystirbirthdayfirstsquirrelshirtdirtythirdfir© 2009 by Kathryn J. Davis 149Vowel Patterns

Basic Listooxon pot mopoff hop oxtop dog pophot not lotdrop cost frogploploststopspotcrosssoft© 2009 by Kathryn J. Davis 150Vowel Patterns

oox_ot_op_od_og_ob_on_om_ock_ox_odd_oll_oss© 2009 by Kathryn J. Davis 151Vowel Patterns

hot spot hop stopnot slot top slopcot blot cop floplot plot lop glopgot clot mop ploppot trot pop propdot scot sop croprot bop dropjotstroptot© 2009 by Kathryn J. Davis 152Vowel Patterns

od dog cob mossnod jog rob lossGod log Bob bosscod hog mob tosssod fog job Rosspod bog sob flossclod nog lob glossplod cog glob crossprod smog snobtrod frog slobclogblob© 2009 by Kathryn J. Davis 153Vowel Patterns

mom on off sockTom Ron doff lockprom Don scoff rockconsocktockdockclockodd doll box stockloll pox flockloxblockfox© 2009 by Kathryn J. Davis 154Vowel Patterns

ōoceango no sopro yo-yo ho ho hoboth most postMom will go on a trip.A golf pro will help Dad.A yo-yo can spin fast.Sam and Tom will both go on the bus.No, Beth can not go with them.It is so hot in the sun.Jeff has six shells.Jan has ten shells.Jan has the most.© 2009 by Kathryn J. Davis 155Vowel Patterns

ōoceano pen openmo ment momentto ken tokenbo gus bogusbo nus bonuspo et poetpo em poemco ed coedfro zen frozendo nut donutfo cus focusho tel hotelmo tel motello tus lotusro bot robotno mad nomadyo del yodel© 2009 by Kathryn J. Davis 156Vowel Patterns

ōoceanhip po hippohel lo hellocon do condopin to pintolim bo limbodit to dittotem po tempodis co discocon do condocom bo combolo go logodo do dodolo co locoyo yp yo-yoso so so-sosi lo siloro de orodeo© 2009 by Kathryn J. Davis 157Vowel Patterns

ötotodomoveprove* two lose* whoDad and I will go to the pond to fish.Kim will go to the pet shop with me.I will send two gifts to Pam.Who can do this job ?Do not step on that bug.Jeff will move this big box to the attic.Do not lose this cash.© 2009 by Kathryn J. Davis 158Vowel Patterns

osonson from ovenwon front coverton month wonderofI will get a bag of toffee from the candy shop.A man and his son went on a long trip.We will run from this tree to the pond.Jeff will stand at the front of the class.Our class won the contest.I wonder how many stars are in the sky?July is a hot month.© 2009 by Kathryn J. Davis 159Vowel Patterns

ōaboat_oad_oaf_oak_oal_oam_oan_oap_oar_oast_oat_oath_oard© 2009 by Kathryn J. Davis 160Vowel Patterns

ōaboat_oat _oar _oadboat oar roadcoat roar toadmoat soar loadgoat boar goadoats hoar * broadfloat* abroadthroat_oakgloat oak _oambloat soak foamgroat cloak loamcroakroam© 2009 by Kathryn J. Davis 161Vowel Patterns

ōaboat_oan _oast _oardloan roast boardmoan coast hoardJoan toast * cupboardroanboastgroan_oarsehoarse_oal coarsecoalloaffoal soap _oathgoal coax oathshoal hoax loath© 2009 by Kathryn J. Davis 162Vowel Patterns

ōaboatboatsoapfoalroadcoatcloakoakcoastfoamgoatfloatcōcoaroarcroakoatmealtoad roach topcoatcoachroastrowboattoastsoartugboatthroatgroan* broadcoalboard* cupboard© 2009 by Kathryn J. Davis 163Vowel Patterns

ōaboat1. Kay has a red coat.2. A goat ate the man’s hat.3. We will go for a ride on the river inBob’s boat.4. I can float in the water.5. Sam’s throat is sore today.6. Tom drove down the road.7. We will eat eggs and toast for breakfast.8. Joan will wash her hands with soap.9. A fat toad ate a fly. Croak, croak.10. The men will load the boards onto thetruck.© 2009 by Kathryn J. Davis 164Vowel Patterns

ōetoetoe floe doehoe oboe * shoeJoe goes * canoeJoe has some new shoes.I bumped my toe on the desk.The mother doe took good care of her fawn.I will need a hoe to dig up the weeds.A jest goes faster than a canoe.The ship hit an ice floe.Beth can play the oboe.© 2009 by Kathryn J. Davis 165Vowel Patterns

ō_ehome_obe_ode_oke_ole_ome_one_ope_ore_ose_ote_ove_oze© 2009 by Kathryn J. Davis 166Vowel Patterns

