drawings

freeplotting.com
  • No tags were found...

drawings

GENERAL REMODELGENERAL REMODELGENERAL REMODEL710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsRUSTON, LOUISIANASTORE NO.:0023-201GENERAL REMODELEXISTING SQ FT: 199,026DATE:02-02-11PROTO: 188 SUPERCENTERSTIPULATION FOR REUSE{DRAWING INDEX}{GROCERY ARCHITECTURAL} {MECHANICAL}{GENERAL}C1 COVER SHEETN1 GENERAL INFORMATION{ARCHITECTURAL}SP1 SITE PLANSP2 SITE DETAILSSP2.1 SITE BMP DETAILSD1 DEMOLITION PLAND1.1 FRONT GROCERY DEMOLITION PLAND1.2 REAR GROCERY DEMOLITION PLANA1 FLOOR PLANA1.1 FLOOR FINISH PLANA1.2 INTERIOR FINISH PLAN AND DETAILSA1.3 GROCERY INTERIOR FINISH PLAN AND DETAILSA2 EXTERIOR ELEVATIONSA2.1 SIGNAGE DETAILS, NOTES, AND SCHEDULESA3 SECTIONS AND DETAILSA4 ROOF PLANA5 ENLARGED VESTIBULE PLANS AND ELEVATIONSA5.1 REAR OFFICE PLANA5.2 {NOT USED}A5.3 RESTROOM PLANSA5.4 {NOT USED}A5.5 RESTROOM DETAILSA5.6 ENLARGED VESTIBULE ELEVATIONSA6 PARTITION TYPES AND WALL DETAILSA7 ROOM FINISH SCHEDULE AND DETAILSA8 DOOR SCHEDULEA8.1 DOOR DETAILSA9 CASEWORKAC1 AUTOCENTER PLANS AND DETAILSAC2 ENVIRONMENTAL CAGE PLANS AND DETAILSGC1 GARDEN CENTER PLANMC1 {NOT USED}RXPFC PAINT, FIX, CLEAN (PFC) PLAN AND DETAILSVCPFC PFC WMVC PLANWR1 {NOT USED}WR2 {NOT USED}GA1 FRONT GROCERY FLOOR PLANGA2 REAR GROCERY FLOOR PLANGA3 GROCERY SECTIONS AND DETAILS{STRUCTURAL}S1 PLAN GENERAL NOTES AND DETAILS{FIRE PROTECTION}FP1 FIRE SPRINKLER SITE PLANFP2 FIRE SPRINKLER REMODEL PIPING PLANFP3 FIRE SPRINKLER REMODEL PIPING PLANFP4 FIRE SPRINKLER REMODEL PIPING PLANFP5 FIRE SPRINKLER REMODEL PIPING PLANMP1 MECHANICAL AND PLUMBING PLANMP2 ROOF MECHANICAL PLANM1 ENLARGED MECHANICAL PLANSM2 MECHANICAL DETAILSM3 MECHANICAL SCHEDULESMAC1 AUTO CENTER MECHANICAL PLANSMAC2 AUTO CENTER MECHANICAL DETAILSMAC3 AST TANK VENT PIPE DETAILSMAC4 AUTO CENTER MECHANICAL RISERP1 ENLARGED PLUMBING PLANSP2 PLUMBING DETAILSP3 PLUMBING SCHEDULESP3.1 PLUMBING SCHEDULESGP1 FRONT PLUMBING PLANGP1.1 REAR PLUMBING PLAN{REFRIGERATION}{ELECTRICAL}{RACKING STRUCTURAL}FXS1 RACK AND SHELVING ANCHORAGE PLAN AND GENERAL NOTESFXS2 RACK AND SHELVING ANCHORAGE DETAILSSTORE NO.GENERAL REMODELJOB NUMBER:ISSUE BLOCKCHECKED BY:DRAWN BY:BUILDING CODE SUMMARY188/C010-CODEPROTO:188NAME OF PROJECT:RUSTON, LOUISIANAPROTO CYCLE:11-19-10STREET ADDRESS:1201 NORTH SERVICE ROAD EASTDOCUMENT DATE:02-09-11CODES:PROPOSED USE:BUILDING:FIRE:MECHANICAL:ELECTRICAL:PLUMBING:LIFE SAFETY:ACCESSIBILITY:RETAIL2006 INTERNATIONAL BUILDING CODE2006 INTERNATIONAL FIRE CODE2006 INTERNATIONAL MECHANICAL CODE2008 NEC2000 LA STATE PLUMBING CODE2009 NFPA 101ADAAG* EXTERIOR SURFACES: CLEAN, PREP AND PAINT* INTERIOR WALLS: CLEAN, PREP AND PAINT* PHARMACY: PAINT, FIX, AND CLEAN* GARDEN CENTER: REFURBISH AS NOTED* RESTROOMS: REFURBISH AS NOTED* VARIOUS OFFICES: REFURBISH* CUSTOMER SERVICE: REFURBISH* DOORS: REPAIR/REPLACE AS NOTED* FLOOR TILE: REPAIR/REPLACE AS NOTED* GROCERY: REMODEL, REPAIR/REPLACE EQUIPMENT AS NOTED* ENTRY VESTIBULE: REMODEL, REPLACE EQUIPMENT AS NOTED* ROOF: REPLACE EQUIPMENT AS NOTED* SIGNAGE: INSTALL AS NOTEDOCCUPANCY:M- MERCANTILETYPE OF CONSTRUCTION:ALLOWABLE AREA:FIRE PROTECTION:5B unprotected (SPRINKLERED)UNLIMITEDBUILDING IS EQUIPPED THROUGHOUT WITH AN AUTOMATIC SPRINKLER SYSTEM AND IS SURROUNDED ON ALL SIDES BY 60 FEET MINIMUM OF PERMANENT OPEN SPACE. UNLIMITED AREA CRITERIA IS APPLICABLE.SIGNAGESIGNAGEFURNISHEDPERMITTEDBY WALMART AND INSTALLEDSEPARATELYBY OTHERS. REF A2.1PRINTED: 8/4/2011 3:26 PM BY: Brenda Garrison LAST SAVED: 8/4/2011 2:10 PM BY: BRIANCARLTONe:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\c010.dwgNOT FORCONSTRUCTIONSHEET:


{KEYNOTES}SHEET NOTES:REMOVED NOTE 211. POWER WASH SIDEWALK AROUND THE ENTIRE PERIMETER OF BUILDING.2. REMOVE SEALANT AND BACKER MATERIAL FROM JOINT BETWEEN BUILDING AND SIDEWALK. FILL AND SEAL JOINTS, REF SPEC 07900.3. REPAINT PERIMETER SIDEWALK AND FIRE LANE CURB.4. NOT USED5. NOT USED6. NOT USED7. NOT USED{8. NOT USED}9. NOT USED10. RAISE ALL SITE SIGNS WITHIN CLOSE PROXIMITY TO STRUCTURE TO 7'-0" ABOVE GRADE.{}11. REPLACE ALL DAMAGED, MISSING, OR FADED SITE SIGNS WITHIN CLOSE PROXIMITY TO STRUCTURE.12. INSTALL ALL SITE SIGNS AT BUILDING SIDE OF DRIVE LANE IN BOLLARDS. REF 12-SP2.{13. NOT USED14. NOT USED}15. NOT USED16. NOT USED17. NOT USED{18. NOT USED}19. NOT USED20. NOT USED{21. NOT USED}{22. NOT USED23. NOT USED24. NOT USED25. REMOVE SEALANT AND BACKER MATERIALS FROM ALL BUILDING CONTROL AND EXPANSION JOINTS. FILL AND SEAL JOINTS. REF SPEC 07900}710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. Phillips35'-2" 38'-2" 34'-0" 33'-0" 48'-0" 48'-0" 48'-0" 48'-0" 48'-0" 48'-0" 48'-0" 48'-0" 48'-0" 34'-0"JOB NUMBER:51'-8"STORE NO.50'-8"STIPULATION FOR REUSEGENERAL REMODEL49'-6"ISSUE BLOCKARCHITECTURAL FINISH FLOOR = 100.00'%NOTE:FINISH FLOOR ELEVATION ATALL EXTERIOR DOORS = 100.00'UNLESS NOTED OTHERWISE40'-4"REFER TO SHEET SP2.1 AND SPEC SECTION 01500 FOR DETAILS AND REQUIREMENTS FOR STORMWATER POLLUTION CONTROLS AND SITE STORAGE OF MATERIALS AND EQUIPMENT. DEVIATION(S) FROM DETAILS SHOWN MUST BE SUBMITTED FOR APPROVAL IN ACCORDANCE WITH SPEC SECTION 01330.41'-4"CHECKED BY:DRAWN BY:PROTO:1886'-0"FV5'-0"8'-8"5'-0"58'-8"PROTO CYCLE:DOCUMENT DATE:11-19-1002-09-11NEW RAMPREF 9-SP2 SIMFV56'-2"6'-0"6'-0"FV41'-4"EXISTING PLANTER BOX AREAAND INNER SIDEWALK TO REMAIN10'-2"FV10'-0"FV10'-2"FV10'-0"FVPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:09 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\sp010.dwg14'-11{}"FV6'-0"(FV)19'-9"2 EQUALSPACES(FV)9'-6"5'-0"(FV)NEW RAMPREF 9-SP25'-0"(FV)105'-9"9 EQUAL SPACES13'-0"9'-4{}"13'-8"8'-6{}"FVFVFVFV49'-7{}"4 EQUAL SPACES(FV)28'-3{}"2 EQUALSPACES(FV)7 EQUAL SPACES(FV)67'-8"3'-11"FV14'-11"FV134'-6{}"14 EQUAL SPACES(FV)REPLACE EXISTING CURB AT PERIMETER OF BUILDING WHERE SIDEWALK MEETS EXISTING CMU WALL REF 11-SP213'-8"FV13'-4"9'-4{}"FVFV7 EQUAL SPACES(FV)67'-8"4'-0"FV13'-8"14'-7{}"32'-2{}"3 EQUAL SPACES(FV)60'-0"6 EQUAL SPACES6'-0"FV56'-4{}"18'-0"2 EQUALSPACES(FV)9 EQUAL SPACES(FV)15'-0"51'-0"NOT FORCONSTRUCTIONSHEET:


SINKREMOVE EYEWASH REF MEPSDSDUPC/INVOICINGSD SD SD VDRELOCATE EXISTING REFRIGERATORREMOVE CABINETRY IN ITS ENTIRETYREMOVE SINK REF MEPTRAININGPHOTO STORAGECBLAP MONITORMANAGERS OFFICEASSOCIATE WOMENFIXTURESCORRIDORMANAGEMENTAP OFFICECUSTOMER MEN{1. GC TO REMOVE ANY INTERIOR TENANT SIGNAGE ORORNAMENTATION INSTALLED ON THE FRONT OR SIDE TENANTBULKHEADS. WALMART OWNED TENANT SIGNS ANDORNAMENTS ARE TO BE RETURNED TO THE STORE MANAGER.NON-WALMART OWNED TENANT SIGNS AND ORNAMENTS ARETO BE RETURNED TO THE TENANT.2. GC TO REMOVE ALL EXTERIOR BUILDING MOUNTEDSIGNAGE, LIT AND UNLIT. COORDINATE REMOVAL OFEXTERIOR TENANT SIGNAGE WITH CM AND TENANT PRIOR TOREMOVAL. GC WILL REMOVE ALL EXTERIOR TENANT SIGNAGEAND DELIVER TO TENANT. PATCH AND REPAIR EXTERIOR WALLSURFACES, DAMAGED OR EXPOSED DUE TO SIGNAGEREMOVAL, TO MATCH ADJACENT AS REQUIRED.3. COORDINATE EXTERIOR LIT SIGNAGE REMOVAL WITHWALMART CM. EXTERIOR LIT SIGNS CANNOT BE REMOVEDWITHOUT WALMART CM APPROVAL. DISPOSE OF EXISTINGFLUORESCENT LAMPS AND BALLASTS IN ACCORDANCE WITHSPEC SECTION 01743 PRIOR TO PLACING SIGN(S) IN WASTEMANAGEMENT CONTAINER.4. UNLIT EXTERIOR SIGNAGE MAY BE REMOVED WITHOUTPRIOR APPROVAL.5. NOT USED.6. NOT USED.7. SALES FLOOR TO BE ACCESSIBLE TO CUSTOMERS DURINGNON-CONSTRUCTION HOURS. PROVIDE TEMPORARY COVERSCAPABLE OF WITHSTANDING SHOPPING CART TRAFFIC ANDOCCUPANTS FOR PITS AND TUNNELS, REMOVECONSTRUCTION FENCING AND DUST WALLS INTERFERINGWITH CUSTOMER CIRCULATION OR ACCESS.8. NOT USED.}STIPULATION FOR REUSE710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSITE TO STOREBREAKROOMCUSTOMER WOMENDEMOLITION LEGENDEXISTING TO REMAINASSOCIATE MENDEMOLISH/REMOVEAREA TO BE DEMOLISHEDRELOCATEGENERAL REMODELNOTE:THE GENERAL CONTRACTOR SHALLREPAIR/REPLACE ANY DAMAGED FLOORTILE DUE TO INSTALLATION OR REMOVALCONTINUOUS SEALANTSTORE NO.CORRIDOR2x WOOD PLATE1/2" C/D EXT. PLYWOOD SCREWED TO STUDS OVER 6 MIL CLEAR POLY SHEETSEXISTING WALL TO REMAIN3'-0"MIN.PHARMACY STORAGEBALERDEPARTMENT MANAGERS WORKSTATIONELECTRICAL ROOM-1FIRE CORRIDORUPC/INVOICINGFIRE CORRIDORSPRINKLERSECURITY ROOMCLAIMSMANAGEMENTFIXTURESMANAGERS OFFICEAP MONITORPHOTO STORAGETRAININGFIRE CORRIDORFIXTURE STORAGEMARKET MANAGERS OFFICEDELI FREEZERDELI COOLERHALLWAYDELI PREPDEPT. 82ISSUE BLOCKJOB NUMBER:RECEIVING-GMSTOCKROOMCOMPACTORSTOCKROOMCBLDAIRY COOLERSERVICE DELI{SALES}2x4 STUDS @ 24" OC (TYPICAL)CONTINUOUS SEALANT BOTH SIDES OF SILL PLATEEXISTING OPENING{DEMO AREA}TIRE AND BATTERY STORAGECUSTOMER SERVICETOILETSTORAGEREMOVE DOORS SHOWN DASHED. FRAMES TO REMAIN UNO ON DOOR SCHEDULE OR PLANBREAKROOMSITE TO STOREASSOCIATE WOMENASSOCIATE MENJANITORCUSTOMER MENAP OFFICECUSTOMER WOMENGROCERY SALESCOMPACTORRECEIVING-GRFIRE CORRIDORSTOCKROOMGROCERY FREEZERCHECKED BY:2x4 TREATED WOOD SILL PLATE2'-0" MAXLUBE AND TIRE MOUNTING AREAELECTRICAL ROOM-4SECURITYREMOVE CARPETING AND ADHESIVE FROM COLUMNSELECTRICAL ROOM-5DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11REMOVE EYEWASH REF MEPWET DEVELOPING EQUIPMENT TO BE REMOVED BY EQUIPMENT VENDORSILVER RECOVERY UNIT TO BE REMOVED BY OTHERS. GC TO CAP EXISTING DRAIN/CONNECTION AS REQUIREDSALESREMOVE ALL WALL STANDARDS ABOVE 96" AFF ON SALES FLOORMEAT COOLERMEAT PREPROOF DECKREMOVE EXISTING RAMPAND PORTION OFEXISTING CONCRETE. REFWATER FILTRATION SYSTEM TO BE REMOVED BY OTHERS. GC TO DISCONNECT WATER LINE TO WATER FILTRATION SYSTEM AND MAINTAIN CONNECTION OF WATER LINE TO SINKPHOTO LABMEAT HOLDINGGROCERY COOLERCONTINUE PLYWOOD TO DECKDO NOT USE DUSTWALL TO SHORE ROOF JOISTSICE CREAM FREEZERSEAFOOD COOLERWALL TO BE REMOVEDSEASONAL SHOPGROCERY SALESSEAFOOD FREEZERSEAFOODPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:09 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\d010.dwg1/2" CD PLYWOOD 4'-0"X8'-0" HORIZONTAL PROVIDE 2x4 NAILER AT ALL JOINTSINSTALL CONTINUOUS LAYER 6 MIL POLY SHEETS TAPE ALL JOINTS2x4 AT 24" OCSALESSEALANT UNDER BOTTOM PLATE6'-0" LOAD BEARING4'-0" ELSEWHEREDEMO AREANOTES:1. INSTALL TEMPORARY WALL IN SECTIONS APPROX 40'-0" PER DAY (COORDINATE WITH STORE MANAGER AND WALMART CONSTRUCTION MANAGER)2. LOCATE VERTICAL 2x4'S AS NOT TO INTERFERE WITH CEILING GRID OR LIGHT FIXTURES3. LOCATE HORIZONTAL 2x4 AT 2" ABOVE CEILING EXCEPT LIGHT FIXTURE LOCATIONS4. SCREW PLYWOOD (MAX SPACING 12" OC)CONTINUOUS SEALANTAGAINST PLATEANCHOR AT 24" OC COORDINATE W/SPECIFICATION SECTION 01500.REMOVE EXISTING SODA MACHINESGARDEN CENTERREMOVE AQUARIUM WALLREPLACE COUNTERS IN THEIR ENTIRETYREPLACE COUNTERTOP EXISTING CABINETRY TO REMAINCART STORAGE - GMELECTRICALROOM-3OTHER INCOME - GMVESTIBULE - GMREMOVE EXISTING CARPET TILE. REPLACE WITH WALMART SUPPLIED CARPET TILEREMOVE EXISTING ICE MACHINEEXISTING ICE MACHINE TO REMAINVISION CENTERWOODFOREST NATIONAL BANKVESTIBULE - GRREMOVE EQUIPMENT STORE MANAGER TO COORDINATE REMOVAL WITH VENDOR IF NOT WALMART OWNEDREMOVE EQUIPMENT STORE MANAGER TO COORDINATE REMOVAL WITH VENDOR IF NOT WALMART OWNEDREMOVE EXISTING CURB AS SHOWN DASHED REF SP1 FOR EXTENT OF WORKREMOVE EXISTING RAMP REF SP1 FOR EXTENT OF WORK REMOVE EXISTING CONCRETE, AND DETECTABLE WARNING AS SHOWN. REF SP1 FOR EXTENT OF WORKEXISTING BOLLARDS TO REMAIN, TYPREMOVE EXISTING CONCRETE AND DETECTABLE WARNING AS SHOWN. REF SP1 FOR EXTENT OF WORKDEMOLITION INCLUDES BUT IS NOT LIMITED TO ITEMS SHOWN DASHED REF DEMOLITION REQUIREMENTS NOTES ON N1 SHEETEXISTING BOLLARDS TO REMAIN, TYP.FIRE CORRIDORCOUNTCASHMONEY CENTERREGAL NAILSREMOVE EXISTING CAPRET TILE. REPLACE WITH WALMART SUPPLIED CARPET TILECUSTOMER WOMENJANITORCUSTOMER MENPICTURE MESMART STYLEFLORALCAKE DECORATINGRLCART STORAGE - GRELECTRICALROOM-2OTHER INCOME - GRBAKERYPLUMBING/ MECHANICALPRODUCE PREPPRODUCE COOLERBAKERY COOLERBAKERY FREEZERNOT FORCONSTRUCTIONSHEET:


DEMOLITION LEGENDEXISTING TO REMAINDEMOLISH/REMOVEAREA TO BE DEMOLISHEDRELOCATEDEMOLITION INCLUDES BUT IS NOT LIMITED TO ITEMS SHOWN DASHED REF DEMOLITION REQUIREMENTS NOTES ON N1 SHEET710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSTIPULATION FOR REUSEEXISTING M/D FRESH MEAT CASESMEAT HOLDINGGENERAL REMODELEXISTING COFFINCASE TO REMAINSTORE NO.EXISTING REFRIGERATED CASESGROCERY COOLERJOB NUMBER:EXISTING REFRIGERATED CASESEXISTING REFRIGERATED CASESEXISTING M/D FRESH MEAT CASESICE CREAM FREEZERSTOCKROOMISSUE BLOCKEXISTING REFRIGERATED CASESSEAFOOD COOLERSEAFOOD FREEZEREXISTING PRODUCE CASESREMOVE DOORSSHOWN DASHED.FRAMES TO REMAINUNO ON DOORSCHEDULE OR PLANEXISTING REACH-IN FREEZERS TO REMAINSEAFOODCHECKED BY:DRAWN BY:GROCERYSALESEXISTING M/D SEAFOOD CASE TO REMAINPROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11PRODUCE PREPEXISTING CULLIGAN WATER DISPENSERPASTRY CASES TO REMAINEXISTING REACH-IN FREEZER TO REMAINEXISTING CAKE CASES TO REMAINPRODUCE COOLERCAKE DECORATINGBAKERYBAKERY COOLERPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:09 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\d011.dwgDINNING AREASERVICE AREARLCOOLERFREEZERUTILITYEXISTING THERMOGLAZER TO REMAINBAKERY OVENS TO REMAINPROOFER TO REMAINEXISTING ICING TABLE TO REMAINRACK WASHER TO REMAINPLUMBING/ MECHANICALBAKERY FREEZERNOT FORCONSTRUCTIONSHEET:


DEMOLITION LEGENDEXISTING TO REMAINREMOVE EXISTING WASTE COOKINGOIL TANKS. AFTER REMOVINGWASTE OIL PIPING, REPAIR ANDSEAL MORTAR JOINTS AND SEALFROM WATER PENETRATIONDEMOLISH/REMOVEAREA TO BE DEMOLISHEDRELOCATEDEMOLITION INCLUDES BUT IS NOT LIMITED TO ITEMS SHOWN DASHED REF DEMOLITION REQUIREMENTS NOTES ON N1 SHEET710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsBALERMARKET MANAGERS OFFICEDELI FREEZERDELI PREPDEPT. 82STIPULATION FOR REUSE51'-0"GROCERY FREEZERISSUE BLOCKCHECKED BY:DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:STORE NO.GENERAL REMODELJOB NUMBER:18811-19-1002-09-11PRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:09 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\d012.dwgDAIRY COOLERHALLWAYEXISTING VENT HOOD TO REMAINDELI COOLEREXISTING COFFIN CASES TO REMAINSERVICE DELIEXISTING M/D DAIRY/DELI CASES TO REMAINEXISTING M/D FRESH MEAT CASES TO REMAINMEAT COOLERMEAT PREPRECEIVING-GREXISTINGCOFFIN CASES TOREMAINEXISTING M/D BEER CASESGROCERYSALESEXISTING M/D DAIRY CASESCOORDINATE REMOVAL AND DISPOSALOF EXISTING REFRIGERATED CASES AND FIXTURESWITH WALMART CONSTRUCTIONAND STORE MANAGERS.REMOVE DOORS SHOWN DASHED. FRAMES TO REMAIN UNO ON DOOR SCHEDULE OR PLANEXISTING DAIRY CASES TO REMAINDELIFRYER AND ROTISSERIE TOREMAINREPLACE CEILING GRIDAND TILE 4'-0" FROMEXHAUST HOODEXISTING COFFIN CASE TO REMAINEXISTING CASETO REMAINEXISTING COFFIN CASE TO REMAINEXISTING CASES TO REMAINEXISTING CASES TO REMAINEXISTING M/D DAIRY/DELI CASES TO REMAINEXISTING DELI HOT CASE TO REMAINREMOVEEYEWASHFIRE CORRIDORSTOCKROOMELECTRICAL ROOM-5NOT FORCONSTRUCTIONSHEET:


REDBOX(TYP AT HALF-GONDOLAS)OMIT PAINT AS INDICATEDPAINT AS INDICATED1'-0"DRY MERCHANDISE SHELVING SHOWN DASHED FOR CLARITY.1'-0"AT ALL PERIMETER HALF-GONDOLAS EXTEND PAINT BEYOND VERTICAL EDGE OF END GONDOLAS.WAINSCOT AS INDICATED. ON EXPOSED WALLS WHERE WAINSCOT IS NOT TO BE INSTALLED, CONTINUE PAINT TO FINISH FLOOR.PAINT DOORP102PAINT FRAME P102RESTROOM SIDEPAINT FRAME P16 OPPOSITE SIDE{RESTROOM}PAINT DOORP16{ALCOVE, SALES OR CUSTOMER SERVICE}TO DECKMATCH WALL COLOR{ANY SALES FLOOR COLUMN WHICH FALLS WITHIN 2'-0" OF A PERIMETER WALL}7'-0"TO DECK{NON PERIMETERGM SALES FLOOR COLUMNS}TO DECK7'-0"{NON-PERIMETERGROCERY COLUMNS}STIPULATION FOR REUSE710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSPRINKLERPHOTO STORAGERECEIVING-GMPHARMACY STORAGESTOCKROOMFIRE CORRIDORELECTRICAL ROOM #1STOCKROOMCLAIMSJANITORSECURITY ROOMSITE TO STOREFIRE CORRIDORUPC/INVOICINGTRAININGBREAKROOMASSOCIATEMENBREAKROOMASSOCIATEWOMENFIXTURESAP OFFICECUSTOMERWOMENCORRIDORCUSTOMERMENMANAGER'S OFFICEMANAGEMENTSTORE NO.GENERAL REMODELTIRE AND BATTERY STORAGECUSTOMER SERVICEISSUE BLOCKJOB NUMBER:LUBE & TIRE MOUNTING AREASTORAGECOLUMN PAINTTO MATCH SALES WALLPAINT STRUCTURE AS INDICATED ON DETAILS 2-A1.2 AND 3-A1.2ALL HM DOORS AND FRAMES LOCATED IN PAINTED WALLS TO BE PAINTED SAME AS WALL COLOR. DOORS IN WALLS WITH WAINSCOT SHALL BE PAINTEDCOLORS SHOWN IN GROCERY FOR BULKHEAD ONLY. REFER TO A1.3 FOR WALL FINISHESCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11SALESGROCERY SALESPAINT GIRDER OR JOIST DIRECTLY ADJACENT TO WALL TO MATCH. COLOR AS INDICATEDPAINT COLUMN TO MATCH ADJACENT WALL AS INDICATEDSEASONAL SHOPMONEYCENTERPHARMACYPAINT HVAC GRILLS TO MATCH ADJACENT WALLPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:09 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a012.dwgPAINT CMU FROM FINISH FLOOR TO DECK AS SCHEDULEDFLOOR FINISH AS SCHEDULEDGARDEN CENTERGM CART STORAGE GMELECTRICAL ROOM-3WAL-WMGREETOTHER INCOME-GMVESTIBULE-GMREFLECTED SOFFIT PLANVISION CENTERCOURTESYDESKCASHCOUNTCUSTOMERWOMENFIRE CORRIDORPICTUREMEALL HM DOORS AND FRAMES LOCATED IN VISION CENTER TO BE PAINTED P40CUSTOMERMENREGAL NAILSSMART STYLEREFLECTED SOFFIT PLANWOODFORESTNATIONALBANKFLORALVESTIBULE-GRWAL- WMGREETRB PANELGR CART STORAGE-GRELECTRICAL ROOM-2OTHER INCOME-GRNOT FORCONSTRUCTIONSHEET:


1'-0"2'-0"4'-10{}"4'-6{}"4'-10{}"{NEW SIGNREF 5-A2.1}{NEW SIGNSREF 7-A2.1}{NEW SIGNSREF 6-A2.1}REF SPECIFICATIONSSHEET NOTES:REMOVE SHEET NOTE 3ADDED NOTE 171. DOOR HOODS, STEEL DOORS AND FRAMES, EXPOSEDMETAL FLASHING, HANDRAILS, GAS LINES, AND EXPOSEDMISCELLANEOUS STEEL SHALL MATCH ADJACENT BUILDINGCOLOR UNO. IF THERE ARE TWO COLORS AT WALL ADJACENTTO DOOR AND FRAME. USE BOTTOM COLOR FOR ENTIREDOOR AND FRAME.2. REPAIR GUTTERS AND DOWNSPOUTS. REPLACE MISSINGSECTION(S) WITH LIKE MATERIAL. PAINT TO MATCH ADJACENTWALL COLOR.3. NOT USED.4. POWER WASH 100% OF EXTERIOR WALLS PRIOR TOPAINTING.5. PAINT ENTIRE EXTERIOR OF BUILDING.6. NOT USED.7. PAINT JIB CRANE - P36 ON JIB BOOM, P5 ON HANDRAILS.8. NOT USED.9. PAINT GARDEN CENTER STEEL DOORS AND FRAMES TOMATCH ADJACENT BUILDING WALL. IF THERE ARE TWOCOLORS AT ADJACENT WALL, USE BOTTOM COLOR FORENTIRE DOOR AND FRAME.10. PAINT SPRINKLER VALVES P4. DO NOT PAINT OVER SIGHTGLASS.11. DO NOT PAINT OVER FIRE ALARM BELL.12. PAINT ALL EXTERIOR BOLLARDS TO MATCH EXISTINGCOLOR UNLESS NOTED TO RECEIVE PLASTIC BOLLARDSLEEVE.13. PAINT SECURITY WALL PACK HOUSINGS TO MATCHADJACENT WALL.14. CLEAN SECURITY WALL PACKS. REMOVE PAINTOVERSPRAY FROM LENSES.15. REMOVE ALL BRANDED SIGNAGE AND TLE OIL SIGNAGEPRIOR TO PAINTING.16. CLEAN ALL SIGNS THAT ARE EXISTING TO REMAIN.17. CLEAN EXISTING FACTORY SECTIONAL OVERHEADDOORS AT CART STORAGE.STIPULATION FOR REUSE710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. Phillips4'-6{}"4'-10{}"ELEVATIONS APPROVED BY WALMART BRANDING ON 08/30/10CAP (TYP)CAP (TYP)STORE NO.GENERAL REMODELGARDEN CENTER FENCE SHOWN DASHED FOR CLARITYJOB NUMBER:ISSUE BLOCKPAINT STAIRSAND RAILINGCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11PRINTED: 8/4/2011 3:28 PM BY: Brenda Garrison LAST SAVED: 8/3/2011 4:00 PM BY: BRIANCARLTONe:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a020.dwg19'-7"GARDEN CENTER FENCE SHOWN DASHED FOR CLARITYNEW SIGNREF 4-A2.14'-7{}"TENANTSIGNAGEHATCH AREA INDICATES RESURFACED EXISTING EIFS. REF SPEC SECTION 7240 HATCH AREA INDICATES RESURFACED EXISTING EIFS. REF SPEC SECTION 724064'-5{}"10'-0"4'-6{}"4'-8{}"23'-10"MONEW SIGNREF 2-A2.126'-0"4'-5"NEW SIGNREF 1-A2.14'-6{}"25'-0"NEW SIGNREF 3-A2.123'-10"MO10'-0"TENANTSIGNAGENOT FORCONSTRUCTIONSHEET:


{KEYNOTES}KEYNOTES:REVISED KEYNOTE 6.24710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsJOB NUMBER:STORE NO.GENERAL REMODELSTIPULATION FOR REUSEISSUE BLOCKCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11OPEN TO CART STORAGEOPENTOOTHERPRINTED: 8/4/2011 3:28 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:11 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a056.dwgOPENTOOTHEROPEN TO CART STORAGENOT FORCONSTRUCTIONSHEET:


REFERENCE SIDEOPPOSITE SIDE1.NOT USED.METAL STUDS5/8" GYPSUM BOARDUSE 5/8" WATER RESISTANT GYPSUM BOARD AT WET AREAS UNO2.3.4.5.6.7.USE 1/2" GYPSUM BOARD ON NON-RATED PARTITIONS UNO.USE 5/8" TYPE X GYPSUM BOARD ON FIRE RATED PARTITIONS.REF ROOM FINISH SCHEDULE FOR ROOMS THAT RECEIVE FRP.CONTINUE FINISH MATERIAL TO A MINIMUM OF 4" ABOVE SUSPENDED CEILING SYSTEMS UNO.REF PARTITION KEY SYMBOL FOR STUD THICKNESSES.WHERE NO CEILING IS INDICATED CONTINUE FINISH TO DECK UNO. MAINTAIN CLEARANCE BELOW STRUCTURE PER CAPTURE TRACK DETAILS710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. Phillips8.C\a060-ptY9.10.11.STUD PARTITIONS REQUIRING A FIRE RATING OF ONE HOUR SHALL COMPLY WITH UL#U465 OR UL #U442. MASONRY PARTITIONS REQUIRING ONE HOUR FIRE RATING SHALL COMPLY WITH UL#U905.STUD WALLS RECEIVING PLYWOOD SHALL BE 22 GAUGE OR HEAVIER.MAXIMUM HEIGHT OF NON LOAD BEARING WALL ABOVE HEADER TO BE 20'-0".{REF SPECIFICATIONS FOR LATERAL BRACING OF STUD PARTITIONS.}STIPULATION FOR REUSE12.NOT USED.13.USE GYPSUM BOARD BEHIND ALL FRP BOARD UNO.14.WHERE NO CEILING IS SCHEDULED, STOP 1/2" PLYWOOD SUBSTRATE AT 10'-0" AFF.15.PROVIDE FIRE BLOCKING AT FLOOR AND ROOF LEVELS, CONCEALED SPACES BETWEEN STAIRWAY STRINGERS, PENETRATIONS IN FLOOR/CEILING ASSEMBLIES AND OTHER LOCATIONS AS REQUIRED BY CODE.16.ROOMS THAT HAVE 5/8" IMPACT RESISTANT GYP BD TO 48" AFF NEED 5/8" GYP BD ABOVE 48" AFF. REF A7 FOR LOCATIONS.17. NOT USED.DETAIL:GENERAL REMODELPLAN:LETTER INDICATES PARTITIONTYPEREF PLANS AND SHEET A6REFERENCE SIDEOPPOSITE SIDE1 - 1 5/8" METAL2 - 2 1/2" METAL3 - 3 5/8" METALNUMBER INDICATES STUDHEIGHTNO NUMBER INDICATESSTUD HEIGHT TO BOTTOMOF ROOF DECK TYPNUMBER INDICATES STUD SIZE AS FOLLOWS:6 - 6" METAL8 - 8" CMU12 - 12" CMU1 HOUR RATED GYPSUM BOARD (NEW) UL#U442OR U465,1 HOUR RATED CMU (NEW) UL#U905STORE NO.JOB NUMBER:NON-RATED GYPSUM BOARD WALL (NEW)ACOUSTICAL INSULATION FULL WALL THICKNESS (NEW)CHAIN LINK FENCE (NEW)COOLER/FREEZER WALL (NEW)INDICATES (NEW) 48" HIGH PLASTIC LAMINATE WAINSCOT OR PROTECTIVE SURFACE WAINSCOT UNO.INDICATES (NEW) 48" HIGH PLYWOOD WAINSCOT WITH 2x8 WOOD BASE AND DB5 BASE UNOISSUE BLOCKEXISTING 1 HOUR RATED GYPSUM BOARD TO REMAINEXISTING PARTITION OR WALL TO REMAINCMU WALL (NEW)EXISTING WALL TO BE DEMOLISHEDCHAIR RAIL FURNISHED BY WALMART, INSTALLED BY G.C.NON-RATED GYPSUM BOARD WALL (NEW) (GROCERY PREP AREAS) WITH SILL SEALERCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11{INTERIOR NON-LOAD BEARING PARTITION HEADER SCHEDULE}HEADER LENGTH2' TO 6'6' TO 8'8' TO 10'10' TO 12'12' TO 14'14' TO 16'16' TO 18'18' TO 26'HEADER MEMBERS(2) 6" x 18 GAUGE(2) 6" x 16 GAUGE(2) 6" x 14 GAUGE(2) 8" x 18 GAUGE(2) 8" x 16 GAUGE(2) 8" x 14 GAUGE(2) 10" x 14 GAUGE(2) 12" x 16 GAUGEMINIMUM EFFECTIVE PROPERTIES PER STUDIx = 2.042 Sx = 0.670Ix = 2.518 Sx = 0.839Ix = 3.094 Sx = 1.031Ix = 4.134 Sx = 1.033Ix = 5.110 Sx = 1.277Ix = 6.303 Sx = 1.576Ix = 12.325 Sx = 2.456Ix = 15.730 Sx = 2.334DOUBLE MTL STUD AT JAMBSMETAL STUDPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:11 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a060.dwgBOX BEAMPC 18 GA TRACK{SECTION B}BOTTOM TRACKTOP TRACK2 STUD HEADERSFINISH AS INDICATEDBOTTOM TRACKVARIES{SECTION A}METAL STUD HEADERPC 18 GA TRACK WITH (3) #10 TEKSCREWS EACH SIDE TO HEADER AND (6) #10 TEK SCREWS TOJAMBMETAL STUD JAMBNOT FORCONSTRUCTIONSHEET:


SCHEDULE NOTES:1. CLEAN JOISTS, JOIST GIRDERS, DECKING, LIGHTS, CONDUIT, HVAC GRILLES, SPRINKLER PIPES AND SECURITY GLOBES (IFEXISTING).2. CLEAN CEILING TILES, GRID, AIR GRILLES/DIFFUSERS, SECURITY GLOBES, SPRINKLER HEADS AND LIGHT LENSES. REPLACEANY DAMAGED ITEMS.3. CLEAN CEILING GRID, AIR GRILLE/DIFFUSERS, SECURITY GLOBES, SPRINKLER HEADS, AND LIGHT LENSES. REPLACE ANYDAMAGED ITEMS.4. CLEAN WINDOWS. REMOVE EXISTING PAINT AND DIRT FROM GLASS.5. CLEAN EXISTING RESTROOMS.6. CLEAN CERAMIC TILE.7. CLEAN KALWALL.8. CLEAN AIR DOOR AND GRATE.9. REMOVE CARPETING. INSTALL LAMINATE, DB10, BLACK PLASTIC CORNERS TO 58" AFF TO GYP BD WRAPPED COLUMNS. REF4-A1.210. PAINT ALL EXPOSED COLUMNS. USE EPOXY PAINT TO 7'-0" AFF AND LATEX PAINT ABOVE. REF 3-A1.2 FOR LOCATIONS.11. SEAL BASE OF ALL COLUMNS ON VCT TILE W/WHITE SEALANT AND ON PVC PLANK FLOORING W/BROWN SEALANT..12. REINSTALL ALL FIRE EXTINGUISHERS IMMEDIATELY AFTER REMOVING THE CARPETING AND REPAINTING COLUMNS AND ATALL OTHER LOCATIONS.13. INSTALL MISSING COLUMN TRIM AT CEILING.14. REMOVE ALL SECTIONS OF WALL STANDARDS. PAINT WALLS AFTER REMOVAL.15. REPLACE CEILING TILE AT SALES FLOOR TO 50' AS INDICATED ON 1-A1.16. PAINT GYPSUM BOARD WALLS TO 6" BEHIND TOP AND SIDES OF FIXTURE CASES17. REPLACE DAMAGED PIECES OF EXISTING CERAMIC TILE FROM FLOOR TO CEILING. GROUT TO MATCH ADJACENT.18. REMOVE ALL WALL COVERINGS, PREP AND TEXTURE WALLS WITH TEXTURED FINISH AS SPECIFIED.19. WALLS TO RECEIVE MEDIUM KNOCK-DOWN TEXTURE. FINISH TEXTURE WITH FINAL COAT OF PAINT.20. PAINT PRODUCE PREP HALLWAY UP TO DECK P40. INSTALL 2X8 WOOD BASE W/CHAMFERED TOP AND DB5.21. REPLACE DAMAGED FRP PANELS.22. INSTALL PLASTIC LAMINATE WAINSCOT WITH EDGE TRIM AT ALL EXPOSED EDGES AS INDICATED ON PLANS. DO NOT INSTALLON BLOCK WALLS.23. INSTALL 1/2" PLYWOOD WAINSCOT WITH TOP EDGE ROUNDED OFF 48" BEHIND 2X8 WOOD BASE AT GYPSUM WALLS ONLYWHERE INDICATED ON PLANS. REF 2-A3.24. INSTALL 1/2" PLYWOOD WAINSCOT WITH TOP EDGE ROUNDED OFF 48" ON WALLS ONLY WHERE INDICATED ON PLANS. PAINTPLYWOOD TO MATCH WALL ABOVE. DO NOT PAINT CURB.25. REPAIR GYP BD CEILING. CLEAN LIGHTS, HVAC GRILLES, SPRINKLER HEADS AND REPAIR ANY DAMAGED ITEMS.26. REPAINT CEILING GRID IN SALES AREA.27. REPLACE DAMAGED/DISCOLORED CEILING TILES TO MATCH EXISTING.28. CEILING TILES TO HAVE HOLD DOWN CLIPS REF SPECS29. IN AREA OF REMOVED SMOKERS BREAKROOM, RE-LAYOUT CEILING GRID TO LINE UP WITH CEILING GRID OF BREAKROOM.30. PAINT EXPOSED HVAC DUCT WORK AND PLENUMS P33.31. WHERE UNPAINTED ROOF STRUCTURE, DECK, CONDUIT, AND FIRE SPRINKLER PIPING (FIRE SPRINKLER HEADS TO REMAINUNPAINTED) HAVE BEEN EXPOSED IN SALES AND/OR GROCERY SALES AREA BY OTHER PORTIONS OF THE OVERALL SCOPE OFWORK, PAINT TO MATCH EXISTING ITEMS OF SAME TYPE32. INSTALL ACCESS DOOR AND FRAME IN HARD CEILING33. PAINT ALL AIR DIFFUSERS34. REPAIR FLOORING TO MATCH ADJACENT35. CAULK BASE AT WALL AND FLOOR36. REPAIR EXISTING COVE BASE37. REFER TO SHEET GA2 FOR COVE BASE INSTALLATION DETAILS38. REMOVE ADJUSTABLE COUNTER SUPPORTS AND INSTALL PIPE SUPPORTS. REF 2-A939. AT MAIN JANITOR CLOSET EXTEND PLYWOOD TO 8'-0" AND PROVIDE 8'-0" FRP1 PANEL ON ALL WALL(S).40. INSTALL NEW CART RAIL(S). LOCATION TO BE DETERMINED BY FINAL MERCHANDISE PLAN.41. REPLACE DAMAGED SLIDING GLASS AND HARDWARE ON WALL OPENING PASS-THRU.42. RE-LAMINATE SILL(S) AT WINDOW LOCATIONS WITH PL20.43. PROVIDE 8'-0" FRP1 PANEL ON ALL GYP WALL(S).44. CAULK ALL MIRRORS, SINKS, AND TOILETS.45. PROPERLY SEAL ALL NEW PENETRATIONS IN EXISTING FIREWALLS TO MAINTAIN FIRE RATING.46. CLEAN METAL SOFFIT PANELS.47. CONTRACTOR TO REMOVE EXISTING DOOR, FRAME, HARDWARE, CMU AND STRUCTURE AS REQUIRED TO CREATE NEW 10'-0"X 10'-0" OPENING. REF STRUCTURAL.48. REPLACE DAMAGED, MISSING, OR BENT TRUSSES, CROSS BRACES, COLUMNS AND CAPS. MATCH EXISTING TO REMAIN.49. POWER WASH UNDERSIDE OF CANOPY. REMOVE ALL BIRD NESTS AND REPLACE MISSING OR DAMAGED PREMOLDEDCLOSURE STRIPS.50. INSTALL PREMOLDED CLOSURE STRIPS AT BOTH SIDES OF CANOPY, END TO END, AND ABOVE CANOPY LIGHTING.51. PAINT ALL STEEL COLUMNS AND STEEL CANOPY STRUCTURE TO MATCH ADJACENT WALL. PAINT UNDERSIDE OF CANOPY P33.IF STEEL CANOPY HAS NOT PREVIOUSLY BEEN PAINTED - DO NOT PAINT.52. PIECE REPLACE VCT FLOORING AS DIRECTED BY WALMART CONSTRUCTION MANAGER53. REMOVE FRP AROUND COMPACTOR DOOR OPENING. PAINT P16 TO 8'-0" AFF, 8'-0" WIDE.54. PAINT BATTERY/TIRE STORAGE AREA INCLUDING CANOPY, COLUMNS AND BEAM TO MATCH EXTERIOR COLOR SCHEME. DONOT PAINT FENCE OR PLASTIC SLATS IF APPLICABLE. IF STEEL CANOPY DECKING HAS NOT PREVIOUSLY BEEN PAINTED - DO NOTPAINT.55. ALIGN NEW CEILING GRID WITH ADJACENT.56. PAINT HAND RAILS ENTIRELY AND STAIRS DOWN TO THE BULK HEAD P5.57. INSTALL 2X10 WOOD BASE W/CHAMFERED TOP TO ALL NON-CMU WALLS. DO NOT PAINT.58. STOP PLYWOOD SUBSTRATE AT 10'-0" AFF59. CARPET OR ENTRY TILE TRANSITION STRIP FURNISHED BY WALMART, INSTALLED BY GC60. INSTALL FLOOR MAT SYSTEM.61. INSTALL PROTECTIVE SURFACE WAINSCOT AS INDICATED ON PLANS. DO NOT INSTALL ON BLOCK WALLS.62. CARPETING INSTALLED IN PHARMACY WORK AREA AND PHARMACY CHECKOUT PER MANUFACTURERS RECOMMENDATIONS.63. CLEAN FRP WALLS.64. REPLACE OAK CAP ON HALF WALL WITH SOLID SURFACE MATERIAL.65. INSTALL BASE DB10 UNDER COOLER DOORS ENTIRE LENGTH OF RUN. INSTALL PL4 TO 48" ON WALLS AT SIDE OF COOLERDOORS.66. PRIME WALLS, DO NOT PAINT67. INSTALL 5" DIA. 48" LONG PVC TUBE W/SCREW CAP FOR REMODEL PLAN STORAGE. MOUNT INSIDE EDC #1 - IN ADDITION TOEXISTING TUBE.68. REMOVE EXISTING FLOOR TILE AND INSTALL NEW AS SCHEDULED69. REPLACE DAMAGED PIECES OF EXISTING SANITARY FLOOR MOLDING AS REQUIRED70. INSTALL 5/8" IMPACT RESISTANT GYPSUM BOARD TO 48" AFF.71. PROPERLY SEAL ALL EXISTING PENETRATIONS IN EXISTING FIREWALLS TO ACHIEVE X HOUR RATING.72. PAINT FLOOR P5. PAINT PATTERN TO MATCH EXISTING.73. PAINT PLYWOOD WAINSCOT AND WOOD BASE P76 BLUE.74. PAINT PLYWOOD WAINSCOT AND WOOD BASE P106 YELLOW.75. CLEAN ALL MECHANICAL AND ELECTRICAL CAGES AND ROOMS.76. NOT USED.77. AT MOPSINK PROVIDE 8'-0"x8'-0" FRP1 PANEL ON WALL(S) BEHIND MOPSINK. IF MOPSINK IN CORNER, PROVIDE 8'-0"x8'-0" FRP1ON BOTH WALL SURFACES. DOES NOT APPLY AT SIDE(S) OF MOPSINK ADJACENT TO COOLER PANEL(S).78. PAINT CUSTOMER WALKWAY P16 TO 8'-0" AFF, DO NOT PAINT ABOVE.GENERAL NOTESC/A070-SGN1. PAINT ALL METAL DOOR FRAMES VISIBLE TO CUSTOMER (EXCEPT DOORS IN CMU WALLS) WITH EPOXY PAINT. PAINT ALL METALDOORS AND METAL FRAMES TO MATCH ADJACENT WALLS UNO. WHERE ADJACENT WALLS ARE UNFINISHED PAINT METAL DOORSAND METAL FRAMES P33 UNO.2. WHEN PIECE REPLACING CEILING TILE GC TO MATCH NEW TILE TO ADJACENT SURROUNDING CEILING TILE.3. INSTALL MISSING CEILING TILES IN ALL ROOMS WHERE LAY-IN CEILING TILE IS ETR.MATERIAL KEYMARKABCDEETRFGHJMNPQTDESCRIPTIONCONCRETEGLASS AND ALUMINUM FRAMESMOOTH FACE CMUSPLIT FACE CMUCHAIN LINKEXISTING TO REMAINEXPOSED STRUCTUREGYPSUM BOARDMETAL SOFFITSHADECLOTHPLYWOODORNAMENTAL FENCECOOLER/FREEZER PANELTRANSLUCENT WALL PANELFIBERGLASS ROOF PANELSGLASS-MAT BACKER MATERIALFINISH KEYREF SPECIFICATIONS FOR EXACT COLORS REQUIREDMARK FINISH COLOR DESCRIPTIONACT1 ACOUSTICAL CEILING TILE WHITE 24"x48"ACT2 ACOUSTICAL CEILING TILE WHITE 24"x48" VINYL FACED NON-PERFORATEDACT3 ACOUSTICAL CEILING TILE WHITE 24"x48"ACT4 ACOUSTICAL CEILING TILE WHITE 24"x48"ACTG ACOUSTICAL CEILING GRID WHITEB4 RESILIENT BASE BLACK 4"B6 PLASTIC BASE BLACK6"x 1/4"B9 PLASTIC BASEBLACK4"x 1/4"B10 PLASTIC BASE OUTSIDE CORNER BLACKC1C3CCP5TCWBCUSHION BACK TILE CARPETCONCRETE CURBCT2 ENTRY TILERED12"x 24"x 3/8"CT6 GLAZED WALL TILE MEDIUM TAN6"x6"x5/16"CT9 ACCENT TILE LIGHT BROWN6"x6x3/8"6"x6"x5/16"6"x6"x5/16"CT10 GLAZED WALL TILE DARK BLUECT12 GLAZED WALL TILE LIGHT TANCT13 PORCELAIN TILE BROWNCT15 GLAZED WALL TILE BLACKCT16CT17CT19ECFRP2G5ICCMOSAIC FLOOR TILEGLAZED WALL TILEEXPOSED CONCRETEFIBERGLASS REINFORCED PLASTICGROUTINTEGRAL COLORED CONCRETEPAINTPL15 PLASTIC LAMINATE BROWNPL20 PLASTIC LAMINATE TANTEXTURED CONCRETE2x8 WOOD BASETANALMONDDB5 DURA-TUFF BASE BLACK 5"DB10 DURA-TUFF BASE BLACK 10"BEIGEG1 GROUT DARK GRAYG2 GROUT DARK GRAYG3G13G14P4PF4GROUTGROUTPAINTPREFINISHED METALIVORYBEIGEMUSHROOMBROWNDARK ZINCPL18 PLASTIC LAMINATE MEDIUM TANPVC1 PVC PLANK FLOORING WOODGRAINSST1SCB1SCB2SCB4SCB5PORCELAIN TILEGROUTSOLID SURFACESANITARY COVE BASESANITARY COVE BASESANITARY COVE BASESANITARY COVE BASEIVORYLT TANREDGRAYREDGRAYGRAY6"x6"x5/16"3"x3"x5/16"6"x6"x5/16"CT21 CERAMIC FLOOR TILE GRAY2"x 2"CT22 CERAMIC FLOOR TILE GRAY4"X4"ETRFRP1FRP5EXISTING TO REMAING4 GROUT DARK GRAYG6 GROUT SILVERFRP WALL PANELFRP7 FIBERGLASS REINFORCED PLASTIC GRAY FRP WALL PANELG7 GROUT BROWNP8 PAINT "PURE WHITE" # 7005P12 PAINT "BISCUIT" # 6112P16 PAINT"SOFTWARE" #7074P17 PAINT"ROW HOUSE TAN" #7689P18 PAINT"GRIZZLE GRAY" #7068P23 PAINT"PURE WHITE" #7005P33 PAINT"DOVER WHITE" #6385P36 PAINT"DOMINO" #6989P37 PAINT"WHITE HYACINTH" #0046P40 PAINT"GARDENIA" #6665P41 PAINT"PRACTICAL BEIGE" #6100P76 PAINT"MEDIUM WALMART BLUE" #076P81 PAINT"TRICOM BLACK" #6258P83 PAINT"COBBLE BROWN" #6082P88 PAINT"ROOKWOOD CLAY" #2823P93 PAINT"TAMARIND" #7538P94P98 PAINT"OAK CREEK" #7718P100 PAINT"NOTABLE HUE" #6521P102 PAINT"BEACH HOUSE" #7518P103 PAINT"TOASTY" #6095P105 PAINT"ICELANDIC" #6526P106 PAINT"AFTERNOON" #6675P107 PAINT"STRAW HARVEST" #7698PL4 PLASTIC LAMINATE MAPLEPL8 PLASTIC LAMINATE SANDPL9QT3 QUARRY TILE GRAY 6"X6" ABRASIVEQT31 QUARRY TILE RED 6"X6" ABRASIVERF1 RESINOUS FLOOR GRAYRF2 RESINOUS FLOOR REDVCT9 VINYL COMPOSITION TILE WHITE12"x12"x1/8"VCT11 VINYL COMPOSITION TILE BEIGE12"x12"x1/8"VCT12 VINYL COMPOSITION TILE TAN12"x12"x1/8"WB10FIBERGLASS REINFORCED PLASTICFIBERGLASS REINFORCED PLASTICG10 GROUT REDPAINTPLASTIC LAMINATE2x10 WOOD BASEWHITEALMOND"THEATER RED" #1602DARK GRAYPL12 PLASTIC LAMINATE BLACKPL19 PLASTIC LAMINATE CHAMPAGNEPL23 PLASTIC LAMINATE DARK GRAYPS1 PROTECTIVE SURFACE WALMART BLUESSCUSHION BACK TILE CARPETSTAINLESS STEELWG PLASTIC WALL GUARD BLACK OR GRAY"SAFETY YELLOW" OSHA STANDARD"EXTERIOR DROMEDARY CAMEL" #7694 (EXT)SVP1 SOLID VINYL PLANK FLOORING STRIP BAMBOO CARAMELREF SPECSREF SPECSFRP WALL PANELFRP WALL PANELNRP2 {NON-FIBERGLASS REINFORCED PLASTIC} ALMOND NRP WALL PANELPL6 PLASTIC LAMINATE LIGHT TANPL28 PLASTIC LAMINATE ALOEFINISH KEY:ADD C38" H ANTIMICROBIAL PLASTIC FOR QT8" H ANTIMICROBIAL PLASTIC FOR QT8" H ANTIMICROBIAL PLASTIC8" H ANTIMICROBIAL PLASTICBROOM FINISH SCHEDULERM # ROOM NAMEPLAN FLOOR WALL CEILINGS NOTESREFERENCECD ORIENTATIONA B C DAFINISH BASE MAT FINISH BASE MAT FINISH BASE MAT FINISH BASE MAT FINISH MAT FINISH HEIGHT093 FIXTURE STORAGE ETR --- ETR P94 --- ETR --- --- ETR --- --- ETR --- --- --- --- ---094 ROOF STAIRCASE CAGE ETR --- ETR P88 --- ETR --- --- ETR --- --- ETR --- --- --- --- ---100 SALES ETR REF A1.2 ETR REF A1.2 REF A1.2 ETR,G REF A1.2 --- --- --- REF A1.2 ETR REF A1.2 ETR --- ETR 10, 11, 12, 16,22, 30, 31, 52,61, 79101 VESTIBULE-GM C3 --- B --- --- B --- DB5 ETR P105 DB5 ETR P105 ACT4 --- ETR ---102 JANITOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---103 OTHER INCOME-GM C3 DB5 ETR P105 DB5 ETR P105 DB5 ETR P105 DB5 ETR P105 ACT4 --- ETR 3, 28104 CART STORAGE-GM ETR ETR ETR P105 ETR ETR P105 --- ETR P105 ETR ETR P105 ACT4 --- ETR 3, 28105 COURTESY DESK ETR DB5 ETR P105, PS1 DB5 ETR P105, PS1 DB5 ETR P105, PS1 DB5 ETR P105, PS1 ACT1 --- ETR 3, 52, 61107 CASH ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ---108 COUNT ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ---110 FIRE CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR, G ETR ETR ETR ETR ETR --- ETR 45, 71111 CUSTOMER MEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR P33 ETR 5, 17, 25, 44112 CUSTOMER WOMEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR P33 ETR 5, 17, 25, 44113 ALCOVE ETR DB5 ETR P105, PS1 --- --- --- DB5 ETR P105, PS1 DB5 ETR P105, PS1 ACT1 --- ETR 3, 52, 61115 VESTIBULE-GR C3 --- B --- --- B --- DB5 ETR P105 --- ETR P105 ACT4 --- ETR 3, 28116 ELECTRICAL ROOM-2 ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---117 OTHER INCOME-GR C3 DB5 ETR P105 DB5 ETR P105 DB5 ETR P105 DB5 ETR P105 ACT4 --- ETR 3, 28118 CART STORAGE-GR ETR ETR ETR P105 ETR ETR P105 --- ETR P105 --- ETR P105 ACT4 --- ETR 3, 28119 AP OFFICE ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---121 AP RETENTION ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---122 ELECTRICAL ROOM-3 ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---126 SEASONAL SHOP ETR --- ETR P105 --- ETR P105 --- ETR P105 --- ETR P105 ETR --- ETR 10, 30, 31, 79133 ALCOVE ETR --- --- --- DB5 ETR P105, PS1 DB5 ETR P105, PS1 DB5 ETR P105, PS1 ETR P33 ETR 25, 52, 61145 ASSOCIATE MEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---146 ASSOCIATE WOMEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---150 FIRE CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR 45, 71151 BREAKROOM ETR ETR ETR ETR, P105 ETR ETR ETR, P105 ETR ETR ETR, P105 ETR ETR ETR, P105 ETR --- ETR 2, 27, 52152 BREAKROOM ETR ETR ETR ETR, P105 ETR ETR ETR, P105 ETR ETR ETR, P105 ETR ETR ETR, P105 ETR --- ETR 2, 27, 52154 ELECTRICAL ROOM-1 ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR 67155 PHARMACY STORAGE ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---157 CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---158 JANITOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---159 SPRINKLER ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---160 CLAIMS ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---162 FIRE CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 45, 71, 72163 SITE TO STORE ETR DB5 ETR P105, PS1 DB5 ETR P105, PS1 DB5 ETR P105, PS1 DB5 ETR P105, PS1 ACT1 --- ETR 3, 52, 61164 ALCOVE ETR DB5 ETR P105, PS1 DB5 ETR P105, PS1 --- --- --- DB5 ETR P105, PS1 ETR P33 ETR 25, 52, 61165 CUSTOMER MEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR P33 ETR 5, 17, 25, 44166 CUSTOMER WOMEN ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR P33 ETR 5, 17, 25, 44168 PHOTO STORAGE ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---171 UPC/INVOICING ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---172 TRAINING ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 38174 MARKET MANAGERS OFFICE ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 38175 MANAGEMENT ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 38176 FIRE CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR 45,71177 MANAGERS OFFICE ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 38178 RECEIVING-GM ETR --- ETR --- --- ETR --- --- --- --- --- ETR --- ETR --- ETR 53179 STOCKROOM ETR --- ETR --- --- ETR --- --- ETR --- --- --- --- ETR --- ETR ---180 STOCKROOM ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---186 SECURITY ROOM ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---187 FIXTURES ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---PHARMACY300 PHARMACY C1 B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ACT1 --- ETR 3304 PHARMACY STORAGE ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 52FOOD SERVICE TENANT401 UTILITY ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---402 DINING AREA ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---404 SERVICE AREA ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---GARDEN CENTER501 GARDEN CENTER ETR --- ETR --- --- ETR P88, P94 --- ETR P88 --- ETR P88 P94 --- --- --- 49AUTO CENTER600 LUBE & TIRE MOUNTING AREA ETR --- ETR ETR --- ETR ETR --- ETR ETR --- ETR ETR ETR --- ETR ---601 TOILET ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---602 ELECTRICAL ROOM-4 ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---603 SECURITY ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---604 CUSTOMER SERVICE ETR DB5 ETR P105, PS1 DB5 ETR P105 DB5 ETR P105 DB5 ETR P105 ACT1 --- ETR 3, 4, 52, 61605 STORAGE ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---609 LUBE PIT ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR 56610 TIRE/BATTERY STORAGE ETR, A --- ETR --- --- ETR, C --- --- ETR --- --- ETR, E --- ETR --- ETR 54611 CUSTOMER WALKWAY ETR --- ETR P16 --- ETR P16 --- ETR P16 ETR ETR --- ETR --- ETR 78614 ENVIRONMENTAL CAGE ETR --- ETR --- --- ETR --- --- E --- --- ETR --- ETR --- ETR 54VISION CENTER700 OPTICAL SALES ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34701 ADJUSTMENTS ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34702 CONTACTS ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34703 PRETEST ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34704 RECORD RETENTION ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34705 EXAM #1 ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34706 EXAM #2 ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34707 WAITING ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 --- --- --- ETR --- ETR 2, 27, 34709 STORAGE ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34713 HALLWAY ETR B9 ETR P40 B9 ETR P40 B9 ETR P40 B9 ETR P40 ETR --- ETR 2, 27, 34TENANTS800 BANK ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---802 PICTURE ME ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---803 REGAL NAILS ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---804 FLORAL ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---HAIR CARE809 CLOSET ETR --- ETR ETR --- ETR ETR --- ETR ETR --- ETR ETR ETR --- ETR ---810 SALON ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---811 UTILITY ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---812 STORAGE ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---GROCERY900 GROCERY SALES ETR REF A1.3 ETR REF A1.3 REF A1.3 ETR REF A1.3 REF A1.3 ETR REF A1.3 REF A1.3 ETR REF A1.3 ETR --- ETR 10, 11, 12, 16,22, 30, 31, 52,65, 79901 SERVICE DELI ETR SCB5 ETR FRP2, P106 SCB5 ETR FRP2 SCB5 ETR FRP2 SCB5 ETR FRP2, P106 ACT2 --- ETR 3, 34, 35, 37902 DELI PREP ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 2, 21, 27, 34,35, 63, 69906 BAKERY ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 2, 21, 27, 34,35, 63, 69907 DEPARTMENT 82 ROOM ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---908 MEAT HOLDING ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 34, 35, 69909 PRODUCE PREP ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ACT2 --- ETR 3, 21, 35, 63,69912 MEAT PREP ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 34, 35, 69914 SEAFOOD ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---916 STOCKROOM ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---917 PLUMBING/MECHANICAL ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---918 FIRE CORRIDOR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR 45, 71, 72920 RECEIVING-GR ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR 53922 ELECTRICAL ROOM-5 ETR --- ETR --- --- ETR --- --- ETR --- --- ETR --- ETR --- ETR ---926 HALLWAY ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR ETR --- ETR ---935 CAKE DECORATING ETR SCB5 ETR FRP2 --- ETR P106 SCB5 ETR FRP2 SCB5 ETR FRP2 ACT2 --- ETR 3, 34, 35, 37STIPULATION FOR REUSEISSUE BLOCKCHECKED BY:DRAWN BY:PROTO:710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209PROTO CYCLE:Architect of RecordBradley J. PhillipsDOCUMENT DATE:STORE NO.GENERAL REMODELJOB NUMBER:18811-19-1002-09-11PRINTED: 8/4/2011 3:26 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 11:38 AM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a070.dwgROOM FINISH SCHEDULE:REVISED ROOMS 093, 101, 126, 604, 909, 935ADDED ROOM 177NOT FORCONSTRUCTIONSHEET:


DOOR SCHEDULEDETAIL REFERENCES ARE TO SHEET A8.1 UNOPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 11:43 AM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a080.dwg3'-6"2"2"5"N12"HOLLOW METALC\a080-01NARROW LITEC\a080-DRNSLIDE6"3'-7"1'-8"AFFMAX4" 2" 2"SLIDEAAAUTOMATIC SLIDING SO-SX-SX-SOC\a080-DRAA2HOLLOW METALC\a080-022"S12"MOTION DETECTOR TYPMUNTIN BARSECTIONAL OVERHEADC\a080-DRS13HOLLOW METALC\a080-032" CRASH BARS AT 6" AND 24" TYP10" BOTTOM STILES TYP3'-6"2"4"2"SLIDES34"4HOLLOW METALC\a080-04SLIDEBBAUTOMATIC SLIDING SO-SX-SX-SOC\a080-DRBBSECTIONAL OVERHEADC\a080-DRS32"4"U2"MOTION DETECTOR TYP1/4" TEMPERED GLASS TYPMUNTIN BAR2" CRASH BARS AT 6" AND 24" TYP10" BOTTOM STILES TYPCOILINGC\a080-DRU3'-7"8HOLLOW METALC\a080-0082"EFLEXIBLE TRAFFICC\a080-DREU1COILINGC\a080-DRU1CLEAR VIEW VISION PANEL5"x18" STEEL JAMB GUARDS2'-0" HIGH IMPACT BUMPER ON EACH SIDE OF DOORFFLUSHC\a080-DRFCHAIN LINKC\a080-DRV3'-0"3'-6"AFFMAX6" 6"GHALF GLASSC\a080-DRGORNAMENTAL FENCEC/A080-DRVV112808GENERAL NOTES:REMOVE 1-4COILING SHUTTERPFLUSH PASS-THRUC\a080-DRP8"W3(MAX.)ORNAMENTAL1. SCHEDULED WIDTH AND HEIGHT INDICATEFINISHED OPENING SIZE.2. AUTOMATIC SLIDING DOOR. SCHEDULEDWIDTH AND HEIGHT INDICATE ROUGH OPENINGSIZE.3. SIGNAGE: PROVIDE 1" HIGH LETTERS INCONTRASTING COLORS TO BACKGROUND, TEXTTO READ "THIS DOOR TO REMAIN UNLOCKEDDURING BUSINESS HOURS". SIGNAGEFURNISHED BY WALMART AND INSTALLED BYGENERAL CONTRACTOR.4. INSTALL SECTIONAL DOOR TRACK RETURN ATMAXIMUM HEIGHT AND AND AS CLOSE TO ROOFSTRUCTURE AS ALLOWABLE BY MANUFACTURER.5. INSTALL/REPLACE FLEXIBLE STRIP DOOR.6. DOOR COLOR TO BE BLACK7. SIGNAGE: PROVIDE 1" HIGH LETTERS INCONTRASTING COLORS TO BACKGROUND, TEXTTO READ "IN EMERGENCY PUSH TO OPEN".8. FULLY GASKETED FOR NEUTRALIZATION.9. DOOR, FRAME AND HARDWARE BYCONTRACTOR. SUB-FRAME BY CANOPYMANUFACTURER.10. PROVIDE VENDOR WITH FIELD DIMENSION OFCLEAR WIDTH AFTER REFRIGERATED CASES HAVEBEEN INSTALLED.11. NOT USED12. PROVIDE 1" CLEARANCE BETWEEN EDGE OFSTRIKE SIDE OF DOOR AND ADJACENTCASEWORK.13. NOT USED14. REPAIR AND ADJUST EXISTING DOOR TRACKSAND ALL ACCESSORIES.15. NOT USED{16. NOT USED}17. REPLACE BROKEN, MISSING, OR DAMAGEDGLASS.18. REMOVE EXISTING DOOR AND HARDWARE.EXISTING FRAME TO REMAIN. INSTALL HINGEFILLER PLATE AND STRIKE FILLER PLATE INHOLLOW METAL FRAME.19. WELDED FRAME20. REPLACE DAMAGED SECTIONAL DOORPANELS.21. REPAIR EXISTING DOOR.22. FLEXIBLE TRAFFIC DOOR COLOR TO BE KHAKI.PAINT DOOR FRAME P17.23. NOT USED.24. FLEXIBLE TRAFFIC DOOR COLOR TO BEBLACK. PAINT DOOR FRAME TO MATCH ADJACENTWALL.25. PROVIDE TACTILE "EXIT" SIGN, REF N126. NOT USED27. NOT USED28. NOT USED29. NOT USED30. REPAIR DAMAGED GATE.31. REMOVE DOOR CLOSER. PATCH AS NEEDED.32. ENLARGE DOCK DOOR OPENING. INSTALLNEW SEALS.33. INSTALL/REPLACE STOP. REF SPEC34. INSTALL 5"X20" WINDOW IN DOOR.35. INSTALL/REPLACE ALL DOOR HARDWARE. REFSPEC36. INSTALL/REPLACE EXIT DEVICE OR EXITALARM. REF SPEC37. INSTALL/REPLACE ONE-WAY VIEWER. REFSPEC38. ENSURE GATE IS OPERATIONAL ANDLATCHES.39. REPAIR DAMAGED EXTERIOR WALL CORNERSAT ROLL DOOR OPENINGS.40. INSTALL/REPLACE ELECTROMAGNETIC DOORHOLDER(S). REF SPEC41. INSTALL/REPLACE BUTTS. REF SPEC42. INSTALL/REPLACE CYLINDER(S), THUMBTURN,LOCK, LATCH AND/OR DEADLOCK. REF SPEC43. INSTALL/REPLACE PUSH AND/OR PULL. REFSPEC44. INSTALL/REPLACE THRESHOLD. REF SPEC45. INSTALL/REPLACE SAFETY HASP AND STAPLE.REF SPEC46. INSTALL/REPLACE SURFACE BOLT(S). REFSPEC47. INSTALL/REPLACE FLUSH BOLT(S). REF SPEC48. INSTALL/REPLACE DRIP CAP. REF SPEC49. INSTALL/REPLACE DOOR COORDINATOR. REFSPEC50. INSTALL/REPLACE DOOR ALARM ANDCYLINDER. REF SPEC51. INSTALL/REPLACE ELECTROMAGNETIC LOCK.REF SPEC52. INSTALL/REPLACE CLOSER. REF SPEC53. INSTALL/REPLACE LOCK GUARD. REF SPEC54. INSTALL/REPLACE ARMOR PLATE AND/ORKICKPLATE55. REPAIR DOOR, TRACK AND ACCESSORIES TOLIKE-NEW CONDITION56. INSTALL/REPLACE DEADBOLT LOCK. REFSPEC57. INSTALL/REPLACE DOOR HOLDER. REF SPEC58. INSTALL/REPLACE CONTINUOUS GEARED1. NOT USED.2. NOT USED.3. NOT USED.4. NOT USED.5. INSTALL/REPLACE ALL WEATHERSTRIPPING AND GASKETSAT ALL EXTERIOR HOLLOW METAL DOORS. REF SPEC6. ALL DOORS SCHEDULED AS NEW ARE TO RECEIVECOMPLETE NEW HARDWARE SETS AS LISTED INSPECIFICATIONS.7. INSTALL/REPLACE REINFORCING PIVOT AT ALL INTERIORHOLLOW METAL DOOR LOCATIONS WHERE MISSING ORBROKEN.8. ALL UL RATED DOORS MUST HAVE UL LABELS IN PLAINSIGHT AND BE LEGIBLE. IF EXISTING LABELS HAVE BEENPAINTED OVER, TEST PAINT REMOVAL IN ONE LOCATION. IFPAINT REMOVAL DAMAGES UL LABEL, CONTACT CM FORFURTHER DIRECTION. IF TEST UL LABEL IS NOT DAMAGEDFROM PAINT REMOVAL, REMOVE PAINT FROM ALL UL LABELS.9. AT EXTERIOR HOLLOW METAL DOORS, ENSURE EXITDEVICE/ALARM IS WORKING PROPERLY10. AT ALL DOORS IMMEDIATELY ADJACENT TO CUSTOMERAREAS, ADJUST EXISTING DOOR HARDWARE TO PROPERWORKING CONDITION.MATERIAL KEYMARKACRYLALALUMCLHM-STLOMPLASTSTLSTL-PSTL-BPTEMP{ROLLERS BY GATE MFR. }DESCRIPTIONACRYLICALUMINUM LINKALUMINUMCHAIN LINKHOLLOW METAL-STEELORNAMENTAL METALPLASTICSTEEL{ORNAMENTAL METAL GATE}STEEL PIPESTEEL BENT PLATETEMPEREDSLIDEXSIDE FOLDING GRILLEC/A080-DRX112604C/A080-FKEYSIDE FOLDING GRILLE (SEEDOOR SCHEDULE FOR SINGLE ORBI-PARTING)MARK ROOM NAME DOOR FRAME FIRERATINGNEW/ TYPE MATERIAL COLOR QTY NOMINAL SIZE GLASS NEW/ TYPE MATERIAL COLOR DETAILS(MIN)ETRETRW H T HEAD JAMB THRESHOLD093A FIXTURE STORAGE ETR V CL --- PR 3'-6' 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 093A094A ROOF STAIRCASE CAGE ETR V CL --- 1 4'-0' 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 094A100A SALES ETR F HM-STL P105 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL P105 --- --- --- --- 25 100A100B SALES ETR F HM-STL P105 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL P105 --- --- --- --- 25 100B100C SALES ETR F HM-STL P105 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL P105 --- --- --- --- 25 100C100D SALES ETR F HM-STL P105 2 3'-0" 7'-0" 1 3/4"" --- ETR 4 HM-STL P105 --- --- --- --- 25 100D101A VESTIBULE-GM NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 3 --- 2, 3, 7 101A101B VESTIBULE-GM NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 3 --- 2, 3, 7 101B101C VESTIBULE-GM NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 4 --- 2, 3, 7 101C101D VESTIBULE-GM NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 4 --- 2, 3, 7 101D102A JANITOR ETR F HM-STL P16 1 4'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P16 --- --- --- --- 59 102A104A CART STORAGE-GM ETR S1 STL --- 1 16'-0" 4'-8" --- --- ETR --- STL --- --- --- --- --- 1, 5 104A107A CASH ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 107A108A COUNT ETR F HM-STL P16 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P16 --- --- --- --- 59 108A110B FIRE CORRIDOR ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25 110B110F FIRE CORRIDOR ETR N HM-STL P16 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL P16 --- --- --- 1 HR 25, 59 110F111A CUSTOMER MEN ETR F HM-STL REF 4-A1.2 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL REF 4-A1.2 --- --- --- --- 52, 58, 59 111A112A CUSTOMER WOMEN ETR F HM-STL REF 4-A1.2 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL REF 4-A1.2 --- --- --- --- 52, 58, 59 112A115A VESTIBULE-GR NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 3 --- 2, 3, 7 115A115B VESTIBULE-GR NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 3 --- 2, 3, 7 115B115C VESTIBULE-GR NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 4 --- 2, 3, 7 115C115D VESTIBULE-GR NEW BB ALUM --- 1 12'-0" 10'-0" 1 1/2" TEMP NEW --- ALUM --- 6 5 4 --- 2, 3, 7 115D116B ELECTRICAL ROOM-2 ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P105 --- --- --- --- 59 116B118A CART STORAGE-GR ETR S1 STL --- 1 16'-0" 4'-8" --- --- ETR --- STL --- --- --- --- --- 1, 5 118A119A AP OFFICE ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 119A121A AP RETENTION ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 121A122C ELECTRICAL ROOM-3 ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P105 --- --- --- --- 59 122C126A SEASONAL SHOP NEW AA ALUM --- 1 12'-0" 7'-4" 1 1/2" TEMP NEW --- ALUM --- 7 5 8 --- 2, 3, 7, 25 126A126B SEASONAL SHOP ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P105 --- --- --- --- 25 126B126C SEASONAL SHOP ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P105 --- --- --- --- 25 126C126D SEASONAL SHOP ETR S1 STL --- 1 6'-0" 8'-8" --- --- ETR --- --- --- --- --- --- --- 1 126D145A ASSOCIATE MEN ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P105 --- --- --- --- --- 145A146A ASSOCIATE WOMEN ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P105 --- --- --- --- --- 146A150A FIRE CORRIDOR ETR F HM-STL --- 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL --- --- --- --- --- 25 150A150M FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 150M150N FIRE CORRIDOR ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL --- --- --- --- 1 HR 25 150N150P FIRE CORRIDOR NEW F HM-STL P16 PR 3'-0" 7'-0" 1 3/4" --- NEW 3 HM-STL P16 14 13 --- 1 HR 25 150P150Q FIRE CORRIDOR ETR F HM-STL --- PR 3'-0" 7'-0" 1 3/4" --- ETR 3 HM-STL --- --- --- --- 1 HR 25, 36 150Q151F BREAKROOM ETR G HM-STL P16 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- 59 151F151G BREAKROOM ETR G HM-STL P16 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL P16 --- --- --- --- 52, 59 151G154A ELECTRICAL ROOM-1 ETR V CL --- PR 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 154A154C ELECTRICAL ROOM-1 ETR V CL --- 1 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 154C155B PHARMACY STORAGE ETR V CL --- 1 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 155B157A FIRE CORRIDOR ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25 157A158C JANITOR ETR F HM-STL --- PR 2'-0" 7'-0" 1 3/4" --- ETR 3 HM-STL --- --- --- --- --- --- 158C159A SPRINKLER ETR V CL --- 1 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 159A160D CLAIMS ETR V CL --- 1 3'-0" 7'-6" --- --- ETR --- STL-P --- --- --- --- --- --- 160D162A FIRE CORRIDOR ETR F HM-STL --- 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL --- --- --- --- --- 25 162A162D FIRE CORRIDOR NEW F HM-STL P16 PR 3'-0" 7'-0" 1 3/4" --- ETR 3 HM-STL P16 --- --- 1 HR 25 162D162M FIRE CORRIDOR ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL --- --- --- --- 1 HR 25 162M162N FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 162N163A SITE TO STORE ETR F HM-STL P16 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P16 --- --- --- --- 52, 59 163A165A CUSTOMER MEN ETR F HM-STL REF 4-A1.2 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL REF 4-A1.2 --- --- --- --- 52, 58, 59 165A166A CUSTOMER WOMEN ETR F HM-STL REF 4-A1.2 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL REF 4-A1.2 --- --- --- --- 52, 58, 59 166A168A PHOTO STORAGE ETR F WOOD --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 WOOD --- --- --- --- --- --- 168A171A UPC/INVOICING ETR G HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 171A171B UPC/INVOICING ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL --- --- --- --- 1 HR --- 171B171C UPC/INVOICING ETR U STL --- 1 2'-0" 2'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 171C171D UPC/INVOICING ETR U STL --- 1 2'-0" 2'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 171D174B MARKET MANAGERS OFFICE ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 174B175A MANAGEMENT ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 175A176A FIRE CORRIDOR ETR F HM-STL --- 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL --- --- --- --- --- 25 176A176D FIRE CORRIDOR ETR F HM-STL P16 PR 3'-0" 9'-0" 1 3/4" --- ETR 3 HM-STL P16 --- --- --- 1 HR 25 176D176H FIRE CORRIDOR ETR N HM-STL ETR 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL ETR --- --- --- 1 HR 17, 25 176H176J FIRE CORRIDOR ETR N HM-STL ETR 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL ETR --- --- --- 1 HR 17, 25 176J176K FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 176K176L FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 176L177A MANAGERS OFFICE ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 177A178A RECEIVING-GM ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25,37 178A178B RECEIVING-GM ETR S1 STL --- 1 7'-4" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 178B178C RECEIVING-GM ETR S1 STL --- 1 7'-4" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 178C178D RECEIVING-GM ETR S1 STL --- 1 7'-4" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 178D178E RECEIVING-GM ETR S1 STL --- 1 7'-4" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 178E186A SECURITY ROOM ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 186A187B FIXTURES ETR V CL --- PR 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 187BPHARMACY300A PHARMACY ETR P HM-STL P16 1 3'-6" 7'-0" 1 3/4" --- ETR 1 HM-STL P16 --- --- --- --- 59 300A300B PHARMACY ETR U STL --- 1 9'-7" 4'-4" --- --- ETR --- --- --- --- --- --- --- --- 300B300C PHARMACY ETR U STL --- 1 6'-10" 3'-4" --- --- ETR --- --- --- --- --- --- --- --- 300C300E PHARMACY ETR U STL --- 1 2'-6" 2'-6" --- --- ETR --- --- --- --- --- --- 1 HR 1 300E304A PHARMACY STORAGE ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P40 --- --- --- --- --- 304AFOOD SERVICE TENANT401B UTILITY ETR F HM-STL ETR 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL ETR --- --- --- --- --- 401B402E DINING AREA ETR X --- --- 1 10'-8" 9'-0" --- --- ETR --- --- --- --- --- --- --- --- 402EGARDEN CENTER501E GARDEN CENTER ETR F HM-STL REF A2 PR 3'-0" 7'-0" 1 3/4" --- ETR 8 HM-STL REF A2 --- --- --- --- 25, 48 501E501F GARDEN CENTER ETR VV OM --- 1 4'-0" 8'-0" --- --- ETR --- OM --- --- --- --- --- 25 501F501K GARDEN CENTER ETR W3 OM --- 1 8'-0" 8'-0" --- --- ETR --- OM --- --- --- --- --- --- 501KAUTO CENTER600C LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600C600D LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600D600E LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600E600F LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600F600G LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600G600H LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600H600J LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600J600K LUBE & TIRE MOUNTING AREA ETR S3 STL --- 1 12'-0" 10'-0" --- ACRYL ETR --- STL --- --- --- --- --- 1 600K600L LUBE & TIRE MOUNTING AREA ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25 600L601A TOILET ETR F HM-STL P16 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P16 --- --- --- 45 MIN --- 601A602F ELECTRICAL ROOM-4 ETR V CL --- 1 3'-0" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 602F603A SECURITY ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 603A604D CUSTOMER SERVICE ETR N HM-STL P105 1 3'-0" 7'-0" 1 3/4" RATED ETR 2 HM-STL P105 --- --- --- 45 MIN --- 604D604E CUSTOMER SERVICE ETR F HM-STL P105 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P105 --- --- --- --- 25 604E605G STORAGE ETR F HM-STL P16 1 4'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL P16 --- --- --- 45 MIN --- 605G605H STORAGE ETR S1 STL --- 1 6'-0" 8'-8" --- --- ETR --- --- --- --- --- --- --- 1 605H605J STORAGE ETR F HM-STL P16 PR 3'-0" 7'-0" 1 3/4" --- ETR 3 HM-STL P16 --- --- --- --- 52 605J610C TIRE & BATTERY STORAGE NEW F HM-STL P88 PR 3'-0" 7'-0" 1 3/4" --- NEW 8 HM-STL P88 8-AC2 7-AC2 --- --- --- 610C611A CUSTOMER WALKWAY ETR G HM-STL P16 1 3'-0" 7'-0" 1 3/4" TEMP ETR 2 HM-STL P16 --- --- --- --- 25 611A611B CUSTOMER WALKWAY ETR G HM-STL P16 1 3'-0" 7'-0" 1 3/4" TEMP ETR 2 HM-STL P16 --- --- --- --- 25 611B611C CUSTOMER WALKWAY ETR U STL --- 1 8'-0" 3'-4" --- --- ETR --- --- --- --- --- --- 45 MIN 1 611C611D CUSTOMER WALKWAY ETR V CL --- 1 4'-0" 4'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 611D611E CUSTOMER WALKWAY ETR V CL --- 1 4'-0" 4'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 611E614C ENVIRONMENTAL CAGE NEW F HM-STL P88 PR 3'-0" 7'-0" 1 3/4" --- ETR 8 HM-STL P88 --- --- --- --- --- 614CVISION CENTER701A ADJUSTMENTS ETR G HM-STL P40 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL P40 --- --- --- --- 59 701A702A CONTACTS ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P40 --- --- --- --- 59 702A704A RECORD RETENTION ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P40 --- --- --- --- 59 704A705A EXAM #1 ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P40 --- --- --- --- 59 705A706A EXAM #2 ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL P40 --- --- --- --- 59 706A709A STORAGE ETR F HM-STL P40 1 3'-0" 7'-0" 1 3/4" ---- ETR 1 HM-STL P40 --- --- --- ---- 59 709ATENANTS800A BANK ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25 800A803B REGAL NAILS ETR X ALUM --- 1 14'-0" 9'-0" --- --- ETR --- ALUM --- --- --- --- --- --- 803B804A FLORAL ETR F HM-STL ETR 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL ETR --- --- --- --- 25 804A804B FLORAL ETR U1 STL --- 1 10'-0" 9'-11" --- --- ETR --- --- --- --- --- --- --- --- 804BHAIR CARE809A CLOSET ETR F HM-STL --- 1 2'-6" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 809A810E SALON ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 2 HM-STL --- --- --- --- --- 25 810E810G SALON ETR U1 STL --- 1 13'-10" 9'-10" --- --- ETR --- --- --- --- --- --- --- --- 810G811B UTILITY ETR F HM-STL --- 1 3'-0" 7'-0" 1 3/4" --- ETR 1 HM-STL --- --- --- --- --- --- 811BGROCERY901A SERVICE DELI NEW E PLAST KHAKI 1 3'-0" 7'-0" --- ACRYL ETR --- STL-BP P102 --- --- --- --- --- 901A901C SERVICE DELI NEW E PLAST KHAKI 1 3'-0" 7'-0" --- ACRYL ETR --- STL-BP P102 --- --- --- --- --- 901C902A DELI PREP ETR E PLAST --- PR 3'-0" 7'-0" --- ACRYL ETR --- STL-BP --- --- --- --- --- --- 902A906C BAKERY NEW E PLAST BLACK 1 3'-0" 7'-0" --- ACRYL ETR --- STL-BP P36 --- --- --- --- --- 906C906D BAKERY ETR E PLAST --- PR 4'-0" 7'-0" --- ACRYL ETR --- STL-BP --- --- --- --- --- --- 906D907A DEPT 82 ROOM ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 907A908A MEAT HOLDING NEW E PLAST BLACK 1 3'-6" 6'-8" --- ACRYL ETR --- STL-BP P36 --- --- --- --- --- 908A909B PRODUCE PREP NEW E PLAST BLACK PR 4'-0" 9'-0" --- ACRYL ETR --- STL-BP P36 --- --- --- --- 25 909B914A SEAFOOD PREP ETR E PLAST --- PR 3'-0" 7'-0" --- ACRYL ETR --- STL-BP --- --- --- --- --- --- 914A916B STOCKROOM ETR F HM-STL --- 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL --- --- --- --- --- 25 916B917C PLUMBING/MECHANICAL ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" TEMP ETR 1 HM-STL --- --- --- --- --- --- 917C918B FIRE CORRIDOR ETR F HM-STL --- 2 3'-0" 7'-0" 1 3/4" --- ETR 4 HM-STL --- --- --- --- --- 25 918B918D FIRE CORRIDOR NEW N HM-STL P106 PR 4'-0" 9'-0" 1 3/4" RATED NEW 3 HM-STL P106 14 13 --- 1 HR 25 918D918J FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 918J918K FIRE CORRIDOR ETR U STL --- 1 8'-0" 9'-0" --- --- ETR --- --- --- --- --- --- 1 HR 1 918K918L FIRE CORRIDOR ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL --- --- --- --- 1 HR 25 918L918M FIRE CORRIDOR ETR N HM-STL --- 1 3'-0" 7'-0" 1 3/4" RATED ETR 1 HM-STL --- --- --- --- 1 HR 25 918M920A RECEIVING-GR ETR S1 STL --- 1 6'-0" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 920A920B RECEIVING-GR ETR S1 STL --- 1 8'-0" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 920B920C RECEIVING-GR ETR S1 STL --- 1 8'-0" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 920C920D RECEIVING-GR ETR S1 STL --- 1 8'-0" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 920D920E RECEIVING-GR ETR S1 STL --- 1 8'-0" 8'-8" --- --- ETR --- STL --- --- --- --- --- 1 920E922C ELECTRICAL ROOM-5 ETR V CL --- 1 3'-6" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 922C922D ELECTRICAL ROOM-5 ETR V CL --- 1 3'-6" 8'-0" --- --- ETR --- STL-P --- --- --- --- --- --- 922D935A CAKE DECORATING NEW E PLAST KHAKI 1 3'-0" 7'-0" --- ACRYL ETR --- STL-BP P102 --- --- --- --- --- 935ADOOR SCHEDULE:REVISED 101A, 101B, 101C, 101D, 110F, 115A, 115B, 115C, 115D, 119A,150N, 151F, 162M, 171A, 171B, 172A, 186A, 300B, 300C, 602F, 604D,611A, 611B, 701A, 902A, 906D, 907A, 914D, 917C, 918D, 918L, 918MAND 935AADDED 121A, 171C, 171D, 177A AND 300ENOTESMARKSTIPULATION FOR REUSEISSUE BLOCKCHECKED BY:DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:SHEET:710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSTORE NO.GENERAL REMODELJOB NUMBER:18811-19-1002-09-11NOT FORCONSTRUCTION


710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSTIPULATION FOR REUSENEW 1/4" CHAMFER AT SEALED HARDWOOD EDGE BOTH SIDESPLASTIC LAMINATE ON EXISTING SUBSTRATE TOPDO NOT LAMINATE REAR OR INSIDE OF CABINETSTORE NO.GENERAL REMODELPLASTIC LAMINATE ON EXISTING SUBSTRATE FRONT AND SIDES2'-2"4"ISSUE BLOCKJOB NUMBER:TRUEBRO BASIN GUARDPHONE: 1-800-340-5969INTERNET: HTTP://WWW.IPSCORP.COM/TRUEBROEMAIL: INFO@TRUEBRO.COMFIXTURE AND CABINET DIMENSIONS ARE CRITICAL TO ADAAG AND LOCAL ACCESSIBILITY CODE REQUIREMENTS. ENSURE INSTALLATION COMPLIES.2'-1"SINK AS SCHEDULED(REF PLUMBING)CHECKED BY:4"ONE PIECE PREFORMED ROLLED FRONT COUNTERTOP BY PLUNKETT DISTRIBUTING 1-800-833-4393 CONTACT HOLLIE PIERCEDRAWN BY:PROTO:1881x4 WOOD BLOCKINGPROTO CYCLE:11-19-102'-10" MAX2'-5"2'-3" MINTO BOTTOM OF SCALD GUARD9" MIN8" MINPROVIDE UNDERSINK PROTECTIVE ENCLOSUREPLASTIC LAMINATEON{}" PLYWOOD PANELSDOCUMENT DATE:02-09-1111" MINPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 1:11 PM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\a090.dwgEXISTINGFV{}"PLASTIC LAMINATE ON EXISTING 3/4" SUSBSTRATE TOPPLASTIC LAMINATE ON FRONT STILES1/4" CHAMFER ATPLASTIC LAMINATEAND HARDWOODEDGESEALEDHARDWOODEDGE TRIM TYP2'-10"MAX AFF4"{}"5{}"{}"WIRE PULL1{}"HARDWOOD EDGE TRIM TYP4"1{}"2'-1"ONE PIECE PREFORMED ROLLED FRONT COUNTERTOP BY PLUNKETT DISTRIBUTING 1-800-833-4393 CONTACT HOLLIE PIERCE1x4 WOOD BLOCKINGDRAWER, OMITTED UNDER SINK3/4" SUBSTRATE ADJUSTABLE SHELF OMITTED UNDER SINK3/4" SUBSTRATE FRONT AND ENDS3/4" SUBSTRATE BOTTOM2x WOOD BLOCKING4"2'-10"TO TOP OF SINK{NOTE:}INSULATE ALL EXPOSED PIPINGAT SINK3'-11"2'-5"BASE BEYOND12'-0"3'-0"SINK3'-6"5'-1"UNDERSINK PROTECTIVE COVERONE PIECE PREFORMED ROLLED FRONT COUNTERTOP BY PLUNKETT DISTRIBUTING 1-800-833-4393 CONTACT HOLLIE PIERCEPREFABRICATED OAK FACE AND TRIM COUNTER BASE1/4" CHAMFER AT PLASTICLAMINATE ANDHARDWOODEDGESEALEDHARDWOODEDGE TRIM TYP{}"EXISTING{}"1{}"PLASTIC LAMINATE ON EXISTING 3/4" SUBSTRATE1 1/4" OD STEEL PIPE AT 48" OC MAX. UNO PAINTENSURE ALL FLANGES ARE SECURELY ATTACHED TO COUNTER AND FLOORFLANGE ATTACHMENTIF ADJUSTABLE SQUARE SUPPORT POSTS ARE EXISTING, REPLACE WITH PIPE SUPPORTS AS SHOWN. OTHERWISE, EXISTING PIPE SUPPORTS ARE TO REMAIN.3'-0"2'-8" AT ADA COUNTER2'-2"PLASTIC LAMINATE ON EXISTING 3/4" SUSBSTRATE TOPCUSTOMER SIDE OF COUNTERCONTINUOUS WOOD BLOCKING INFILLPLASTIC LAMINATE 3/4"SUBSTRATEAT FRONT AND SIDES1{}"EXISTINGFVTOE KICK TO BE INFILLED AS SHOWN AT CUSTOMER SIDE OF COUNTER AT THE TLE, CUSTOMER SERVICE, AND SITE TO STORE AREAS.{}"1/4" CHAMFER ATPLASTICLAMINATE ANDHARDWOODEDGESEALEDHARDWOODEDGE TRIM TYPNOT FORCONSTRUCTIONSHEET:


CI = CERTIFIED INSTALLERGC=GENERAL CONTRACTORES=EQUIPMENT SUPPLIERWM=WAL-MARTQTY53124422111582633112642211122214112NODESCRIPTIONEQUIPMENT SCHEDULEMANUFACTURERMODEL NOINSTALLED BYFINAL CONNSUPPLIED BYAC000-ESCHNOTESGENERAL NOTES1NOTESALL TANKS AND PIPING TO BE INSTALLED AND PROPERLY TESTED IN ACCORDANCE WITH ALL APPLICABLE CODES AND MANUFACTURER REQUIREMENTS. REF SPECIFICATIONS.2 ALL PIPING AND FITTINGS TO BE SUPPLIED BY GENERAL CONTRACTOR AND INSTALLED BY CERTIFIED INSTALLER1 FURNISHED BY WAL-MART AND INSTALLED BY GENERAL CONTRACTOR PER MANUFACTURER'S SPECIFICATIONS2 GENERAL CONTRACTOR IS RESPONSIBLE TO COORDINATE DELIVERY SCHEDULE REF SPECIFICATIONS3 STEEL MOUNTING PLATE FOR WASTE OIL PUMP BY LIFT MANUFACTURER4 NOT USED5 HOSES ROUTED THROUGH EMBEDDED PIPE SLEEVE. REF MECHANICAL6 TB900 SHALL BE PROVIDED WITH LIFTGENERAL CONTRACTOR IS RESPONSIBLE TO COORDINATE INSTALLATION SCHEDULE REF SPECIFICATIONS8 REF MECHANICAL FOR LOCATION9 REFER TO SPECIFICATIONSNOTE:VERIFY EQUIPMENT REQUIRED WITHEQUIPMENT SCHEDULE, ARCHITECTURAL ANDMEP DRAWINGS.EXISTING SUMP PUMPEXISTING LADDERCORE DRILL (2) 6"DIAMETER HOLES 6" APARTTHRU EXISTING SLAB THENCUT BETWEEN TO CREATEONE HOLE. RUN VENT PIPESTHRU SLAB THEN THRU ROOF12'-0"1. WALMART ENVIRONMENTAL MANAGEMENT ANDSUPPORT SHALL BE RESPONSIBLE FOR EMPTYING,HANDLING, REMOVAL AND DISPOSAL OF ALL AST TANKS2. GENERAL CONTRACTOR SHALL PROVIDEDISCONNECTION OF ALL EQUIPMENT, LINES, PIPES ANDRETAINING HARDWARE.3. GENERAL CONTRACTOR SHALL NOT PERFORM ANYWORK BEFORE TANK HAS BEEN EMPTIED.4. GENERAL CONTRACTOR SHALL COORDINATE ALL WORKWITH WALMART CONSTRUCTION MANAGER.5. WALMART CONSTRUCTION MANAGER SHALL CONTACTGREG ROWLAND OR PAT GUTHRIE WITH WALMARTENVIRONMENTAL MANAGEMENT AND SUPPORT FOR TANKREMOVAL COORDINATION (479-204-2108 OR 479-204-2501)1. ONLY REMOVE BULK WASTE, WINDSHIELD FLUID, SPECIALTY OIL AND DIY TANK IF SHOWN TO BE REMOVED. REF GENERAL NOTES1. REF A7 FOR SCHEDULE FINISH KEYSTIPULATION FOR REUSE710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. Phillips8"RELOCATE EXISTING 400 GALLON BULK OIL TANKREMOVE EYEWASHREF MEPRELOCATE EXISTING PLASTIC WINDSHIELD WASHER FLUID TANKEXISTING GEAR OIL,CHASSIS GREASEAND CONTAINMENTCORE DRILL (2) 6" DIAMETER HOLES6" APART THRU EXISTING SLAB THENSAWCUT BETWEEN TO CREATE ONEHOLE. RUN VENT PIPES THRU SLABTHEN THRU ROOFREF MEP AND 3,4,10-AC2RELOCATEEXISTING 400GALLON BULKOIL TANKCORE DRILL (2) 6" DIAMETER HOLES6" APART THRU EXISTING SLAB THENSAWCUT BETWEEN TO CREATE ONEHOLE. RUN VENT PIPES THRU SLABTHEN THRU ROOFREF MEP AND 3,4,10-AC28"UP11{}"1'-10{}"8"SERVICE PLATFORMLUBE PITEXISTING SHELVES TO REMAINSERVICE PLATFORMSTORE NO.GENERAL REMODELJOB NUMBER:RELOCATEEXISTING 800GALLON WASTEOIL TANKISSUE BLOCKENVIRONMENTAL CAGETIRE & BATTERY STORAGECHECKED BY:DRAWN BY:PROTO:188EXISTING SUMP PUMPREF 2,3-AC1 FOR PIT DEMOLITION AND PIT PLAN (BELOW)PROTO CYCLE:DOCUMENT DATE:11-19-1002-09-11EXISTING LADDERVENT PIPING THROUGH FLOOR ABOVEREF MEP AND 3,4,10-AC2RELOCATED 400GALLON BULKOIL TANK14'-2"NEW EYEWASHREF MEP ANDN1 FOR STRIPPINGREQUIREMENTS3"MINEXISTING VENDINGRELOCATED EXISTING PLASTIC WINDSHIELD WASHER FLUID TANKTLE SERVICEEXISTING GEAROIL, CHASSISGREASEAND CONTAINMENTVENT PIPING THROUGH FLOORABOVEREF MEP AND 3,4,10-AC211'-10"SERVICE PLATFORMEXISTING SHELVESSERVICE PLATFORMDNRELOCATED 400GALLON BULKOIL TANK2'-2"RELOCATED 800GALLON WASTEOIL TANK3"MINPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 11:46 AM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\ac010.dwg3"MINNEW FILTER CRUSHER AND WASTE OIL RESERVOIR3"MINEQUALEQUALWASTE OIL PUMPRELOCATED EWC REF MEP2'-0"NEW EYEWASHREF MEPNOT FORCONSTRUCTIONSHEET:


5.52 48" GALVANIZED STEEL BOLLARD. REF 8-A5.1710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsJOB NUMBER:STORE NO.GENERAL REMODELSTIPULATION FOR REUSEISSUE BLOCKCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11METAL CANOPYPRINTED: 8/4/2011 3:28 PM BY: Brenda Garrison LAST SAVED: 8/3/2011 4:11 PM BY: BRIANCARLTONe:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\gc010.dwg4"4"NOT FORCONSTRUCTIONSHEET:


710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsSTIPULATION FOR REUSEFIELD VERIFYGENERAL REMODELMATCH EXISTINGSTORE NO.3/4" PLYWOOD SUBSTRATEFIELD VERIFYGRAY VINYL WALL GUARDREF SPECIFICATIONSJOB NUMBER:1x TRIMISSUE BLOCK2'-10"FIELD VERIFYCONTINUOUS SEALANT AT TOP OF BASEGRAY VINYL WALL GUARDREF SPECIFICATIONS1 1/4" OD PIPE SUPPORTS AT 48" OC MAX PAINT3'-4{}"ADJUST COUNTERTOP HEIGHT AS NEEDEDCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11RELAMINATE ALL COUNTERTOPSREPLACE ADJUSTABLE COUNTERTOPS SUPPORTS WITH 1 {}" OD PIPE SUPPORTS AT 48" OC MAX PAINTWHEN REPLACING COUNTERTOP LAMINATE REMOVE HARDWOOD TRIM FROM EDGE, BAND EDGES WITH PLASTIC LAMINATE TO MATCH COUNTERTOP, TYPWALL CAPS WITH GLASS TO REMAIN TYPREMOVE CORNICE PATCH AND REPAIR WALL FINISH AND REPAINTPAINT INTERIOR OF PHARMACYREPAIR DAMAGED WALLS BOTH INTERIOR AND EXTERIORRELAMINATE COUNTERTOPSCLEAN ALL LIGHT LENSES TYPINSTALL BASEEXISTING BULKHEAD TO REMAININSTALL NEW CARPET TILEPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 11:51 AM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\rxpfc010.dwg4'-0"2'-2"ALUMINUM CORNER GUARDS AT ALL OUTSIDE CORNERSPAINT EXTERIOR WALLSPLASTIC LAMINATEGRAY WALL GUARDREPLACE ALL CEILING TILE CLEAN EXISTING CEILING GRIDCLEAN ALL HVAC DIFFUSERS AND SPRINKLER HEADSEXISTING FIXTURES TO REMAIN. RELOCATE AND PROTECT AS REQUIRED DURING INSTALLATION OF NEW WORK WITH MINIMA INTRUSION TO PHARMACY OPERATION. RETURN FIXTURES TO ORIGINAL LOCATIONRELAMINATE VERTICAL SURFACED IN THE PHARMACYPAINT INTERIOR OF PHARMACY STORAGENOT FORCONSTRUCTIONSHEET:


{MISC. GROCERY EQUIPMENT LEGEND}NO. QTY. DESCRIPTIONMFR. OR SUPPLIER NOTESMODEL NO. SUPPLIED BY INSTALLED BY FINAL CONNECTREMOVED REFRIGERATED CASE LEGENDEQUIPMENT NOTES1. REFERENCE SHEET A1 FOR EQUIPMENT LOCATION3. WALMART TO SUPPLY SS FIXTURES BY UNIVERSAL STAINLESS IN THE FOLLOWING STATES: CO, ID, KS, MT, ND, NE, SD, OR, WA,WYWAL-MART TO SUPPLY SS FIXTURES BY WIN-HOLT IN THE FOLLOWING STATES: AK, AL, AR, AZ, CA, CT, DE, FL, GA, HI, IA, IL, IN, KY,4. QUANTITY AND TYPE BY WALMART. RACKS SHOWN ARE FOR POSSIBLE STORAGE AND PREP LOCATIONS5. EQUIPMENT SUPPLIED TO HAVE CLEAR COATED GALVANIZED EXTERIOR, WITH BLACK INTERIOR AND COLOR BANDS6. REFERENCE SPEC SECTION 11400 FOR SPECIAL INSTRUCTIONS FOR STORES WHICH HAVE AN EXISTING WASTE COOKING OIL TANK (EXPANSIONS AND RELOCATIONS ONLY){13. CONNECTED AND INSTALLED BY SUPPLIER. GC TO COORDINATE CONNECTION LOCATIONS FOR MAINTENANCE WITH SUPPLIER, REF MEP}710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsABBREVIATION KEYESGCEQUIPMENT SUPPLIERGENERAL CONTRACTORRC REFRIGERATION CONTRACTOR, REF SPEC 15600WMWALMARTSTIPULATION FOR REUSEEXISTING M/D FRESH MEAT CASESGENERAL REMODELEXISTING COFFINCASES TO REMAINSTORE NO.EXISTING REFRIGERATED CASESGROCERY COOLERJOB NUMBER:ISSUE BLOCKEXISTING REFRIGERATED CASESEXISTING REFRIGERATED CASESEXISTING M/D FRESH MEAT CASESICE CREAM FREEZEREXISTING REFRIGERATED CASESSEAFOOD COOLERSEAFOOD FREEZEREXISTING PRODUCE CASESCHECKED BY:DRAWN BY:SEPARATE CONTRACTOR IS RESPONSIBLE FOR RE-SKIN OF EXISTING REFRIGERATED CASES TO REMAINCASES FURNISHED BY WALMARTINSTALLED BY REFRIGERATIONCONTRACTOR VERIFY VERIFYEXACTLOCATION OF CASES WITHWALMART CONSTRUCTIONEXISTING REACH-IN FREEZERS TO REMAINPROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11EXISTING M/D SEAFOOD TO REMAINEXISTING REACH-IN FREEZER TO REMAINEXISTING CAKE CASES TO REMAINNEW MOPSINK REF MEPBULKHEAD ABOVEPRODUCE COOLERSUBWAYBAKERY COOLERPRINTED: 8/4/2011 3:27 PM BY: Brenda Garrison LAST SAVED: 8/2/2011 11:56 AM BY: LukeSpurgeone:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\ga010.dwgRLCOOLERFREEZERBAKERY FREEZERNOT FORCONSTRUCTIONSHEET:


{KEYNOTES}710 West Roselawn DriveRogers, Arkansas 72756Phone: 479.636.3545Fax: 479.636.1209Architect of RecordBradley J. PhillipsNOTE:THIS DETAIL ONLY OCCURS IN THE GROCERY SERVICE AREAS: PRODUCE, DELI PREP, DELIUTILITY, BAKERY, BAKERY UTILITY, UTILITY, FOOD SERVICE, AND SEAFOOD PREP (IFNEW WASTECOOKINGOIL TANK8'-0"12'-0{}"FVSTIPULATION FOR REUSEBALEREXISTING GYPSUM BOARDEXISTING GYPSUM BOARD1/2" x 10" H GLASS MAT BACKER BOARD5"1"1/2" x 10" H GLASS MAT BACKER BOARDDELI FREEZER5"1"{}"{INSIDE CORNER}{SECTION}EXISTING STEEL TRACK4" BUILDING TAPE FULL HEIGHT OF WALL AND ALL VERTICAL WALL BOARD JOINTS6" BUILDING TAPE AT WALL/FLOOR INTERSECTIONEXISTING GYPSUM BOARDREMOVE BOTTOM 10" OF EXISTING GYP BD AND INSTALL 10"x1/2" GLASS MAT BACKER BOARDPOLYURETHANE SEALANT (REF SPECS)SANITARY COVE BASEPOLYURETHANE SEALANT (REF SPECS){OUTSIDE CORNER}WALL FINISH TO MATCH ADJACENT EXISTINGEXISTING STUDS{}"BUILDING TAPE AT WALL/FLOOR INTERSECTION (REF SPEC 09655){FOOD PREP AREA}4" BUILDING TAPE FULL HEIGHT OF WALL AND ALL VERTICAL WALL BOARD JOINTS6" BUILDING TAPE AT WALL/FLOOR INTERSECTIONDAIRY COOLEREXISTING DAIRY CASES TO REMAINEXISTING CASES TO REMAINDELI COOLEREXISTING CASES TO REMAINSTORE NO.GENERAL REMODELEXISTING COFFIN CASE TO REMAINEXISTING CASETO REMAINNEW EYEWASHREF MEP2'-6"JOB NUMBER:ISSUE BLOCKEXISTING M/D DAIRY CASESEXISTING M/D BEER CASESEXISTING COFFIN CASE TO REMAINCHECKED BY:DRAWN BY:PROTO:188PROTO CYCLE:11-19-10EXISTING M/D DAIRY/DELI CASES TO REMAINDOCUMENT DATE:02-09-11RE-SKIN OF EXISTING REFRIGERATED CASES TO REMAIN SEPARATE CONTRACT.VERIFY EXACT LOCATION OF CASES WITH WALMART CONSTRUCTION MANAGER PRIOR TO STARTING CONSTRUCTION (TYP)GROCERY FREEZEREXISTING COFFIN CASES TO REMAINEXISTING M/D DAIRY/DELI CASES TO REMAINPRINTED: 8/4/2011 3:26 PM BY: Brenda Garrison LAST SAVED: 8/3/2011 4:21 PM BY: BRIANCARLTONe:\2010xxx\2010-0452 ruston_la\4condoc\188 (general remodel-2)\arch\sheets\ga020.dwgEXISTING M/D FRESH MEAT CASES TO REMAINMEAT COOLERNOT FORCONSTRUCTIONSHEET:


SINKGENERAL NOTES12 11REFER TO SHEET P1 FOR GENERAL NOTES PERTAINING TO THIS SHEET.PLUMBING KEYNOTESCLEAN ALL SUPPLYDIFFUSERS ANDEXISTING WATER HEATER ETRB15.422{}EXISTING PIPING TO REMAIN (VERIFY LOCATION IN FIELD).STIPULATION FOR REUSEPHARMACY MECHANICAL PLAN1/8"=1'-0"15 14 13 12 1 10PHARMACY STORAGEFIRE CORRIDORSECURITYROOMSPRINKLERFIRE CORRIDORUPC/INVOICINGMANAGER'S OFFICEPHOTO STORAGEEXISTING 2-1/2"CW15.4224FIXTURE STORAGEGP1.1COMPACTORTIRE & BATTERY STORAGERECEIVING-{GM }STOCKROOMEXISTING 6" SS15.422FCO ETRDEPARTMENTMANAGER'SWORKSTATIONEXISTING 6" SS15.422ELECTRICALROOM #1STOCKROOM4CLAIMSJANITORP1 M1 P1PHOTO LAB/SITE TO STORETRAININGBREAKROOMPERSONNELFIXTURESAP OFFICEBREAKROOMMANAGEMENTCUSTOMERMENCUSTOMERWOMENASSOCIATE MENASSOCIATE WOMENMARKET MANAGER'S OFFICEFIRE CORRIDORDAIRY COOLERHALLWAYDELI FREEZERDELI COOLERDELI PREPSERVICE DELIDEPT. 82RECEIVING-{GR}STOCKROOMFIRE CORRIDORRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:CUSTOMER SERVICETOILETISSUE BLOCKELECTRICAL ROOM #4FCO ETRELECTRICALROOM #507-14-11 PLAN REV. #108-05-11 ADDENDUM #1LUBE & TIRE MOUNTING AREASECURITYEXISTING 4" SS15.422GROCERY FREEZERSTORAGEFCO ETRMAC1MEAT COOLERFEXISTING 1-1/2"CW15.422CHECKED BY:JEESALESMEAT PREPDRAWN BY:TRFEPROTO:188EXISTING 1/2"CW15.422FCO ETRP1WET DEVELOPING EQUIPMENT TO BE REMOVED BY EQUIPMENT VENDORSILVER RECOVERY UNIT TO BE REMOVED BY OTHERS. GENERAL CONTRACTOR TO CAP EXISTING DRAIN/CONNECTION AS REQUIRED.GROCERY SALESMEAT HOLDINGGROCERY COOLERICE CREAM FREEZERPROTO CYCLE:DOCUMENT DATE:11-19-1002-09-11EXISTING 6" SSPHOTO LAB ETRWATER FILTRATION SYSTEM TO BE REMOVED BY OTHERS. GENERAL CONTRACTOR TO DISCONNECT WATER LINE TO WATER FILTRATION SYSTEM AND MAINTAIN CONNECTION OF WATER LINE TO SINK.SEAFOOD COOLERSEAFOOD FREEZEREXISTING 1-1/2"CW15.42215.422SEAFOOD PREPSEASONAL SHOPEXISTING 1-1/4"CW15.422YCO ETRPHARMACYMP1EXISTING 6" SS15.422FCO ETREXISTING 1-1/2"CW15.422CART STORAGE-{GM }ELECTRICAL ROOM #3EXISTING 3/4"CWP1P1JANITORCORRIDOREXISTING 2"CW15.422EXISTING 2"CWM1PICTURE MEEXISTING 2-1/2"CW15.422CART STORAGE-{GR}4M1SUBWAYRCAKE DECORATINGBAKERYPLUMBING/MECHANICALPRODUCE PREPPRODUCE COOLERBAKERY COOLERBAKERY FREEZERBGP1ALL HVAC WORK ON THIS PROJECT IS TO BE COMPLETED BY A WALMART APPROVED CONTRACTOR.S:\Wal-Mart\W447\D\W447MP1 3 Aug 2011 - 4:41 pmGARDEN CENTERP1YCO ETROTHER INCOME-GMVESTIBULE-{GM}VISION CENTERCOURTESY DESKCASHCOUNTWOMENREGAL NAILS%MECHANICAL AND PLUMBING PLAN1" = 20'-0"MENSMART STYLEBANKWIRELESS STOREEXISTING 6" SS15.422VESTIBULE-{GR}M1OTHER INCOME-GRYCO ETRELECTRICAL ROOM #2EXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGHKNOWLEDGE OF ALL DRAWINGS AND SPECIFICATIONS IN THEIRRELATED FIELD. THE FAILURE TO ACQUAINT HIMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING HIS WORK PROPERLY. NO ADDITIONAL COMPENSATIONSHALL BE ALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.MECHANICALANDPLUMBINGPLANSHEET:MP1