ō_ehome_one _ope _olebone rope holecone hope poletone cope solelone mope molezone Pope rolestone lope doleclone slope stolealone scope * wholeshonegrope* one* done# gone© 2009 by Kathryn J. Davis 167Vowel Patterns

ō_ehome_ode _oke _omerode joke homecode poke domemode woke Romenode yoke * somebode spoke * comelode smoke * becomeeeestoke* welcomeebroke© 2009 by Kathryn J. Davis 168Vowel Patterns

ō_ehome_ote _ove _osevote cove nosenote wove roserote stove hosedote clove posetote drove dosequote grove closesmote * love prose* dove those_oze * glove * lösedoze * shove * whösefroze» pröve© 2009 by Kathryn J. Davis 169Vowel Patterns

ō_ehome_ore _ore core store clothesbore score anymorefore spore adoremore snore ashoresore shore beforepore Lenore ignoretore _obe devotewore robe tadpoleyore lobe exploreore globe explodelore probe suppose© 2009 by Kathryn J. Davis 170Vowel Patterns

ō_ehomehome hope morerope note sorenose hose torehole joke corerode bone borecode woke woreclose drove storestone broke scorecone those snorerosesmokeglobepolerobedomeoremore© 2009 by Kathryn J. Davis 171Vowel Patterns

ō_ehomeI went home.I rode the bus home.I dug a hole.I set a pole in the hole.A rope was on the pole.A flag was on the rope.I see six shells and a red stone.Jan woke up at six.Those men need this rope.Bob will feed his dog a bone.I hope we will go in the jeep.© 2009 by Kathryn J. Davis 172Vowel Patterns

o_elovelove come donedove some noneglove become * oneWill Mary come with me?Ross loves his dog.None of them will help me.Sam lost one of his gloves.Some of the kids did not get on the bus.A dove sat on top of the barn.© 2009 by Kathryn J. Davis 173Vowel Patterns

oioil_oil_oin_oint_oist_oid_oise_oice_oif© 2009 by Kathryn J. Davis 174Vowel Patterns

oioil_oil _oint _oistoil point moistcoil joint joistsoil appoint hoistcoil ointment foistfoiltoilappointmentdisappointspoilbroil© 2009 by Kathryn J. Davis 175Vowel Patterns

oioil_oin _oice _oidjoin voice voidcoin choice avoidgroin rejoice devoidsirloin invoice ovoidpurloinadenoidandroid_oise tabloidnoise noisy thyroidpoise coif typhoid* porpoise doily* tortoise troika© 2009 by Kathryn J. Davis 176Vowel Patterns

oioiloil join noiseboil coin voicefoil sirloin choicesoil point rejoicecoil joint avoidspoil appoint noisybroil ointment moistdoily appointment hoist© 2009 by Kathryn J. Davis 177Vowel Patterns

oioilJim planted the seeds in the soil.John will change the oil in his car.Jack keeps all of his coins in a jar.Jeff will coil the rope neatly.Jan will boil the rice for supper.Josh will point to the correct answer.Jill has a good singing voice.Julie wants to avoid that spoiled boy.Jerry shouldn’t be so noisy in the classroom.Don't be late for your dental appointment.© 2009 by Kathryn J. Davis 178Vowel Patterns

ōldgold_old _older old folder coldcold smolder coldersold holder coldestfoldoldbold oldermold golden oldestgold goldfish foldtold behold foldedhold potholder scoldscoldscolded© 2009 by Kathryn J. Davis 179Vowel Patterns

ōldgoldoldholdcoldtoldfoldscoldgoldgoldensoldfoldermoldsmolderboldbehold© 2009 by Kathryn J. Davis 180Vowel Patterns

ōldgoldThe old man lost his hat.Will we find gold in this cave ?May I hold the baby ?Pam will fold the napkins.It is cold in the winter.She sold him three books.I will try to scrub the mold off the wall.There are many goldfish in this pond.Mom scolded us for being late.A fire can smolder for a long time.Keep your homework in this folder.© 2009 by Kathryn J. Davis 181Vowel Patterns

ōlkyolkyolkfolkkinsfolkPolkpolka dotNorfolkJames K. Polk was the eleventh president ofthe United States.Norfolk is a city on the coast of Virginia.Her new dress had red polka dots.We will learn some folk songs in musictoday.When you fry the egg, try not to break theyolk.She went to visit her kinsfolk in themountains.© 2009 by Kathryn J. Davis 182Vowel Patterns

ōlltrollroll stroll swollentoll droll strollerpoll enroll bedrolltroll enrollment rolling pindroll patrolled roller coasterknoll roller roller skatescroll payroll steamrollerextollcollate© 2009 by Kathryn J. Davis 183Vowel Patterns

ōlltrollHis knee was swollen after he fell on theconcrete.Mr. and Mrs. Brown put the baby in thestroller and took a walk after dinner.We will all ride on the roller coaster at theamusement park.The biggest billy goat butted the terrible trolloff the bridge.Long ago, people wrote on long strips ofpaper called scrolls.We had our picnic on a grassy knoll by thelake.Mom and Dad will enroll Michael in summercamp this year.We must pay a toll to use this highway.© 2009 © 2001 by by Kathryn KaXthryn J. Davis J. 184Vowel Sounds For Beginning Vowel Readers Patterns

ōltboltbolt molt moltenjolt volt boltedcolt dolt revoltA bolt of lightning hit the fence.The car stopped with a jolt.She will buy a bolt of fabric to make the curtains.The little colt ran quickly to its mother.A reptile’s skin will molt several times a year.We will bolt the license plate to the back ofthe car.That toy uses a 1.5 volt battery.The peasants will revolt if they are starving.© 2009 by Kathryn J. Davis 185Vowel Patterns

oobook_ook_ood_ool_oof_oot© 2009 by Kathryn J. Davis 186Vowel Patterns

oobook_ook _ood _ootbook good footlook wood soothookhoodtook stood _oofcook * blood hoofnook * flood woofbrookcrook _oolshook football woolunderstoodgoodnightuu© 2009 by Kathryn J. Davis 187Vowel Patterns

oobooklookwoodgoodhookbooksootfoothoofwoofcookhoodbrookwoolstoodtookshook© 2009 by Kathryn J. Davis 188Vowel Patterns

oobookLook at all the pretty flowers !This is a very good book.A dog can bark. Woof, woof !I see a small fish in the brook.Mom will cook hotdogs on the grill.Jan has a red wool scarf.The trees shook in the wind.Kay took a nap after the party.This horse has a crack in its hoof.Our class stood up and sang a song.This box is one foot long.© 2009 by Kathryn J. Davis 189Vowel Patterns

öomoon_oo_ood_oof_ool_oom_oon_oop_oose_oot© 2009 by Kathryn J. Davis 190Vowel Patterns

öomoon_oo _oom _ootzoo room boottoo zoom rootmoo loom lootwoo doom tootcoo boom mootboo bloom hootshoo gloom shootbroomgroom_oostroostboost© 2009 by Kathryn J. Davis 191Vowel Patterns

öomoon_ool _oop _ooncool hoop noonpool coop loontool loop moonfool stoop soonstool scoop boonspool swoop spoondrool troop croonk* school sloop swoondroopsnoop© 2009 by Kathryn J. Davis 192Vowel Patterns

eöomoon_ood _ooth food tooth poohmood booth spookbrood smooth groovesoothesnoozeshampoo_oof _oose bathroomroof loose balloongoof moose afternoonproof goose bamboospoof noose igloorooster© 2009 by Kathryn J. Davis 193Vowel Patterns

öomoonzoo tool moosefood soon gooseroom pool looseroot noon broomcool scoop troopmoon proof shootboot spool toothfool bloom smoothtoo stool schoolroof spoon cocoon© 2009 by Kathryn J. Davis 194Vowel Patterns

öomoonMy red boots are in my room.This vest is too tight on me.Tom's tooth is loose.I can see the moon in the night sky.I will get a broom so I can sweep my room.A goose can swim in a pond.A tree has long roots that go down into theground.Your food is on the tray.We will swim in the pool this summer.We will see a moose at the zoo next week.It is hot out in the sun.house.It is cool in the© 2009 by Kathryn J. Davis 195Vowel Patterns

ōordoordoor outdoors floordoorway poor flooringindoors poorly floorsI will open the door for you.Look at the poor lost puppy.My books fell on the floor.We play indoors when it is too cold outside.A pretty girl stood in the doorway.Some workmen installed new flooring in ourhouse.He did poorly on his spelling test this week.lit-I will leave a crumb on the floor for thetle mouse.© 2009 by Kathryn J. Davis 196Vowel Patterns

or oor arhorsedoorbarnThe horse is by the barn door.© 2009 by Kathryn J. Davis 197Vowel Patterns

ōrhorse_or_ord_ork_orm_orn_orse_ort_orth_orb© 2009 by Kathryn J. Davis 198Vowel Patterns

ōrhorse_or _ork _ortor fork fortfor pork portnor cork sortstorksportsnort_ord _orm shortcordformford norm _orthlord dorm north* sword storm forth© 2009 by Kathryn J. Davis 199Vowel Patterns

ōrhorse_orn corn orbit importhorn forbid exporttorn forget supportborn forgot reportworn forgiven importantscorn horse informthorn morning performshorn story borderesworn_orborb* colore© 2009 by Kathryn J. Davis 200Vowel Patterns

ōrhorsehorse corn cordfork storm sportborn thorn shortpork horn norththorn or forstork snort cork© 2009 by Kathryn J. Davis 201Vowel Patterns