15EXISTING DUCTDOWN TO PITREBALANCE TO2500 CFMAUTO CENTER NOTESSUMP PIT1. REFERENCE ARCHITECTURAL SHEETS FOREQUIPMENT SCHEDULE.3/4"15.473EXISTING CWEXISTING 3/4" COLDWATER AND AIR UPTHRU FLOORNEW AST VENT PIPE ROUTED UP THRU NEW CHASE CUT THRU SLAB. REF: 1-MAC1 FOR CONTINUATION.15.466(2) 1" ELECTRICAL CONDUITS, REFERENCE ELECTRICAL SHEETS.13'-0"AEXISTING BULKOIL PUMP15.48110W-3015.482TYPRELOCATED BULK OIL TANK15.461142. PROPERLY INSTALL UNISTRUT AND PIPEBRACKETS FOR ALL NEW AND RELOCATEDPIPING. EVERY UNISTRUT SHOULD BEINSTALLED 12 INCHES BEFORE AND AFTEREACH PIPE BEND, A MAXIMUM OF 10 FEETAPART FOR VERTICAL PIPING, AND FORANY PIPING BEING ADDED TO PIPECLUSTER. REFERENCE SPECIFICATIONSFOR MAXIMUM DISTANCE BETWEENUNISTRUT PIPING SUPPORTS FORHORIZONTAL PIPING.3. INSTALL VTR'S A MINIMUM OF 24" ANDFLUES A MINIMUM OF 36" FROM ROOFEDGE AND/OR PARAPET WALLS. INSTALLVTR'S, FLUES AND EXHAUST FANS AMINIMUM OF 10 FT FROM OUTSIDE AIRINTAKE OF ROOF TOP UNITS. INSTALLEXHAUST FANS AND ROOF TOP UNITS AMINIMUM OF 10 FT FROM ROOF EDGE OR AMINIMUM OF 60" FROM PARAPET WALLSTHAT ARE AT LEAST 42" HIGH.STIPULATION FOR REUSE1/2"4RELOCATEDEWC4EW11/2"3/4" TEPID WATERLINE ABOVE CEILINGTEPID%EYEWASH WATER RISER1/4"=1'-0"15.4023/4" TEPID WATER LINE ABOVE CEILING15.401133/4"TOILETEWCETRLAVETRT3/4"CW3/4"HWETMV2WCETRTLE RESTOOM%MECHANICAL/PLUMBING TLE PLAN1/4"=1'-0"WCOETRNEW WH2 ABOVE CEILINGFDETRROUTE NEW 3/4" HW AND CW TO NEW ETMV2NEW WH2ETMV2 TO SUPPLY TLESERVICE BAY ANDSERVICE PIT, MOUNT AT60" AFFREF 5/MAC1MAC2REF EMERGENCY THERMOSTATIC MIXING VALVE, (ETMV) MOUNTING ELEVATION (SIM)NEW AST VENT PIPE ROUTED UP THRU NEW CHASE CUT THRU SLAB. REF: 1-MAC1 FOR CONTINUATION.15.46615.464EXISTING CONTAINMENT PALLETEXISTING WINDSHIELDWASHER FLUID PUMPRELOCATED WINDSHIELDWASHER FLUID TANKEXISTINGCHASSIS GREASENEW 3/4" TEPIDWATER UPTHRU FLOOREXISTING BULKOIL PUMP15.464NEW 3/4" AIR(2) NEW AST VENT PIPES, ROUTED UP THRU NEW CHASE CUT THRU SLAB. REF: 1-MAC1 FOR CONTINUATION.3'-0"MINTHOSE BIBBETREXISTINGGEAR OILMAC2EW13/4" TEPID WATER LINEWMAC315.466TYPCGA5W-30GOEXISTING BULKOIL TANKSAFETY AREA TO BEMAINTAINED FREE AND CLEARFOR EYEWASH.REF: ARCH SHEETSMAC215.464MAC215'-10"A3"5W-3011"CGGOW10W-30EXISTING RACKS TO REMAIN15.464RELOCATED WASTEOIL TANKMAC2ANEW 3/4" AIRNEW 1" WASTE OIL LINE15.461MAC3MAC2TB925TB801TB801(25 GALLON USED OIL RESERVOIR), KIT INCLUDES TB816(UP FLOW VENT).15.46015.466TYP15.40115.40215.42215.46015.46115.46415.46615.46815.47315.48115.482PLUMBING KEYNOTESCONNECT TO NEAREST DOMESTIC COLDWATER PIPE OF EQUAL OR LARGERSIZE. VERIFY SIZE AND LOCATION ATSITE. PROVIDE SHUT-OFF VALVE INNEW PIPE AT POINT OF CONNECTION.CONNECT TO EXISTING HOT WATERPIPE OF EQUAL OR LARGER SIZE.VERIFY SIZE AND LOCATION AT SITE.PROVIDE SHUT-OFF VALVE IN NEWPIPE AT POINT OF CONNECTION.EXISTING PIPING TO REMAIN (VERIFYLOCATION IN FIELD).NEW 2" GALVANIZED STEEL VENTPIPING THROUGH ROOF. INSTALLUPFLOW VENT CAP. DO NOT MANIFOLDVENT WITH OTHER TANK VENTS ORPLUMBING VENTS.PROPERLY CAP AND REMOVE EXISTINGWASTE OR BULK OIL LINES NOT BEINGREUSED.PROVIDE A MINIMUM OF 3"INSPECTION SPACE BETWEEN ALLWALLS, COLUMNS, TANK AND RAILINGS.SLOPE VENT PIPING BACK TO TANK AT1/8" PER FOOT.ROUTE PIPING IN NEW CHASE DOWNTHROUGH FLOOR TO PIT AREA. REF.ARCHITECTURAL DRAWINGS FORLOCATION.SUPPORT NEW PIPING WITHINSTRUCTURE OR AS CLOSE TO BOTTOMOF STRUCTURE AS POSSIBLE.COORDINATE ROUTING WITH EXISTINGEQUIPMENT.SUPPORT PIPING ALONG WALL.COORDINATE ROUTING WITH EXISTINGEQUIPMENT.ALL WORK TO BE DONE BY CERTIFIEDINSTALLER. REFERENCE ARCH.SPECIFICATIONS.ISSUE BLOCKRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:07-14-11 PLAN REV. #108-05-11 ADDENDUM #1EQUALEQUALNEW WASTEOIL PUMP1312ROUTE NEW PIPES AS HIGH AS POSSIBLE WITH HANGERS SUSPENDED ( PER SPECIFICATIONS) EVERY 4'-0" MINIMUM FROM PIT CEILING SUPPORT BEAMS. (DASHED LINES INDICATE ALTERNATE ROUTING OF PIPES THRU ALTERNATE FLOOR PENETRATION BETWEEN CATWALKS).NEW OIL FILTER CRUSHERTB925MAC213TB61012%TLE PIT PLUMBING PLAN1/4"=1'-0"RELOCATED DIY TANK, REF 10/MAC2CHECKED BY:DRAWN BY:JEEJMOTIRE & BATTERY STORAGEPROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-1115 141514EXISTING DUCTDOWN TO PITEXISTING 3/4" COLD WATERDOWNTHRU FLOORYCO ETRFPWH ETRCUSTOMER SERVICECO ETRFD ETRAFD ETRFD ETRFD ETR400CFMETR15.4661/2"15.422EF ETRTLE LUBE TRENCHSAWETRSAWETRTLE SERVICE BAYRTU-3710 TONETRTLERESTROOMEFETREAGETR50CFMETREAGETR250CFMETREF ETRSTORAGERTU-203 TONETR400CFMETRRAGETRNEW AST VENT PIPE, ROUTED FROM AST TANK IN PIT BELOW. REF: 2-MAC1 FOR CONTINUATION.NEW AST VENT PIPE, ROUTED FROM AST TANK IN PIT BELOW. REF: 2-MAC1 FOR CONTINUATION.4MAC3NEW 3/4" TEPIDWATER DOWN15.4682"V(2) 1" ELECTRICAL CONDUITS, REFERENCE ELECTRICAL SHEETS.15.4662"VMAC3TB816UPFLOW VENT CAPMAC3TB816UPFLOW VENT CAPA15.422FCO ETROI ETR3/4"FCO ETRLUBE & TIRE MOUNTING AREAA15.473AA3/4"TOILETAIRDRYERETR4MAC1AIRCOMPRESSORETRCUSTOMER SERVICE15.422100CFMETRSECURITY4MAC315.466SAFETY AREA TO BE MAINTAINEDFREE AND CLEAR FOR EYEWASH.REF: ARCH SHEETSNEW 1/2"TEPID WATERSECURITYSTORAGEMAC315.401S:\Wal-Mart\W447\D\W447MAC1 2 Aug 2011 - 5:08 pm%TLE MECHANICAL PLAN1/8"=1'-0"MAC115.468CO ETR2"VFD ETRTB816UPFLOW VENT CAPPREFERRED ROUTING. (2) NEW AST VENT PIPES, ROUTED FROM AST TANKS IN PIT BELOW. REF: 2-MAC1 FOR CONTINUATION.4MAC3RELOCATEDEWCFD ETRYCO ETRCONNECT NEWTEPID WATER LINETO NEW EYEWASHFD ETR%TLE PLUMBING PLAN1/8" = 1'-0"EW1FD ETRRELOCATE EXISTING EWC. REMOVE ABANDONED CW LINEFPWH ETREXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE IS RESPONSIBLE FOR HAVING FOR A THOROUGH HAVING A KNOWLEDGE THOROUGHOFALL KNOWLEDGE DRAWINGS AND OF SPECIFICATIONS ALL DRAWINGS AND THEIR SPECIFICATIONS RELATED FIELD. THE IN FAILURE THEIRTOACQUAINT THEMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THERESPONSIBILITY RELATED FIELD. OF THE PERFORMING FAILURE THE TO WORK ACQUAINT PROPERLY. THEMSELF NO ADDITIONAL WITH THISCOMPENSATION KNOWLEDGE DOES SHALL BE NOT ALLOWED RELIEVE BECAUSE THE RESPONSIBILITY OF CONDITIONS THAT OF OCCUR DUETO PERFORMING FAILURE TO FAMILIARIZE THE WORK WORKERS PROPERLY. WITH THIS NO ADDITIONAL COMPENSATIONKNOWLEDGE. SHALL BE ALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.AUTO CENTERMECHANICALPLANSSHEET:MAC1


GENERAL NOTESREFER TO SHEET P1 FOR GENERAL NOTES PERTAINING TO THIS SHEET.PLUMBING KEYNOTES15.401CONNECT TO NEAREST DOMESTIC COLD WATER PIPE OF EQUAL OR LARGER SIZE. VERIFY SIZE AND LOCATION AT SITE. PROVIDE SHUT-OFF VALVE IN NEW PIPE AT POINT OF CONNECTION.15.402CONNECT TO EXISTING HOT WATER PIPE OF EQUAL OR LARGER SIZE. VERIFY SIZE AND LOCATION AT SITE. PROVIDE SHUT-OFF VALVE IN NEW PIPE AT POINT OF CONNECTION.STIPULATION FOR REUSE15.406PLUMBING CONTRACTOR TO MAKE ALLNECESSARY DISCONNECTS ANDRECONNECTS OF PLUMBING FIXTURESBEING RELOCATED OR NEW.FD ETRMARKET MANAGER'S OFFICEFCO ETRFCO ETRDAIRY COOLERFD ETR4FD ETRFCO ETRHALLWAY4"15.422SSDELI FREEZERDELI COOLERSERVICE DELIFD ETR3CS ETRFD ETRFD ETRPLUMBING WORK:INSTALL LOAD OUT STATIONPUMP-OUT PIPING THROUGHEXTERIOR WALL PER THEMANUFACTURER'SINSTRUCTIONS. FIELDLOCATE PUMP-OUT FITTINGON THE OUTSIDE WALL ANDCOORDINATE THE LOCATIONWITH STORE MANAGERAND/OR WAL-MARTFD ETRFCO ETRHS ETRFD ETR HS ETRDEPT 82INSTALL OUTLET PIPE CONNECTION OUTSIDE COMPACTOR PAD WHERE APPLICABLE.FD ETR4" VENT THROUGH WALL WITH GOOSENECK4"DO NOT SUPPORT VENT PIPING FROM TANK2" EVACUATION PORT15.407P2FCO ETRRECEIVING-{GR}3/4"HWR GW15.422FULL PORT BALL VALVE IN RISER.15.40715.422REMOVE ALL EQUIPMENT, COMPONENTS,PIPING AND RETAINING HARDWARESERVING DELI WASTE OIL TANK BEINGREMOVED. REF. ARCHITECTURAL.EXISTING PIPING TO REMAIN (VERIFYLOCATION IN FIELD).ISSUE BLOCKRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:07-14-11 PLAN REV. #1SSFD ETRFD ETR15.422FD ETRROUTE 1/2" TEPID WATER FROM ETMV1 TO EYEWASH15P2FCO ETR15.402FDETRFD ETRFD ETRSSFD ETRFD ETRFD ETR4"15.422FD ETRFD ETR FD ETRCLEAN AND CAULK EXISTING SERVICE SINK.STOCKROOMRE-ROUTE EXISTING 1/2"CW SERVING EYEWASH TO NEW ETMV115.401SAFETY AREA TO BE MAINTAINED FREE ANDCLEAR FOR EYEWASH.REF: ARCH SHEETSCHECKED BY:DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:JEESAR18811-19-1002-09-114"15.422FD ETRFCO ETRFD ETR1-1/4"HW15.42208-05-11 ADDENDUM #12-1/2"CWFD ETRHBETRHBETRFCO ETRFD ETRETMV1P2REPLACE EYEWASH WITH NEW EW1 AS INDICATED15.406P2P2SSNOT USED4"15.422FD ETRGROCERY FREEZERGWELECTRICAL ROOM #5S:\Wal-Mart\W447\D\W447GP11 3 Aug 2011 - 4:18 pm%VENT THRU ROOF (VTR)NTSMATCH LINEREAR GROCERY PLUMBING PLAN1/8"=1-0"MATCH LINEEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGH KNOWLEDGE OFALL DRAWINGS AND SPECIFICATIONS IN THEIR RELATED FIELD. THE FAILURE TOACQUAINT HIMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITYOF PERFORMING HIS WORK PROPERLY. NO ADDITIONAL COMPENSATION SHALL BEALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.REARPLUMBINGPLANSHEET:GP1.1


SINKGENERAL NOTESREFER TO SHEET E1.1 FOR GENERAL NOTES PERTAINING TO THIS SHEET.ELECTRICAL KEYNOTES16.125EXISTING LIGHT FIXTURES TO REMAIN UNLESSNOTED OTHERWISE.STIPULATION FOR REUSE15 14 13 12 11 10BALERPHARMACY STORAGEFIRECORRIDORSECURITY ROOMFIRECORRIDORUPC/INVOICINGPHOTO STORAGEMANAGER'S OFFICECORRIDORMARKET MANAGER'S OFFICE4FIXTURE STORAGESPRINKLERTRAININGBALEREXISTING DOCK LIGHT TO REMAIN. TYPCOMPACTORTIRE & BATTERY STORAGECUSTOMER SERVICETOILETRECEIVING-{GM }STOCKROOM16.125DEPARTMENTMANAGER'SWORKSTATIONTYPELECTRICALROOM #1STOCKROOMCLAIMSPHOTO LABSITE TO STOREJANITORBREAKROOMASSOCIATES MEN'S RESTROOMASSOCIATES WOMEN'S RESTROOMPERSONNELAP OFFICEFIXTURESBREAKROOMCUSTOMER MENCUSTOMER WOMENMANAGEMENT16.125 TYPE1.2DAIRY COOLERHALLWAY16.125TYPDELI FREEZERDELI COOLERTYPDELI PREPSERVICE DELI16.125DEPT. 8216.125RECEIVING-{GR}STOCKROOMEXISTING DOCK LIGHT TO REMAIN. TYPCOMPACTORFIRE CORRIDORRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:4ELECTRICAL ROOM #4E2.2ISSUE BLOCKLUBE & TIRE MOUNTING AREASECURITY16.125TYP.GROCERY FREEZERELECTRICALROOM #507-14-11 PLAN REV. #108-05-11 ADDENDUM #1MEAT COOLERSTORAGEFE5SALESMEAT PREPCHECKED BY:JEEEDRAWN BY:TJPPROTO:188MEAT HOLDINGPROTO CYCLE:11-19-10GROCERY COOLERDOCUMENT DATE:02-09-1116.125 TYPGROCERY SALESICE CREAM FREEZERSEAFOOD COOLERSEAFOOD PREPSEAFOOD FREEZERSEASONAL SHOPPRODUCE PREPMONEYCENTERCAKE DECORATINGPRODUCE COOLEREXTERIOR WALL PACK SECURITY LIGHT FIXTURE TO REMAIN. TYP OF ALL EXTERIOR PERIMETER LIGHTING FIXTURES.E1.1BAKERYBAKERY COOLERPHARMACYSUBWAYRBAKERY FREEZERBS:\Wal-Mart\W447\D\W447E1 2 Aug 2011 - 4:03 pmGARDEN CENTER4E1.1CART STORAGE-{GM }OTHER INCOME-GMELECTRICAL ROOM #3VESTIBULE-{GM }VISION CENTERCOUNTCASHCOURTESY DESKCORRIDORJANITORMENWOMENPICTURE MEREGAL NAILSE1.1%LIGHTING PLAN1" = 20'-0"SMART STYLEBANKEXISTING LIGHT FIXTURES (NOT SHOWN) SHALL REMAINWIRELESS STORECARTSTORAGEVESTIBULE-{GR }OTHER INCOME-GRELECTRICAL ROOM #2E1.1PLUMBING/MECHANICALGE1GE1EXISTING CONDITIONS WERE TAKEN FROM ORIGINALDRAWINGS AND MAY NOT REFLECT EXACT"AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELDVERIFY ALL EXISTING CONDITIONS PRIOR TOSUBMITTING FINAL BIDS. CONTRACTOR SHALLCAREFULLY COORDINATE NEW WORK AND DEMOLITIONWITH ALL OTHER DISCIPLINES AND EXISTINGCONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVINGA THOROUGH KNOWLEDGE OF ALL DRAWINGS ANDSPECIFICATIONS IN THEIR RELATED FIELD. THEFAILURE TO ACQUAINT THEMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITYOF PERFORMING THE WORK PROPERLY. NOADDITIONAL COMPENSATION SHALL BE ALLOWEDBECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.SHEET:LIGHTINGPLANE1


CEILINGLIGHTING FIXTURE SCHEDULEELECTRICAL KEYNOTESMOUNT FIXTURES IN CORNER OF RESTROOM WALL AND CEILING. INSTALL PER MANUFACTURER'S SPECIFICATIONS, TYP.NUMBER6A6B6C1742MANUFACTURERPAULUHNLDPIGUTH - CODETITEDUAL-LITEDAY-BRITENOTE: FIXTURES AND LAMPS BELOW SHALL BE FURNISHED AND INSTALLED BY CONTRACTOR.CATALOG NUMBERFWFN240S-276384-430-4-CCCP4A-2F40-2LZW2DIDWDE232-277-1/2EB-LT-LP-WMVBVOLTS VA277 80277 80277 8027715277 58(NOTE A)LAMP (PHILIPS)ORDER NUMBERF40T12F40T12F40T126V, 5W HALOGENF32T8/TL850/PLUS/ALTOQTYMOUNTINGDESCRIPTIONSURFACEHAZARDOUS LOCATION STRIPSURFACEHAZARDOUS LOCATION STRIPSURFACEHAZARDOUS LOCATION STRIPWALLEMERGENCY LIGHTSURFACE4' SEALED STRIP16.12516.129EXISTING LIGHT FIXTURES TO REMAIN UNLESSNOTED OTHERWISE.CONNECT TO EXISTING CIRCUIT PREVIOUSLYSERVING AREA LIGHTING THAT WASREMOVED. MAINTAIN EXISTING CIRCUITCONTROL UNLESS NOTED OTHERWISE.PROVIDE CONSTANT HOT FOR EMERGENCY,EXIT, AND LOCALLY CONTROLLED LIGHTFIXTURES.RESTROOMFLOOR%LIGHT FIXTURE MOUNTINGNTS%LIGHT FIXTURE NOTES: (APPLIES TO ALL LIGHT FIXTURES)A.B.NOTE: FIXTURES AND LAMPS BELOW SHALL BE FURNISHED BY WAL-MART AND INSTALLED BY CONTRACTOR.(NOTE B)FOR FIXTURES AND LAMPS CONTACT:HUNZICKER BROTHERS AT 800-324-1026 OR HAINES, JONES & CADBURY, INC. 800-459-7099.FOR FIXTURES AND LAMPS CONTACT:LITHONIA LIGHTING, CONYERS, GA. (800) 447-2422, EXT 2902. CHERRYL BRUCEC. IF REQUIRED BY APPLICABLE BUILDING CODE, SUPPORT ALL RECESSED OR LAY-IN LIGHT FIXTURES,DIRECTLY FROM THE FIXTURE HOUSING TO THE STRUCTURE ABOVE, WITH A MINIMUM OF TWO 12-GAUGEWIRES LOCATED AT DIAGONALLY OPPOSITE CORNERS. FIXTURE SUPPORT WIRES MAY BE SLIGHTLY16.14916.S04REPLACE EXISTING LIGHT SWITCH WITHOCCUPANCY SENSOR.FURNISH AND INSTALL NEW TUBE GUARDSAND CAPS ON ALL EXPOSED LAMPS IN THISAREA.STIPULATION FOR REUSELOOSE TO ALLOW THE FIXTURE TO SEAT IN THE GRID SYSTEM. ATTACH LIGHT FIXTURES TO THESUSPENDED CEILING SYSTEM TO RESIST 100 PERCENT OF FIXTURE WEIGHT ACTING IN ANY DIRECTION.NEOPRENE WASHERAND 1/4"-20 BOLTTYPPROVIDE PREMOLDEDCLOSURE STRIP TYPMETAL CANOPY DECKREF ARCHITECTURALDRAWINGSNOT USEDCOMPLETE IN ACCORDANCE WITH APPLICABLE BUILDING CODE REQUIREMENTS.FURNISH AND INSTALL MOUNTING BRACKET TO MOUNTFIXTURE TO CANOPY DECK PER THE MANUFACTURER'SRECOMMENDATIONS. DO NOT DRILL OR PENETRATE FIXTUREHOUSING. IF FIXTURE HOUSING IS PENETRATED OR DAMAGED,THE CONTRACTOR IS RESPONSIBLE FOR FIXTURE REPLACEMENT.CANOPY LIGHTING DETAILNTSCANOPY LIGHTING DETAILNTSRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:NOT USEDISSUE BLOCK07-14-11 PLAN REV. #108-05-11 ADDENDUM #1NOT USEDNOT USEDCHECKED BY:JEEDRAWN BY:TJP4SHADE CLOTH LIGHTINGNTSTRUCK DOCK LIGHTINGNTSREAR RESTROOM LIGHTING PLAN1/4"=1'-0"PROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11SPRINKLERTRAINING16.S04PHOTOSTORAGEEXISTING LIGHTING (NOT SHOWN) SHALL REMAINFIRECORRIDORELECTRICAL ROOM #1CLAIMSFIXTURESFIRECORRIDORTYP 16.125DEPARTMENTMANAGER'SWORKSTATIONTELZONCHARGINGSTATIONUPC/INVOICING16.S04OSBREAKROOM16.149OSMANAGER'S OFFICE16.S04STOCKROOM16.125 TYPSECURITYROOM16.S04OS16.14916.S04APOFFICE16.S04OSMANAGEMENT16.S0416.149TYP16.125OSOS16.149E1.2JANITORSITE TO STOREROSBREAKROOM16.S04ASSOCIATEWOMEN'SRESTROOM16.125TYPCUSTOMER MENEXISTING RESTROOM NEEDS CLEANING LIGHT CONTROLS TO REMAIN, TYP.S:\Wal-Mart\W447\D\W447E12 4 Aug 2011 - 12:56 pmREAR OFFICE LIGHTING PLAN1/8"=1'-0"FURNISH AND INSTALL HUBBELL ATP1500C OCCUPANCY SENSOR WITH CU277A CONTROL UNIT, IN SERIES WITH EXISTING WALL MOUNTED SWITCHING.ASSOCIATE MEN'SRESTROOM16.125TYPCUSTOMER WOMENEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGH KNOWLEDGE OF ALLDRAWINGS AND SPECIFICATIONS IN THEIR RELATED FIELD. THE FAILURE TO ACQUAINTTHEMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OF PERFORMINGTHE WORK PROPERLY. NO ADDITIONAL COMPENSATION SHALL BE ALLOWED BECAUSE OFCONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.ENLARGEDLIGHTINGPLANSDETAILS ANDSCHEDULESSHEET:E1.2