ōrhorsePlug in the cord.A horse can run fast.This rose is for Mom.Will it storm ?The dress was torn.The pigs will get the corn.We can rest or we can swim.A ram has big horns.The men went north in the jeep.© 2009 by Kathryn J. Davis 202Vowel Patterns

ormirrororsorrymirror motor sorrydoctor major horroractor minor horribleterror labor sorrowhorror favor borrowerror flavor tomorrowstubborn humor horrid* color razor torrid© 2009 by Kathryn J. Davis 203Vowel Patterns

ormirrororsorryI’m sorry you must go so soon.You made three errors on your math test.Will you please do me a favor?May I borrow your book to study for thetest?The doctor will look at the baby to see if sheis sick.My dad has a good sense of humor.What do you see when you look in the mirror?Tomorrow our class will visit the zoo.© 2009 by Kathryn J. Davis 204Vowel Patterns

othermotherothermothersmotheranotherbrotherMy mother makes me clean my room.I will look for another book.Please give this letter to my brother.I will go shopping with my mother.My brother’s name is Bob.We will hike to the other side of the hill.We will go swimming another day.© 2009 by Kathryn J. Davis 205Vowel Patterns

ououch_ouse_oud_ound_out_our_ount_oul_oun_oust© 2009 by Kathryn J. Davis 206Vowel Patterns

ououch_out _ouse _oundout mouse roundpout house soundstout louse poundspout douse foundscout blouse boundsnout spouse houndgrout grouse woundfloutgroundclout© 2009 by Kathryn J. Davis 207Vowel Patterns

ououch_oud _oun _ourloud noun ourcloudproudsourhourflourscour_ount _oul _oustcount foul joustmount© 2009 by Kathryn J. Davis 208Vowel Patterns

ououchout pound blouseour found stoutloud sound cloudnoun round spoutsour hound proudtroutcounta_flour scout aroundsnout ground about© 2009 by Kathryn J. Davis 209Vowel Patterns

ououchSam’s drum is loud.Dan went out at ten.Kim will rest in an hour.Dad found our red caps.Tom can count out loud.Ned 's hotdog fell on the ground.Jill has a red blouse.Mom will mix the flour.The dog ran around the tree.A jet is up in the clouds.© 2009 by Kathryn J. Davis 210Vowel Patterns

öusoup_ou_oup_our_outh_ough_ound© 2009 by Kathryn J. Davis 211Vowel Patterns

öusoup_our _ou your you touristtourcroutoncontour _ough toucandetour through cougaryours_oup _ound yourselfsoup wound routegroupjoulecroup _outh coupontroupe youth silhouettecoupe uncouth you’revermouthyou’ll© 2009 by Kathryn J. Davis 212Vowel Patterns

öusoupyou soup yoursyour group woundtour croup * throughThis soup is hot.Will you go on the bus with me ?You can go to the campground with me.We will tour the camp at ten.Your group will be last.That dog bit your leg.I see a wound on your leg.The mouse ran through the hole.© 2009 by Kathryn J. Davis 213Vowel Patterns

oucountrycountry young dangerouscousin southern curiouscouple jealous furiousdouble nervous serioustrouble famous variousshtouch enormous * anxious© 2009 by Kathryn J. Davis 214Vowel Patterns

oucountryPlease don’t touch that expensive vase.If it breaks, we will be in a lot of trouble.May I have a couple of cookies?You are too young to drive a car.It is dangerous to drive too fast.I would like a double scoop of ice cream.Cats are curious animals.My cousin will visit me next month.She lives in another country.She will fly here in an enormous jet.She is a famous person.She lives in southern France.© 2009 by Kathryn J. Davis 215Vowel Patterns

ōushoulder_oul_our_ourt_ourse_ough_ourn_ourd_oulder_ourth© 2009 by Kathryn J. Davis 216Vowel Patterns

ōushoulder_our _ough _oursefour though coursepour dough concoursefourteenalthoughdownpour thorough _oulsoul_ourt _oulder poultrycourt bouldercourtship shoulder courtyard smoulder fourthmourngourd© 2009 by Kathryn J. Davis 217Vowel Patterns

ōushouldershoulder dough soulboulder although poultrythoroughWhen you make bread, it takes one hour forthe dough to rise.We will begin the game, even though Samis late.Charlie hit his shoulder when he fell.Brad did a thorough job cleaning his room.A large boulder fell down the hill onto theroad.© 2009 by Kathryn J. Davis 218Vowel Patterns

oughtboughtbought fought soughtthought brought wroughtought nought thoughtfulYou ought to do your homework now.I thought he was my friend.The knights fought the battle in the field bythe river.Kim bought a new dress yesterday.We brought you a present for your birthday.Thank you for being so thoughtful when Iwas sick.All of our hard work was for nought.© 2009 by Kathryn J. Davis 219Vowel Patterns

oüldshouldcouldwouldshouldcouldn’twouldn’tshouldn’tI would like to eat dinner now.“You should pick up this mess,” said mother.Ed said, “Do you think you could win thecontest ?”Would you help me, please ?Should I go to bed now ?You shouldn’t be so mean to him.Bob couldn’t do all the work by himself.Oh, how I would like to go home now !© 2009 by Kathryn J. Davis 220Vowel Patterns

ōurpourourjournalfourjournalpourjourneycourtcourtesycoursenourishmournflourishgourdadjournfourthtournamentfourteencourageencourage© 2009 by Kathryn J. Davis 221Vowel Patterns

ōurpourI have four dogs.Will you please pour the milk ?She is fourth in line.The tennis court is crowded today.Of course we will go.This cup is made from a hollow gourd.There are fourteen kids in my class.We will mourn a long time for our dead pet.© 2009 by Kathryn J. Davis 222Vowel Patterns

ourjournalBrad went on a long journey to the otherside of the world.Sue's journal is in her desk.I hope I will win the tennis tournament.This soup will nourish the hungry people.You should eat a nourishing breakfast.Please remember to treat others withcourtesy.Mike's team won the basketball tournament.The actors bowed with a flourish after theplay.© 2009 by Kathryn J. Davis 223Vowel Patterns

er our urherjournalpurseHer journal isin her purse.© 2009 by Kathryn J. Davis 224Vowel Patterns

owcow_ow_own_owd_owl_owel_ower© 2009 by Kathryn J. Davis 225Vowel Patterns

owcow_ow _own _owlcow down owlhow town howlbow gown fowlsow crown jowlpow brown yowlnow frown cowlvow clown scowlwowbrowgrowlprowlprowplow© 2009 by Kathryn J. Davis 226Vowel Patterns

owcow_owd _ower _owelcrowd power toweltowercowerflowervoweldoweltrowel_owsedowsebrowsemeowbow wow© 2009 by Kathryn J. Davis 227Vowel Patterns

owcowcow clown powerhow plow towernow brown showerwow crowd flowerdown frown bow wowtown growl towelgown crown vowelhowl owl me owmeow© 2009 by Kathryn J. Davis 228Vowel Patterns

owcowThree cows are in the barn.A clown will visit our class this week.How fast can this car go ?The farmer will plow his land this week.Will that dog growl at me ?No, but it will howl all night.Mark will plant red flowers in his yard.We all ran down the hill.Dad will frown if he is mad.A cat can play with a ball of yarn. Meow !A big brown dog ran after the cat. Bow wow!Bob got lost in the crowd.We see an owl high in that tree.© 2009 by Kathryn J. Davis 229Vowel Patterns

ōwsnow_ow _ow low stow yellow willowrow grow fellow pillowsow crow mellow billowtow throw elbow windowbow show hollow minnowmow follow widowblow _own bowl belowslow grown growthflowglowsnowthrownblownflown© 2009 by Kathryn J. Davis 230Vowel Patterns

ōwsnowbow pillow snowgrow crow followbowl yellow slowthrow row flowwindow show mowblow elbow grownshadow willow hollowborrow sorrow tomorrow© 2009 by Kathryn J. Davis 231Vowel Patterns

ōwsnow1. Will it snow today?2. I hope we can play in the snow.3. How hard can you throw a snow ball ?4. Will you show me how to do this ?5. Pat will eat a bowl of oatmeal.6. Beth has a red bow on her dress.7. The pillow on this bed is soft.8. Mom has pretty yellow flowers in her yard.9. Flowers need rain and sunshine to grow.10. Brad will shut the window.11. I see a black crow in that oak tree.© 2009 by Kathryn J. Davis 232Vowel Patterns

oyboyboy enjoy oystertoy cowboy royaljoy employ loyalsoy destroy voyagecoy annoy Lloyd© 2009 by Kathryn J. Davis 233Vowel Patterns

oyboyA boy can play ball.A boy can run fast.A boy can fix a toy.A boy can enjoy a good book.A boy can be coy with a girl.A cowboy rides on a horse.I hope they will employ me at the mall.This mess annoys my mother.We ate soy sauce with our Chinese dinner.We must take care not to destroy our forests.Pam is a loyal friend.The sailors went on a long voyage across thesea.© 2009 by Kathryn J. Davis 234Vowel Patterns

quä_quarrelquarrelquandaryquartquadranglequartzquantityquarterquadrupletsquarryqualifyquarantinequalmquaffqualityquartet* quack© 2009 by Kathryn J. Davis 235Vowel Patterns

squä_squashsquashsquadronsquatsquallsquandersqualorsqualidsquabbleSquantosquad* square© 2009 by Kathryn J. Davis 236Vowel Patterns

quä_quarrelsquä_squashWe are growing squash in our garden.I need to buy a quart of milk.Please don’t quarrel with your friends.We need a large quantity of meat for thecompany picnic.The little boy was lost. He was in aquandary.I will buy a snack with my quarters.Do you think you can qualify for the race ?We will study quadrangles in math today.They lived in a squalid shack.This grocery store carries only high qualityfoods.© 2009 by Kathryn J. Davis 237Vowel Patterns

swaswanswan swamp swallowswap swath swaddleswat swab swarm* swam swatch swarthyA beautiful white swan swam across the lake.Yesterday, we found a swarm of bees in apine tree on the playground.Would you like to swap baseball cards withme?The tornado left a swath of destructionthrough the city.The large pills are difficult to swallow.Many alligators live in the swamps in Florida.© 2009 by Kathryn J. Davis 238Vowel Patterns