SINKELECTRICAL KEYNOTESELECTRICAL KEYNOTESELECTRICAL KEYNOTEST5EABOVET5BH5C2H5C1H5DH5AL5D1L5D2%ELECTRICAL ROOM #51/8"=1'-0"L5ENOVARCONTROLPANELPOWERSUPPLYMODULENOVARBOARD4FIREALARMPANELH3SL3FH3CH3AXFMRT3F(ABOVE)L3D1L3D2DATARACKELECTRICAL%ROOM #31/8"=1'-0"H3DXFMRT3DXFMRT2E(ABOVE)4L2EL2U1L2D1UPSPOWERSUPPLYMODULEDATARACKL2D2L2BL2D3L2D4H2DNOVARCONTROLPANELELECTRICAL%ROOM #21/8"=1'-0"XFMRT2D(ABOVE)XFMRT1E(ABOVE) L1U L1ENOVAR & FIRE ALARM BOARDNOVARCONTROLPANELUPSXFMRT1D(ABOVE)POWERSUPPLYMODULEL1D2L1D1L1FH1C3H1C2H1C1H1AXFMRT1F(ABOVE)MSWB%ELECTRICAL ROOM #11/8"=1'-0"16.22816.23416.47016.471INSTALL RECEPTACLE IN PROVIDED DATA ENCLOSURE. COORDINATE LOCATION OF RECEPTACLE WITH ISD CABLE VENDOR.EXTERIOR SIGN POWER: MOUNT JUNCTION BOX(ES) TO WALL IN CEILING SPACE 6" BELOW BOTTOM CHORD OF BAR JOIST, UNLESS NOTED OTHERWISE. COORDINATE LOCATION OF ACCESS DOORS AND PROVIDE FINAL POWER TERMINATIONS. REFER TO ARCHITECTURAL DRAWINGS FOR EXACT SIGN LOCATION(S) PRIOR TO INSTALLATION. TOGGLE SWITCH PROVIDED WITH SIGN.FURNISH AND INSTALL NEW 20 AMP,120 VOLT CIRCUIT(S). FEED FROM PANELBOARD AS INDICATED.PROVIDE20A-1P CIRCUIT BREAKER IF NEEDED. EC SHALL MATCH TYPEAND AIC RATINGS OF EXISTING CIRCUIT BREAKERS. EC SHALLVERIFY PRIOR TO ROUGH-IN THAT EXISTING PANELBOARD HASSPARE CAPACITY TO ACCOMMODATE ADDITIONAL LOAD.FURNISH AND INSTALL NEW 20 AMP,120 VOLT ISOLATED GROUND CIRCUIT(S). FEED FROMPANELBOARD AS INDICATED. PROVIDE 20A-1P CIRCUIT BREAKERIF NEEDED. EC SHALL MATCH TYPE AND AIC RATINGS OFEXISTING CIRCUIT BREAKERS. PROVIDE ORANGE COVER PLATESON ALL ISOLATED GROUND DEVICES WITH CIRCUIT NUMBERENGRAVED UNLESS NOTED OTHERWISE. EC SHALL VERIFYPRIOR TO ROUGH-IN THAT EXISTING PANELBOARD HAS SPARECAPACITY TO ACCOMMODATE ADDITIONAL LOAD.STIPULATION FOR REUSE15 14 13 12 11 104BALERPHARMACY STORAGECORRIDORSECURITYROOMSPRINKLERUPC/INVOICINGPHOTO STORAGEMANAGER'S OFFICEE2.4MARKET MANAGER'S OFFICEFIXTURE STORAGEBALERELECTRICALROOM #1FIXTURESLUBE & TIRE MOUNTING AREACOMPACTORTIRE & BATTERY STORAGECUSTOMER SERVICERECEIVING-{GM}EXISTINGETHERNETSWITCHTOILETBIKE BUILDERS DESKE2.4REPLACE BROKEN ELECTRICAL COVERS AND RECEPTACLES. TYPICAL OF ALL STOCKROOM/RECEIVING AREAS.STOCKROOMSTOCKROOME2JANITORNETWORKTVETRSITE TO STOREBREAKROOMNETWORKTVETRTRAININGASSOCIATES MEN'S RESTROOMASSOCIATES WOMEN'S RESTROOMCBLAP OFFICEMANAGEMENTCUSTOMERMENCUSTOMERWOMENCORRIDORNETWORKTVETRHALLWAYDAIRY COOLERDELI FREEZERDELI COOLERDELI PREPSERVICE DELIDEPT. 82RECEIVING-{GR}16.22837L5D116.471STOCKROOMGE2COMPACTORFIRE CORRIDOR4E2.4RUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:ISSUE BLOCKSECURITYGROCERY FREEZERELECTRICALROOM #507-14-11 PLAN REV. #108-05-11 ADDENDUM #1ELECTRICAL ROOM #4GENERAL POWER NOTES09.24.10EN02E21.STORAGEMEAT COOLERFTELEPOWER POLE(S): MOUNT JUNCTION BOX(ES) TO TOP SIDE OF BOTTOM CHORD OF BAR JOIST. INSTALL FURNISHED PRE-WIRED POWER POLE AND TERMINATE PROVIDED FLEXIBLE CONDUIT AND WIRING TO JUNCTION BOX. PROVIDE UNISTRUT SUPPORTS AND HARDWARE TO SECURE TELEPOWER POLE PLUMB TO BUILDING STRUCTURE.E52.EXISTING PHOTO LABSALESMEAT PREPEXISTINGETHERNETSWITCH3.PROVIDE LIQUID-TIGHT FLEXIBLE METAL CONDUIT AND WIRING FROM DISCONNECT SWITCH OR JUNCTION BOX TO EQUIPMENT KNOCKOUT OR ELECTRICAL CONNECTION POINT.WHERE EQUIPMENT NAMEPLATE PROTECTIVE DEVICE RATING DIFFERS FROM SIZE PROVIDED, CHANGE OUT BRANCH CIRCUIT WIRING AND OVERCURRENT DEVICE TO APPROPRIATE RATING PER NEC.CHECKED BY:JEEE4.DRAWN BY:TJPLPTVETRGENERAL CONTRACTOR TO PROVIDE ONE NEW 20 AMP, 120 VOLT CIRCUIT FOR EACH PIECE OF NEW EQUIPMENT AS FOLLOWS: (1) HP PRINTER (24" WIDE FORMAT PRINTER), (1) HP COLOR PRINTER AND (1 OR 2) DL PRINTER(S) AS SHOWN ON DRAWINGS. FEED FROM NEAREST 120 VOLT PANEL WITH ADEQUATE SPACE AND AMPACITY. PROVIDE NEW CIRCUITS TO STRUCTURE ABOVE EXISTING PHOTO LAB PRIOR TO EQUIPMENT VENDOR ARRIVAL. VERIFY FINAL DROP LOCATION WITH VENDOR PLACEMENT OF EQUIPMENT.REPLACE BROKEN ELECTRICAL COVERS AND RECEPTACLES. TYPICAL OF ALL SALES FLOOR AREAS.GROCERY SALESMEAT HOLDINGGROCERY COOLERICE CREAM FREEZERELECTRONIC FIRE PROTECTION/SECURITY ALARM BOXES AND CONDUITS SHOWN ON POWER PLANS SHALL BE PROVIDED UNDER THIS CONTRACT. IN ADDITION, UNLESS NOTED OTHERWISE, THE FOLLOWING GENERAL NOTES APPLY:A.B.ALL ALARM JUNCTION BOXES SHALL BE 4"X4"X2-1/8" MINIMUM.ALARM RACEWAYS SHALL BE 3/4" MINIMUM WITH PULL WIRE AND INSULATING BUSHINGS AT END OF VERTICAL RACEWAY RUN.PROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11C.LPTVETRGENERAL CONTRACTOR TO PROVIDE ONE CONDUIT AND PULL WIRE AS REQUIRED FOR NEW DATA LINE FOR EACH PIECE OF NEW EQUIPMENT AS FOLLOWS: (1) HP PRINTER (24" WIDE FORMAT PRINTER), (1) HP COLOR PRINTER AND (1) CONDUIT AND PULL WIRE FOR (1 OR 2) DL PRINTER(S) AS SHOWN ON DRAWINGS.SEAFOOD FREEZERVERTICAL RACEWAYS FROM ALARM BOXES SHALL BE EITHER CONCEALED INSIDE WALL OR SURFACE MOUNTED (TO MATCH JUNCTION BOX MOUNTING). ALL VERTICAL RUNS SHALL BE TURNED 90-DEGREES AT TOP SIDE OF BOTTOM CHORD OF BAR JOIST AND EXTENDED HORIZONTALLY TO A LOCATION ACCESSIBLE BY VERTICAL FLOOR TYPE LIFT.SEASONAL SHOPNETWORKTVETRNETWORKTVETRNETWORKTVETRNETWORKTVETRNETWORKTVETRNETWORKTVETRSEAFOOD COOLERPRODUCE PREPSEAFOOD PREP5.6.UPON COMPLETION OF ELECTRICAL INSTALLATION AND PRIOR TO ENERGIZING CIRCUIT:A.B.C.INSPECT WIRE AND CABLE FOR PHYSICAL DAMAGE.PERFORM CONTINUITY TEST.VERIFY PROPER PHASING CONNECTION TO ALL THREE PHASE MOTOR LOADS.REPLACE ANY BROKEN ELECTRICAL DEVICES ANDCOVERS IN STORE.S:\Wal-Mart\W447\D\W447E2 3 Aug 2011 - 4:16 pmGARDEN CENTERE2.4EXISTINGETHERNETSWITCHPHARMACYREPLACE BROKEN COVERS AND RECEPTACLES. NEW COVERS, CONNECTIONS, AND EXPOSED CONDUIT SHALL BE WEATHERPROOF. NEW RECEPTACLES SHALL BE WEATHERPROOF, GFI WITH WHILE-IN- USE COVER. TYP OF ALL GARDEN CENTER DEVICES.EXISTINGETHERNETSWITCHE2.3LPTVETRRELOCATEDTENANTSIGNAGE16.23416.470L3FELECTRICAL ROOM #3CART STORAGE-{GM}OTHER INCOME-GMLPTVETRVESTIBULE-{GM}4E2VISION CENTERLPTVETRCOURTESY DESKCOUNTCASHE2.3CORRIDORJANITORMENWOMENE2.3PICTURE MEREGAL NAILSSMART STYLE%POWER PLAN1" = 20'-0"4E2.3 NETWORK TVETRBANKWIRELESSSTORELPTVETRCARTSTORAGEVESTIBULE-{GR }SUBWAYCAKE DECORATINGR16.470L2DE2ELECTRICAL ROOM #2OTHER INCOME-GRRELOCATEDTENANTSIGNAGE16.234E2.3BAKERYPRODUCE COOLERGE2BAKERY COOLERBAKERY FREEZERPLUMBING/MECHANICALB7.CONTRACTOR SHALL MAKE FINAL CONNECTION FROMEXISTING SIGN JUNCTION BOXES TO NEWILLUMINATED STORE SIGN. WHERE NEW ELECTRICALCONNECTIONS FOR SIGNAGE OCCUR ABOVE ROOFLINE, PROVIDE UNISTRUT TO MOUNT JUNCTION BOXESTO BACK SIDE OF PARAPET AND PROVIDE ONLY ONEPENETRATION THROUGH THE ROOF. REFARCHITECTURAL EXTERIOR WALL SECTIONS ANDWHIP DETAIL FOR ROOF AND PARAPET PENETRATIONREQUIREMENTS. VOLTAGE SHOULD BE NOMINAL 120V+/-5% AND NOT FLUCTUATE MORE THAN +/-5%(114V-126V) OVER TIME. READINGS SHOULD BE TAKENAT THE JUNCTION BOXES CLOSEST TO THE SIGNLETTERS. ALSO VERIFY THE VOLTAGE AT THEPANELBOARD FEEDING THESE CIRCUITS MEETS THESAME CRITERIA. IF THE EXISTING CIRCUITS DO NOTMEET THESE REQUIREMENTS, NOTIFY THE WAL-MARTCONSTRUCTION MANAGER FOR FURTHER DIRECTION.WHEN ELECTRICAL CONNECTIONS ARE BELOW ROOFLINE, COORDINATE LOCATION OF ACCESS DOORSWITH WAL-MART CONSTRUCTION MANAGER ANDEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGHKNOWLEDGE OF ALL DRAWINGS AND SPECIFICATIONS IN THEIRRELATED FIELD. THE FAILURE TO ACQUAINT THEMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING THE WORK PROPERLY. NO ADDITIONAL COMPENSATIONSHALL BE ALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.SHEET:POWERPLANE2


SINKELECTRICAL KEYNOTESELECTRICAL KEYNOTESELECTRICAL KEYNOTESELECTRICAL KEYNOTESPOWER DROP SCHEDULEPOWER DROP NOTES16.957 CONNECT CIRCUIT(S) TO EXISTING BRANCH16.W14CIRCUITRY. MINIMUM WIRE SIZE AND PANELBOARDCIRCUIT ARE NOTED. VERIFY SIZE, RATING ANDCONDITION OF EXISTING BRANCH CIRCUIT CONDUITAND WIRE PRIOR TO USE TO ENSURE THAT THEYMEET REQUIRED SIZE, AND ALL U.L. RATINGSAND REPLACE AS REQUIRED.NEW TELEPOWER POLES FURNISHED BYOWNER, INSTALLED BY ELECTRICALCONTRACTOR.(A) ELECTRICAL CONTRACTOR SHALLFURNISH AND INSTALL TWO JUNCTIONBOXES (PER POLE) LOCATED AT BOTTOMCHORD OF BAR JOIST. ATCHECKSTANDS, LOCATE BOTH JUNCTIONBOXES BETWEEN REGISTERS AND POLES.(B) THE ELECTRICAL CONTRACTORSHALL PLUMB AND ANCHOR POLES ATBASE AND TO STRUCTURE. TOP OFPOWER POLES MUST BE SECURED TOSTRUCTURE USING UNISTRUT.(C) FURNISH AND INSTALL 1/2" FLEXAS REQUIRED TO CONNECT POWERPOLES TO JUNCTION BOXES ATSTRUCTURE. ISOLATED GROUNDCIRCUITS SHALL NOT SHARE ANYJUNCTION BOX OR RACEWAY WITH16.470FURNISH AND INSTALL NEW 20 AMP,120 VOLT CIRCUIT(S). FEED FROM PANELBOARD AS INDICATED.PROVIDE 20A-1P CIRCUIT BREAKER IF NEEDED. EC SHALL MATCHTYPE AND AIC RATINGS OF EXISTING CIRCUIT BREAKERS. ECSHALL VERIFY PRIOR TO ROUGH-IN THAT EXISTING PANELBOARDHAS SPARE CAPACITY TO ACCOMMODATE ADDITIONAL LOAD.NO.PD1PD2PD3PD4DESCRIPTIONMOUNT RECEPTACLE(S) ON TOP OF DISPLAY UNIT(S)MOUNT RECEPTACLE(S) ON BASE OF DISPLAY UNIT(S)PROVIDE DIRECT CONNECTION TO EQUIPMENTOPEN STRUCTURE:MOUNT RECEPTACLE AT BARJOIST AND INSTALL FURNISHED CORD REELLAY-IN CEILING: PROVIDE RECESSED CEILINGRECEPTACLE AND INSTALL FURNISHED CORD REELBELOW CEILING. CORD REEL SHALL BE MOUNTEDTO CEILING FAN RATED JUNCTION BOX SECURED TOLAY-IN CEILING WITH T-BAR BOX HANGER. PROVIDE1/2" THREADED STEEL ROD FROM JUNCTION BOX TOBOTTOM OF STRUCTURAL JOIST OR CHANNEL1.2.3.PROVIDE JUNCTION BOX AND CIRCUITRY TO NEAREST JOIST ABOVE LOCATION SHOWN ON DRAWING. UPON INSTALLATION OF DISPLAY RACK, EXTEND CONDUIT AND CIRCUITRY FROM JUNCTION BOX TO ENDCAP OF GONDOLA (AWAY FROM ACTION ALLEY). PROVIDE CONDUIT AND RECEPTACLE(S) AT GONDOLA SHELVING PER POWER DROP SCHEDULE UNLESS NOTED OTHERWISE ON DRAWING.DURING THE BIDDING PROCESS A REVISION OF THIS PLAN BASED ON THE FINAL MERCHANDISE PLAN MAY BE ISSUED TO SHOW FINAL LOCATIONS FOR THE POWER DROPS. IF MERCHANDISE PLAN DOES NOT CHANGE, THIS PLAN WILL NOT BE REISSUED. PROVIDE CIRCUITRY TO DISPLAYS AND RACKS AS THEY ARE SET. THERE SHALL BE NO ADDITIONAL CHARGE FOR DROPS RELOCATED TO WITHIN 10 FEET FROM LOCATION ORIGINALLY SHOWN.FOR ALL GONDOLA MOUNTED RECEPTACLES, VERIFY EXACT HEIGHT AND LOCATION WITH STORE PLANNING SET-UP SUPERVISOR PRIOR TO INSTALLATION.STIPULATION FOR REUSESTANDARD CIRCUITS.15 14 13 12 11 10BALERPHARMACY STORAGECORRIDORSECURITY ROOMSPRINKLERUPC/INVOICINGPHOTO STORAGEMANAGER'S OFFICE4MARKET MANAGER'S OFFICEFIXTURE STORAGEBALER+90"COMPACTORTIRE & BATTERY STORAGECUSTOMER SERVICELPTV, +90"40RECEIVING-{GM }L1FBIKE BUILDERS DESKSTOCKROOMELECTRICALROOM #1STOCKROOMJANITORPHOTO LAB/SITE TO STORETRAININGBREAKROOMBREAKROOMFIXTURESAP OFFICECUSTOMERWOMENASSOCIATES WOMEN'S RESTROOMASSOCIATES MEN'S RESTROOMCUSTOMERMENMANAGEMENTCORRIDORDAIRY COOLERHALLWAYDELI FREEZERDELI COOLERDELI PREPSERVICE DELILPTV, +90"DEPT. 8242L5D116.470+90"RECEIVING-{GR}STOCKROOMCOMPACTORFIRE CORRIDORRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:TOILETLUBE & TIRE MOUNTING AREAELECTRICAL ROOM #4SECURITYGROCERY FREEZERELECTRICALROOM #5ISSUE BLOCK07-14-11 PLAN REV. #108-05-11 ADDENDUM #1STORAGEMEAT COOLERFSALES24'-10"MEAT PREPCHECKED BY:JEE16.W14EDRAWN BY:TJP34AFITTINGROOMS545'-11"MEAT HOLDINGPROTO:PROTO CYCLE:DOCUMENT DATE:18811-19-1002-09-11PHOTO LABL3D16.957#8WGROCERY SALESGROCERY COOLER35'-3"21'-9"05HPD432L3F16.470#10WICE CREAM FREEZERSEAFOOD FREEZERSEAFOOD COOLER12'-6"34L3F07BPD4PRODUCE PREPSEAFOOD PREP16.470#10WSEASONAL SHOP12'-9"CAKE DECORATINGPRODUCE COOLERPHARMACYMONEYCENTERSUBWAYRBAKERYBAKERY COOLERBAKERY FREEZERBS:\Wal-Mart\W447\D\W447E21 3 Aug 2011 - 5:47 pmGARDEN CENTERCART STORAGE-{GM}ELECTRICAL ROOM #3OTHERINCOMEVESTIBULE-{GM }VISION CENTERCASHCUSTOMERWOMENCOURTESY DESKCOUNTJANITORCUSTOMERMENCORRIDORPICTURE MEREGAL NAILSSMART STYLE%POWER DROP PLAN1" = 20'-0"BANKWIRELESS STORECARTSTORAGE-{GR}VESTIBULE-{GR}OTHER INCOME-GRELECTRICAL ROOM #2PLUMBING/MECHANICALEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGH KNOWLEDGE OF ALLDRAWINGS AND SPECIFICATIONS IN THEIR RELATED FIELD. THE FAILURE TO ACQUAINTTHEMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING THE WORK PROPERLY. NO ADDITIONAL COMPENSATION SHALL BE ALLOWEDBECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.SHEET:POWERDROPPLANE2.1


ELECTRICAL KEYNOTES12EXISTING POWER (NOT SHOWN) SHALL REMAIN1116.26016.451REPLACE EXISTING DEVICE AS NOTED ON PLAN. EXISTING BOX AND CIRCUITRY TO REMAIN. (UNLESS NOTED OTHERWISE).PROVIDE EMT WITH PROPERLY INSTALLED COMPRESSION OR SET- SCREW TYPE FITTINGS AND AN INSULATED GROUND CONDUCTOR FOR ALL RACEWAYS SERVING THIS ROOM TO COMPLY WITH NEC, HEALTH CARE FACILITIES.ETRETRPHARMACYETRETRWH ETRLPEXISTINGETHERNETSWITCH TOREMAINB16.47016.471FURNISH AND INSTALL NEW 20 AMP,120 VOLT CIRCUIT(S). FEED FROMPANELBOARD AS INDICATED. PROVIDE20A-1P CIRCUIT BREAKER IF NEEDED. ECSHALL MATCH TYPE AND AIC RATINGS OFEXISTING CIRCUIT BREAKERS. EC SHALLVERIFY PRIOR TO ROUGH-IN THATEXISTING PANELBOARD HAS SPARECAPACITY TO ACCOMMODATE ADDITIONALFURNISH AND INSTALL NEW 20 AMP,120 VOLT ISOLATED GROUND CIRCUIT(S). FEED FROMPANELBOARD AS INDICATED. PROVIDE 20A-1P CIRCUITBREAKER IF NEEDED. EC SHALL MATCH TYPE AND AICRATINGS OR EXISTING CIRCUIT BREAKERS. PROVIDEORANGE COVER PLATES ON ALL ISOLATED GROUNDDEVICES WITH CIRCUIT NUMBER ENGRAVED UNLESSNOTED OTHERWISE. EC SHALL VERIFY PRIOR TOROUGH-IN THAT EXISTING PANELBOARD HAS SPARECAPACITY TO ACCOMMODATE ADDITIONAL LOAD.STIPULATION FOR REUSEPHARMACY POWER PLAN1/8"=1'-0"NOT USED1'-6"DATA +24"RECEPT +18"STACKEDTYP3216.471L2EETRWIRELESS POWER PLAN1/4"=1'-0"16.W12ETHERNET CABLE:(A) FURNISH AND INSTALL JUNCTIONBOXES AND CONDUIT, AS SHOWN ON PLANSAND AS REQUIRED BY LOCAL CODES AND/ORORDINANCES.(B) ETHERNET CABLE IS FURNISHED BYOTHERS.(C) ELECTRICAL CONTRACTOR SHALLINSTALL CABLE IN POWER POLES.RUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:3'-3"3416.471L2EEF ETRISSUE BLOCK07-14-11 PLAN REV. #108-05-11 ADDENDUM #1NOT USEDCOURTESYDESKCOUNTINGCORRIDORCUSTOMER WOMENCUSTOMER MENCASHACHECKED BY:JEEEXISTING POWER (NOT SHOWN) SHALL REMAINDRAWN BY:PROTO:TJP188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-114%MONEY CENTER POWER PLAN1/4" = 1'-0"FRONT OFFICE POWER PLAN1/8"=1'-0"416.W71VOICE/DATA: FURNISH AND INSTALLAN OUTLET BOX WITH COVER AT EACHLOCATION SHOWN, AND 3/4" CONDUITWITH PULL WIRE, FROM EACH BOX TOBAR JOISTS. PROVIDE BUSHING ONEND OF CONDUIT AT BAR JOISTS. DONOT COMBINE DROPS WITH CONDUITROUTED FROM BOX-TO-BOX. INSTALLINDIVIDUAL CONDUIT TO EACH BOX.CARTSTORAGE-{GM }PROVIDE NEW COVER PLATES FOR EXISTING VESTIBULE RECEPTACLES PER SPECIFICATIONS. TYPPROVIDE NEW COVER PLATES FOR EXISTING VESTIBULE RECEPTACLES PER SPECIFICATIONS. TYPETRETRINSECTCONTROLETRETREXISTINGFIREEXISTING EAS SYSTEM PEDESTALS TO BE RELOCATED. DISCONNECT AND RECONNECT EXISTNG BRANCH CIRCUITRY AS REQUIRED, TYP.EF ETR16.470EMR1GFIEXISTING EAS SYSTEM PEDESTALS TO BE RELOCATED. DISCONNECT AND RECONNECT EXISTNG BRANCH CIRCUITRY AS REQUIRED, TYP.INSECTCONTROLETRETRETRETRCARTSTORAGE-{GR }S:\Wal-Mart\W447\D\W447E23 3 Aug 2011 - 6:07 pmTYP OF 916.2604E2GFIGFIGFIGFI 35+48"OTHERINCOME-GMGFI16.470 L3FGFITYPTYPGFIELECTRICAL ROOM #3GFI3116.W1216.W7116.470L3FGFIb16.470GFIL3Fb33+16" AND +40" STACKEDVESTIBULE-{GM}16.470L3F37INSECTCONTROL,+96"ELECTRONIC MEDICALRECORDS (EMR), +80"EXISTING PANEL LVADJUSTMENTSVISIONCENTERGM VESTIBULE POWER PLAN1/8"=1'-0"WAITING+44",PRETESTTYP 16.45110" 8"EMRCONTACTSRECORDRETENTIONSTORAGEHALLWAY16.451+54",TYP+44",TYP+44",TYPEMREMR10" 8"10" 8"10" 8"GFIEXAM #116.451GFIEXAM #216.451AWIRELESSSTOREINSECTCONTROL,+96"VESTIBULE-{GR }16.470L2D341+16"AND +40"STACKED16.47039L2D3b16.W12 TYP16.W71 TYP16.470+48"L2D3GR VESTIBULE POWER PLAN1/8"=1'-0"b37GFIELECTRICAL ROOM #2GFIEXISTINGREDBOXGFIOTHERINCOME-GRGFIGFIGFIGFIGFIGFIGFIGFIE2TYP OF 1016.260AEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGH KNOWLEDGE OF ALLDRAWINGS AND SPECIFICATIONS IN THEIR RELATED FIELD. THE FAILURE TO ACQUAINTTHEMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OF PERFORMINGTHE WORK PROPERLY. NO ADDITIONAL COMPENSATION SHALL BE ALLOWED BECAUSE OFCONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.ENLARGEDPOWERPLANSSHEET:E2.3