Basic Listuupus sun cupup nut tubfun bus runcub pup butjump just stuffbumpmustlump dust scrubdumphuntgulp© 2009 by Kathryn J. Davis 239Vowel Patterns

uup_ut_um_ud_un_ug_ub_up _us _ux _uck_uss_ull_uff_uzz _uff© 2009 by Kathryn J. Davis 240Vowel Patterns

nut gum bud sunbut hum mud bunhut bum suds funcut rum dud runjut sum cud gunrut mum scud nungut scum spud punglut slum stud dunstrut plum stunglumspundrum© 2009 by Kathryn J. Davis 241Vowel Patterns

ug drug tub grubrug smug cub scrubdug snug rub drubhug slug hub stubtug plug sub snubjug nub clubmuglugdubpubpug© 2009 by Kathryn J. Davis 242Vowel Patterns

cuff dull duck stuckhuff hull luck cluckpuff mull tuck truckmuff null buck struckruff lull muck pluckbuff cull puckgruff gull suckbluff skull tuckstuffscuffsnuffscull* füll* püll© 2009 by Kathryn J. Davis 243Vowel Patterns

tux buzz us upflux fuzz bus cupcrux Gus puppusfussmusstruss© 2009 by Kathryn J. Davis 244Vowel Patterns

Alternate u soundūuniformūtulipmu sic musicu nit unitfu ton futontu lip tuliptu nic tunicpu pil pupilcu bic cubiccu pid cupidmu cus mucusru in ruindu el duelfu el fueldu et duetstu dent studenthu mid humid© 2009 by Kathryn J. Davis 245Vowel Patterns

üpush_ut_ull_ush_ud_ul_ug© 2009 by Kathryn J. Davis 246Vowel Patterns

üpush_ull _ush _ulpull bush awfulbull push lawfulfull ambush carefulbullet cushion playfulpulley bushy helpfulbullion pushy wonderfulbulletinbulldozer _ut _utchbullfrog put butcher_ud input _ugshpudding output sugar© 2009 by Kathryn J. Davis 247Vowel Patterns

üpushpush put awfulbush pudding carefulambush pull wonderfulbull pulley helpfulbullet full playfulshbulldozer cushion sugar© 2009 by Kathryn J. Davis 248Vowel Patterns

üpushPut it on the bed.Pull it off the bed.Put it in the box.Pull it out of the box.A bull can be big.A bull can be bad.A bull can run fast.Put the broom in the closet.Put the lid on the jar.Put the puppy in the yard.© 2009 by Kathryn J. Davis 249Vowel Patterns

üpushPush the pig into the pigpen.Pull the rope to ring the bell.The horse will pull the wagon up the hill.We will eat pudding for dessert tonight.Pudding is made with milk and sugar.Tom’s playful puppy hid in the bushes.Be careful when you cross that busy street.Yesterday was an awful day. I lost myhomework.But today has been a wonderful day !The outlaws ambushed the sheriff.Bullets flew everywhere.© 2009 by Kathryn J. Davis 250Vowel Patterns

eglueūecue_ue cue barbecue fonduedue continue fescueSue avenue rescuehue revenue issuerue argue tissuechblue statue residuechclue virtue subdueflue overdue valuegluesluetrueshsh© 2009 by Kathryn J. Davis 251Vowel Patterns

glueūecuegluecuebluehuetruevalueSuerescueduecluecontinuechstatuefondueshtissuerevenuebarbecueavenueargue© 2009 by Kathryn J. Davis 252Vowel Patterns

glueūecue1. Sue has a pretty blue dress.2. Jim will glue the shapes to the paper.3. Is that a true story ?4. This fingerprint is a clue.5. Do not argue with your mom and dad.6. We will continue our work after we eat.7. Please pay your dues by Friday.8. Your homework is due on Tuesday.9. Jake's house is on Pine Avenue.10. We went to see the Statue of Liberty.11. I will count the revenue from the sale.© 2009 by Kathryn J. Davis 253Vowel Patterns

fluteū_ecube_ube _uce _ude _uge_uke _ule _ume _une_upe _ure _use _ute© 2009 by Kathryn J. Davis 254Vowel Patterns

fluteū_ecube_une _ule _udetune mule rudeJune rule dudedune Yule nudeprune ovule prudeimmune ampule crudeattune module eludecommune nodule exudeNeptune tubule alludetribune molecule deludecapsuleattitudeinclude© 2009 by Kathryn J. Davis 255Vowel Patterns

fluteū_ecube_uke _ume _uceduke fume puceLuke flume trucefluke plume sprucerebuke costume produceconsumevolumereduceinduce assume * lettucedupehugelegumeresumedelugefuze© 2009 by Kathryn J. Davis 256Vowel Patterns

fluteū_ecube_ure _ute _usecure cute uselure mute fusepure jute musesure lute abusesecure flute amuseendure brute excusemanure acute reclusemature astute accuse* sure dilute confuse* figure salute obtuse* injure * minute refuse© 2009 by Kathryn J. Davis 257Vowel Patterns

fluteū_ecube muleflute mule capsulerude cure costumeJune use consumetube cute includeduke fuse produceplume pure confuserule huge moleculeprune fume secureLuke cube excusetunerefusetruce * minute volumespruce * fortune * surechsh© 2009 by Kathryn J. Davis 258Vowel Patterns

fluteū_emuleJune can play a pretty tune on the flute.The vet will cure the sick mule.Luke has a cute puppy.The duke has a red plume in his hat.What is the volume of this cube ?June has a huge dog.Always be sure to drink water that is pure.Does this math problem confuse you ?Luke was rude to his teacher.Our Christmas tree is a blue spruce.I refuse to argue with you.© 2009 by Kathryn J. Davis 259Vowel Patterns

uifruit_uit _uice _uisesuit juice cruisefruit sluice bruiserecruitpursuitlawsuitfruitfulsuitcasejuicynuisancesuitableswimsuit© 2009 by Kathryn J. Davis 260Vowel Patterns

uifruitfruit suit swimsuitcruise suitcase juicybruise lawsuit recruitjuice nuisance pursuit1. Fruit is a healthy snack.2. I bruised my leg when I bumped it.3. We will go on a cruise to Alaska.4. That barking dog is a nuisance.5. Do you want apple juice or orange juice ?6. I packed my swimsuit in my suitcase.7. This is a juicy apple.8. The police ran fast in pursuit of the robbers.© 2009 by Kathryn J. Davis 261Vowel Patterns

urpurse_ur _urr _urb _urf_urd _url _urn _urp_urse _urve _urt _urst© 2009 by Kathryn J. Davis 262Vowel Patterns

urpurse_ur _urn _urlbur turn curlcur burn furlfur urn hurlspur spurn purlslurblur_urvecurve_urthurt_urr _urp curtpurr burp spurtburr slurp blurt© 2009 by Kathryn J. Davis 263Vowel Patterns

urpurse_urf surf disturb Saturnturf survey turnipburlapburden_urb hurray murmurcurb purple occurblurb turtle Saturdaycurlyhamburger_urse burst furthernurse burnt hurrypurse curd surprisecurse lurk burglar© 2009 by Kathryn J. Davis 264Vowel Patterns

urpurseburnturtlefurpursehurtturncurbcurlynursepurplehurryslurpsurprisehurray© 2009 by Kathryn J. Davis 265Vowel Patterns

urpurseDogs and cats have fur to keep them warm.The campfire will burn for a long time.I have a surprise for you.Please hurry or we’ll be late.Soon it will be your turn.Beth wants to be a nurse.Park the car at the curb.Don’t hurt yourself.Jack found a turtle in his yard.Pam her purse.That little girl has brown curly hair.Those are pretty purple flowers.© 2009 by Kathryn J. Davis 266Vowel Patterns

wä_waspwant walk wanderwash wasp walnutwashing wallet waddlewater wad wafflewall wan wallowwaft walrus wandwampum watt wattleWalter wallaby WandaWaldo waltz * wagWashington wallop * wagon© 2009 by Kathryn J. Davis 267Vowel Patterns

wä_waspI want to walk to the park.I want to wash the car.I want to sit on the wall.I want to stay away from that wasp.I want to get a brown wallet.I want to swim in the water.I found a wad of gum under the desk.The ducks waddled down to the pond.Wanda likes to eat waffles.How long did the men wander in the desert ?Walter is washing the windows.I am looking for Waldo.© 2009 by Kathryn J. Davis 268Vowel Patterns

worwormworm worship worstwork worry workerword worse worthworld working worthy© 2009 by Kathryn J. Davis 269Vowel Patterns

worwormWe will work hard today.A robin likes to eat worms.Can you read this word ?Please don’t worry about me.The world is very big.This dish is worth a lot of money.My mother and father like to work in theyard.How many words can you read ?We will finish our workbook this week.Yesterday I felt bad, but today I feel worse.This storm is the worst one we ever had.© 2009 by Kathryn J. Davis 270Vowel Patterns

ymy_ymybystybuyguyspyskyslyflyply_ytryfrycrydrypryspryshywhythywry© 2009 © 2001 by by Kathryn J. Davis 271Vowel Patterns For BeginningVowelReadersPatterns

ymymy dry shyby spy tryfly fry crysky sty slyny lon nylonpy thon pythonsup ply supplyJu ly Julyre ply reply© 2009 by Kathryn J. Davis 272Vowel Patterns

ymyWe will sit in the grass by the tree.My dog got wet in the creek.I will dry him off.A robin can fly in the sky.Did that man spy on us?Jill will try on the red dress.We will go to camp in July.Dad will fry the fish.The sly fox hid in the trees.Tom is very shy.Did Ted cry after the dog bit him ?The pigs are in the pig sty.© 2009 by Kathryn J. Davis 273Vowel Patterns

ycandyhap py happySal ly SallyBet ty Bettyjel ly jellypen ny pennypret ty prettyTom my TommyBob by Bobbyhob by hobbyhol ly hollysil ly sillyfil ly fillyWil ly Willybun ny bunnyfun ny funnyyum my yummy© 2009 by Kathryn J. Davis 274Vowel Patterns

ycandycop y copybod y bodystud y studyver y verycan dy candypan try pantryBet sy Betsyplen ty plentytwen ty twentyemp ty emptyfif ty fiftysix ty sixty© 2009 by Kathryn J. Davis 275Vowel Patterns

ycandyba by babyla dy ladyta sty tastyru by rubydu ty dutytru ly trulyti ny tinyti dy tidywi ly wilyshi ny shinypo ny ponyho ly holyno sy nosy© 2009 by Kathryn J. Davis 276Vowel Patterns

ycandypar ty partydir ty dirtyev er y everydoi ly doilyfam il y familyno body nobodyevery body everybodysome body somebodyany body anybody* only * any* busy * many* bury© 2009 by Kathryn J. Davis 277Vowel Patterns

ycandyThat is a funny clown.Ed is happy if he can play basketball.Sally will start the car now.Tom has a brown pony.The baby will not sleep all night.That lady is pretty.A small bunny ran under the house.I had fun at the party.Bobby found a shiny penny in the street.We brush our teeth every day.We saw a tiny puppy at the pet shop.© 2009 by Kathryn J. Davis 278Vowel Patterns

ygymnasticsgym gypsy Lynngymnastics oxygen lynxmystery cymbal mythbicycle hymn symphonysystem symbol pyramidrhythm cylinder Egyptcyst lyrics onyxcynical nymph syntaxcygnet abyss synonymsyrup syringe gypsumtypical mystery physicalpygmy syllable symptomKathryn Jocelyn Marilyn© 2009 by Kathryn J. Davis 279Vowel Patterns

ygymnasticsWe go to the gym to exercise every day.The boys and girls learned to do cartwheelsin gymnastics.People must have oxygen to breathe.Brad rode his bicycle to school last week.A lynx is a wild cat with a short tail thatlives in North America.We heard beautiful music at the symphony.The children sang several hymns at churchlast Sunday.A pipe is a hollow cylinder.The great pyramids are in Egypt.Jocelyn likes to read mystery books.Kathryn enjoys listening to country music.© 2009 by Kathryn J. Davis 280Vowel Patterns

yeryerye dye lye good-byebye stye * aye * eyeEd will eat a ham sandwich on rye bread.Lisa will dye the cloth red.Long ago settlers used animal fat and lyefrom wood ashes to make soap.I have something in my eye.Our basketball team had a bye for the firstround.We were sorry to say good-bye to ourfriends.The members of the club all voted “aye.”© 2009 by Kathryn J. Davis 281Vowel Patterns

y_etype_yde_yke_yle_yne_ype_yre_yme_yze_yte© 2009 by Kathryn J. Davis 282Vowel Patterns

y_etype_yle _yre _ytestyle lyre kilobyteLyle byre megabyteKyle Tyre epiphyteargyle pyre neophyte_yme _yze rhyme analyze dynetthyme paralyze fykeenzyme dialyze Clydetype© 2009 by Kathryn J. Davis 283Vowel Patterns

y_etypetype rhyme styleClyde Kyle byrelyre Tyre fykeLyle analyze thymetargyle kilobyte megabytepyre electrolyte acolyteparalyze dialyze genotypeenzyme catalyze stereotypeepiphyte neophyte tintype© 2009 by Kathryn J. Davis 284Vowel Patterns

y_etypeKyle will type a letter.Lyle will go to school early today.Do you enjoy hearing nursery rhymes ?A byre is a barn for cows.A fyke is a fishnet in the shape of a long bag.There is a city in Lebanon called Tyre.Thyme is an herb used to season food.A lyre is a musical instrument like a smallharp.Sam bought a beautiful argyle sweater.Audrey’s clothes are always in style.We will analyze the data from the experiment.© 2009 by Kathryn J. Davis 285Vowel Patterns