ELECTRICAL KEYNOTES16.470{}FURNISH AND INSTALL NEW 20 AMP, 120 VOLTCIRCUIT(S). FEED FROM PANELBOARD AS INDICATED.PROVIDE 20A-1P CIRCUIT BREAKER IF NEEDED. EC SHALLMATCH TYPE AND AIC RATINGS OF EXISTING CIRCUITBREAKERS. EC SHALL VERIFY PRIOR TO ROUGH-IN THATEXISTING PANELBOARD HAS SPARE CAPACITY TOACCOMMODATE ADDITIONAL LOAD.NOT USEDNOT USEDNOT USED16.492EC SHALL COORDINATE WITH GENERAL CONTRACTORAND ARCHITECTURAL DEMOLITION PLANS THE EXTENTOF ELECTRICAL DEMOLITION. REMOVE CONDUITS ANDWIRES ALL THE WAY BACK TO ORIGINATING JUNCTIONBOXES OR PANELBOARDS. DEMOLITION SHALL NOTAFFECT ACTIVE CIRCUITS. LABEL DEMOLISHEDCIRCUIT(S) IN PANELBOARDS AS "SPARE". COORDINATEEXACT REQUIREMENTS WITH EXISTING CONDITIONSPRIOR TO BID.{}STIPULATION FOR REUSEGARDEN CENTERDOOR POWER PLAN1/8"=1'-0"AP/MANAGEMENT OFFICE POWER PLAN1/4"=1'-0"{PROVIDE A NEMA 5-20R SINGLE RECEPTACLE ON A DEDICATED CIRCUIT ADJACENT TO THE LOAD OUT STATION. INSTALL RECEPTACLE AT 48" AFF AND WITHIN 4' OF THE TANK.}WASTE OIL TANKMG2141L5D116.470RECEIVING-{GR}REPLACE BROKEN ELECTRICAL COVERS AND RECEPTACLES. TYP OF ALL STOCKROOM/RECEIVING AREAS12TRAINING ROOM POWER PLAN1/4"=1'-0"RUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:RECEIVING-{GM}ISSUE BLOCK07-14-11 PLAN REV. #1EXISTING POWER (NOT SHOWN) SHALL REMAINEXISTING POWER (NOT SHOWN) SHALL REMAINNOT USED08-05-11 ADDENDUM #1RECONNECT TO EXISTING COMPACTOR CIRCUITRY AS REQUIRED.RECONNECT TO EXISTING COMPACTOR CIRCUITRY AS REQUIRED.RECONNECT TO EXISTING COMPACTOR CIRCUITRY AS REQUIRED.ETR#10WRECONNECT TO EXISTING COMPACTOR CIRCUITRY AS REQUIRED.#10WETRNEMA 1 (30A-3P), +60"NEMA 1 (30A-3P), +60"ODORNEUTRALIZERETRODORNEUTRALIZERETREXISTING ETHERNETSWITCH TO REMAINCHECKED BY:JEE4GR RECEIVING POWER PLAN1/8"=1'-0"GM RECEIVING POWER PLAN1/8"=1'-0"SITE TO STORE POWER PLAN1/4"=1'-0"DRAWN BY:PROTO:PROTO CYCLE:TJP18811-19-10DOCUMENT DATE:02-09-11E2EXISTING POWER (NOT SHOWN) SHALL REMAINE2.4ELECTRICALROOM #1CLAIMSSPRINKLERCORRIDORPHOTOSTORAGEFIXTURESUPC/INVOICINGTRAININGDEMOLISHED EXHAUST FAN16.492DEPARTMENTMANAGER'SWORKSTATIONREPLACE BROKEN ELECTRICAL COVERS AND RECEPTACLES.TELZONCHARGINGSTATIONTCMANAGER'SOFFICEEF ETRSECURITYROOMPERSONNELBREAKROOMEF ETRE2.4APOFFICEMANAGEMENTETRETRETRSTOCKROOMSITE TO STOREBREAKROOM COUNTER TO BE REPLACED BY GENERAL CONTRACTOR. EXTEND/REROUTE EXISTING CIRCUITRY TO NEW COUNTER LOCATION AND RECONNECT AS REQUIRED. REPLACE GFI RECEPTACLES AS REQUIRED. COORDINATE ALL WORK WITH WAL-MART CONSTRUCTION MANAGER.ASSOCIATE WOMENSCUSTOMER MENJANITOREF ETRS:\Wal-Mart\W447\D\W447E24 2 Aug 2011 - 4:42 pmREAR OFFICE POWER PLAN1/8"=1'-0"E2.4BREAKROOMASSOCIATE MENSCUSTOMER WOMENEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGH KNOWLEDGE OF ALLDRAWINGS AND SPECIFICATIONS IN THEIR RELATED FIELD. THE FAILURE TO ACQUAINTTHEMSELF WITH THIS KNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OF PERFORMINGTHE WORK PROPERLY. NO ADDITIONAL COMPENSATION SHALL BE ALLOWED BECAUSE OFCONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.ENLARGEDPOWERPLANSSHEET:E2.4


VISION CENTER208/120V11.19.10(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)PANELBOARD NOTES ()TERMINATE GROUND ON ISOLATED GROUND BUS.INSTALL LOCKING DEVICE (LOCK-OFF FOR MAINTENANCE). LOCKING DEVICE SHALL BE UL LISTED. MANUFACTURER SHALL MATCH EXISTING PANELBOARD MANUFACTURERINSTALL LOCKING DEVICE (LOCK-ON FOR CRITICAL LOAD).GFI BREAKER.GFEP CIRCUIT BREAKER.REFER TO ONE-LINE DIAGRAM FOR AVAILABLE FAULT CURRENT FOR INTERRUPT RATINGS.REFER TO ONE-LINE DIAGRAM FOR WIRE SIZES.FACTORY WIRED TO LOAD.BREAKER SHALL BE HIGH MAGNETIC TYPE.NEW PNLBD TO REPLACE EXISTING PNLBD WITH THE SAME NAME. NEW PNLBD POPULATION WAS DETERMINED BY ORIGINAL CONSTRUCTION DRAWINGS. E.C. SHALL VERIFY THAT ALL EXISTING BRANCH CIRCUITS ARE EXTENDED TO NEW PNLBD LOCATION. E.C. SHALL VERIFY CONDITION OF EXISTING BRANCH CIRCUIT CONDUIT AND WIRE TO EXTEND PRIOR TO USE, TO INSURE THAT THEY MEET ALL U.L. RATINGS AND REPLACE AS REQUIRED.ROUTE CIRCUIT THROUGH "SWEATMISER PNLBD"EN04CONDUCTOR SIZE HAS BEEN INCREASED FOR VOLTAGE DROP. SIZE EQUIPMENT GROUNDING CONDUCTOR PROPORTIONATELY PER NEC.LOCATION: ELECTRICAL ROOM #1SERVES: GENERAL POWERTWO SECTIONS: 225A SUB-FEED LUGS111315171923252729333537394143L1F13592131DESCRIPTIONSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSEXISTING LOAD(13)EXISTING LOAD(13)SPACE AND PROVISIONSEXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)SPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONS 20 10.18SPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSWIRE BRKR PL202020 1202020202020202020120 1202020 1202020 1202011111111111111110.000.000.720.720.900.000.000.00A0.001.880.600.360.000.540.180.00PANELBOARD(EXISTING)0.000.540.720.720.900.000.00KVAB0.001.880.541.081.390.720.180.000.600.720.360.360.00C0.000.600.721.081.390.72120/208V, 3PH, 4W225A MAIN LUGS ONLYPL BRKR WIRE DESCRIPTION111 20111 20111 20111121 20EXISTING LOAD(13)1 20EXISTING LOAD(13)0.36 1 20HIRING KIOSK(1)1 20 HIRING KIOSK(1)1 20 LPTV GM RECEIVING112020202020202020202020202010,000 AICGROUND BARISOLATED GROUND BARSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSEXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)DATA CABINETEXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)SPACE AND PROVISIONSSURFACE MOUNT2468101214161820222426283032343638404244NOTE11.19.10 EN09{ARRONE-LINE DIAGRAM LEGEND11.19.10 ES05NEW EQUIPMENTEXISTING EQUIPMENTEQUIPMENT TO BE DEMOLISHEDNOTE:ALL OF THE ELECTRICAL DEVICES SHOWN ON THE RISER DIAGRAM AREEXISTING AND ARE BASED UPON AS-BUILT DRAWINGS. E.C. SHALL VERIFYTHE EXACT EXISTING CONDITIONS, SIZES AND LOCATIONS OF EQUIPMENTPRIOR TO ROUGH-IN. THIS RISER IS SHOWN FOR INFORMATIONAL PURPOSESONLY AND ANY NEW DEVICES ARE SHOWN IN BOLD AND ARE NOTED. DURINGCONSTRUCTION, THE STORE SHALL STAY OPEN FOR BUSINESS. ANYNECESSARY POWER DOWNTIME SHALL BE SCHEDULED AND APPROVED BYWALMART CONSTRUCTION MANAGER.STIPULATION FOR REUSE(13)(14)(15)(16)(17)(18)(19)(20)(21)(22)(23)(24)(25)EXISTING CIRCUIT TO REMAIN.ROUTE CIRCUIT THROUGH NEW CONTACTORPROVIDE INTERLOCK WIRING WITH EXHAUST HOOD ANSUL SYSTEM.CIRCUIT TO BE RELOCATED FROM EXISTING PANELBOARD.PROVIDE LUG ADAPTERS AS REQUIRED.HACR CIRCUIT BREAKER.EXISTING CIRCUIT BREAKER TO REMAIN. VERIFY CONDITION OF CIRCUIT BREAKER TO ENSURE THAT IT IS OPERATIONAL AND MEETS ALL U.L. RATINGS.ROUTE CIRCUIT THROUGH EXISTING LCU CABINET UTILIZING EXISTING RELAY AND CONTROLS. UPDATE LCU IDENTIFICATION SCHEDULE WITH LOAD IDENTIFICATION.PROVIDE HANDLE LOCK OFF DEVICE TO LOCK "SPARE" CIRCUIT BREAKER IN THE "OFF" POSITION. IF CIRCUIT BREAKER IS IDENTIFIED AS "EXISTING", FIELD VERIFY CIRCUIT BREAKER INDICATED IS NOT CONNECTED TO ANY LOAD AND UPDATE PANELBOARD CIRCUIT DIRECTORY IDENTIFYING CIRCUIT AS "SPARE".PROVIDE U.L. LISTED OVERCURRENT DEVICE TO COORDINATE AND MAINTAIN MANUFACTURER'S SERIES RATED SYSTEM.{SOLENOID OPERATED CIRCUIT BREAKER. REFER TO ENERGY MANAGEMENT PLANS FOR CIRCUIT BREAKER CONTROL.}{TRACE EXISITING CIRCUIT, IDENTIFY LOAD AND PROVIDE COMPLETE TYPEWRITTEN PANELBOARD IDENTIFICATION SCHEDULE AND PLACE ON INTERIOR OF PANELBOARD DOOR. IF CIRCUIT IS A "SPARE" THEN REFER TO PANELBOARD NOTE (21).}{PROVIDE LISTED HANDLE-TIE BETWEEN CIRCUIT BREAKERS SHARING COMMON NEUTRAL FOR SIMULTANEOUS TRIP.}4547495153555759SPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSEXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)20 1TOTAL CONNECTEDTOTAL CONNECTEDTOTAL LOADPER NEC ARTICLE 220 FEEDER LOAD20202020120 12020111110.000.547.0458.6725.0225.020.000.60KVAKVA0.000.000.549.8181.750.000.000.60BUILDING ELECTRICAL SERVICE LOAD SUMMARYLOAD DESCRIPTIONEXISTING PEAK UTILITY LOAD @ 0.9 pfHVAC - SUMMERHVAC - WINTERLIGHTING (PER NEC-220)RECEPTACLESMOTOR LOADSLARGEST MOTOR LOADSUPPLEMENTAL ELECTRIC HEATMISCELLANEOUS EQUIPMENTREFRIGERATION EQUIPMENTEXTERIOR LIGHTINGEXISTING LOAD TO BE DELETEDTOTAL LOADTOTAL AMPACITYSERVICE AMPACITY0.000.000.548.1768.0869.5069.50BUILDING OCCUPANCY TYPE:BUILDING SQUARE FOOTAGE:0.000.600.5411111111KVA2020202020202020AMPSAMPSAMPS210,000SPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSSPACE AND PROVISIONSEXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)EXISTING LOAD(13)ConnectedKVAN/ASERVICE DESCRIPTION:480Y/277V, 3PH, 4W0.000.000.3860.000.000.000.000.001.000.000.0061.3873.862000DemandFACTORKVAAMPSAMPS125%100%100%125%100%;50%100%125%100%100%100%125%100%DemandKVA46485052545658601160.000.000.000.4860.000.000.000.000.001.000.000.001221.481469.892000CONTACTOR SCHEDULEARCNOT USEDWARNINGLOW VOLTAGE WIRINGALL LOW VOLTAGE WIRING AND CABLE IS REQUIRED TO BE PLENUM RATED. COORDINATE PROPER CABLE TYPES REQUIRED WITH WAL-MART ALARM DIVISION AND WAL-MART CONSTRUCTION MANAGER PRIOR TO INSTALLATION.CIRCUIT SCHEDULEALL CONDUCTOR SIZES ARE BASED ON 75 DEG C RATED TERMINATIONS AND TYPE THHN/THWN-2 INSULATION; FOR TERMINATIONS OR INSULATION TYPES RATED LESS THAN 75 DEG C, MODIFY SIZES ACCORDING TO NFPA 70.20A WIRE SIZING SCHEDULEALL WIRE SIZES SHOWN ON PANEL SCHEDULES AND PLANS ARE INTENDEDTO BE MINIMUM ACCEPTABLE WIRE SIZE.THE FOLLOWING SCHEDULE IS TO BE USED TO SIZE WIRE FOR 20 AMPCIRCUITS (120 AND 277 VOLT). LENGTHS (IN FEET) ARE INTENDED TO BEMAXIMUM.FINAL CONNECTIONS: WHERE 20A BRANCH CIRCUITS HAVE #8 ANDLARGER WIRE CALLED OUT, #10AWG WIRE MAY BE USED FOR THE FINALCONNECTION (15' MAX.).ISSUE BLOCKRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:{GENERAL NOTES:}1. E.C. SHALL ADD OR REARRANGE CIRCUIT BREAKERS WITHIN PANELBOARDS ASREQUIRED TO MATCH NEW CIRCUIT DESIGNATIONS SHOWN ON DRAWINGS.2. NEW OVERCURRENT PROTECTIVE DEVICES PLACED IN EXISTING PANELBOARDSOR DISTRIBUTION BOARDS SHALL MATCH THE TYPE AND AIC RATING OF EXISTINGOVERCURRENT PROTECTION DEVICES IN SAID BOARD.3. E.C. SHALL TRACE ALL ELECTRICAL CIRCUITS FOR ALL EXISTING ELECTRICALPANELBOARDS AFFECTED BY THE REMODEL AND IDENTIFY LOADS ON EACHCIRCUIT. PROVIDE A COMPLETE TYPEWRITTEN PANELBOARD IDENTIFICATIONSCHEDULE FOR ALL AFFECTED PANELBOARDS.4. E.C. SHALL REPAIR OR REPLACE BROKEN HINGES AND DOOR LATCHES ONEXISTING PANELBOARDS.5. ALL OVERCURRENT DEVICES ARE NEW UNLESS NOTED OTHERWISE.SPARE CAPACITY*PER UTILITY COMPANY BILLING PEAK DEMAND OF:COORDINATE ALL CHANGES TO EXISTING ELECTRICAL SERVICEAND METERING WITH UTILITY COMPANY.STORE ADDRESS:WAL-MART GENERAL REMODEL1201 N SERVICE RD ERUSTON, LA 71270AMPS1044 KW530.11NOTES:A. ALL SWITCHBOARDS AND PANELBOARDS SHALLHAVE A COMMERCIALLY PRODUCED PERMANENT LABEL APPLIED, SIMILAR TO THEABOVE, TO WARN OF POTENTIAL ARC FLASH HAZARDS, IN ACCORDANCE WITH NEC110.16 AND NFPA 70E.B. LABELING MAY BE COMPLETED BY EQUIPMENT MANUFACTURER, EQUIPMENTVENDOR/SUPPLIER, OR THE CONTRACTOR. THE CONTRACTOR SHALL VERIFY THATALL SWITCHBOARDS AND PANELBOARDS ARE PROPERLY LABELED IN THE FIELD.120 VOLT1-5 AMPS11-15 AMPS#12200 FT.6-10 AMPS 100 FT.70 FT.#10325 FT.160 FT.110 FT.#8 #6490 FT.245 FT.165 FT.770 FT.385 FT.255 FT.07-14-11 PLAN REV. #108-05-11 ADDENDUM #1UTILITY COMPANY:PHONE:EMAIL:CITY OF RUSTON318-255-1316light&power@ruston.org277 VOLT1-5 AMPS6-10 AMPS#12480 FT.240 FT.#10760 FT.380 FT.#8 #61170 FT. 1865 FT.585 FT. 930 FT.11-15 AMPS 160 FT.250 FT.390 FT.620 FT.%ARC FLASH DETAILNTSEXISTINGUTILITY TRANSFORMER480Y/277V, 3%%c, 4W SEC3000 KVAEXISTINGUTILITY TRANSFORMER480Y/277V, 3%%c, 4W SEC3000 KVACHECKED BY:DRAWN BY:JEETJPPROTO:188PROTO CYCLE:11-19-10DOCUMENT DATE:02-09-11MSWB-1EXISTINGMSWB-2EXISTING2000 AMPS 480Y/277V 3%%c 4W2000 AMPS 480Y/277V 3%%c 4W200A3P200AETR200A3P200AETR400A3P400AETR400A3P400AETR400A3P400AETR400A3P400AETR400A3P400AETR100A3P100AETR400A3P400AETR200A3P200AETR200A3P200AETR100A3P100AETR60A3P60AETR100A3P100AETR200A3P200AETR200A3P200AETR800A3P800AETR800A3P800AETREXISTING EXISTINGPNLBD PNLBDH1A277/480VH1C1277/480VEXISTING EXISTINGPNLBD PNLBDH1C2277/480VH1C3277/480VS:\Wal-Mart\W447\D\W447E4 3 Aug 2011 - 6:08 pmEXISTINGPNLBDEXISTINGPNLBDH5AH5D277/480V 277/480VEXISTINGPNLBDL5EELECTRICAL ROOM #5208/120VEXISTINGPNLBDH5C1277/480VT5E30 KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDL5D2208/120VEXISTINGPNLBDH5C2277/480VEXISTINGPNLBDL5D1208/120VEXISTINGPNLBDL5BT5B208/120V225 KVA480V-208Y/120V(EXISTING)277/480VEXISTINGPNLBDCH1COMPHOUSE #1EXISTINGPNLBDL5D5208/120VPRODUCE PREPEXISTINGPNLBDCH2277/480V 277/480VCOMPHOUSE #2EXISTINGPNLBDCH3COMPHOUSE #3208/120VEXISTINGPNLBDL5D3DELI PREPT1F45 KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDL1FEXISTINGPNLBDL1U1EXISTINGPNLBDL1E208/120V240/120V 208/120VUPS BATTERYT1E15KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDL1D1T1D75KVA480V-208Y/120V(EXISTING)208/120VEXISTINGPNLBDL1D2208/120VELECTRICAL ROOM #1EXISTINGPNLBDTFS75 KVA480V-208Y/120V(EXISTING)EXISTING%ELECTRICAL ONE-LINE DIAGRAM1/8" = 1'-0"LFS208/120VFOOD TENANTEXISTINGPNLBDH4T277/480VPNLBDL4F208/120VT4F15 KVA480V-208Y/120V(EXISTING)ELECTRICAL ROOM #4(AUTO CENTER)EXISTINGPNLBDEXISTINGPNLBDL3D1H3A208/120VT3D75 KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDL3D2208/120VELECTRICAL ROOM #3EXISTINGPNLBDH3B277/480V277/480VPHOTO LABEXISTINGPNLBDH3C277/480VEXISTINGPNLBDL3F208/120VTPL25 KVA480V-240Y/120V(EXISTING)EXISTINGPNLBDH3S277/480VT3F30 KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDPL240/120VEXISTINGPNLBDH2A277/480VEXISTINGPNLBDL2E208/120VUPS BATTERYEXISTINGPNLBDL2U1240/120VT2E15 KVA480V-208Y/120V(EXISTING)ELECTRICAL ROOM #2T2B225 KVA480V-208Y/120V(EXISTING)EXISTINGPNLBDEXISTINGPNLBDL2B L2D1208/120V208/120VWIRELESSEXISTINGPNLBDL2D3208/120VNAIL TENANTEXISTINGPNLBDL2D4208/120V208/120V208/120VEXISTINGEXISTINGEXISTINGPNLBDPNLBDPNLBDLPLBTLFSPHARMACY BANK TENANT HAIR CAREEXISTINGPNLBDLW1208/120VEXISTINGPNLBDEXISTINGPNLBDL2D2208/120VEXISTINGPNLBDLN208/120VELECTRICALONE-LINEDIAGRAMANDSCHEDULESSHEET:E4


ELECTRICAL KEYNOTESCONT16.125 EXISTING LIGHT FIXTURES TO REMAIN UNLESS16.129NOTED OTHERWISE.CONNECT TO EXISTING CIRCUIT PREVIOUSLYSERVING AREA LIGHTING THAT WAS REMOVED.MAINTAIN EXISTING CIRCUIT CONTROL UNLESSNOTED OTHERWISE. PROVIDE CONSTANT HOTFOR EMERGENCY, EXIT, AND LOCALLYCONTROLLED LIGHT FIXTURES.FURNISH AND INSTALL 2 - 1"C FOR SECURITY CAMERAS. COORDINATE MOUNTING OF CONDUIT WITH MECHANICAL AND ARCHITECTURAL.4E516.477FURNISH AND INSTALL NEW CIRCUITBREAKER (##A-#P) IN EXISTINGPANELBOARD INDICATED. PROVIDE CIRCUITBREAKER LOCKING DEVICE (LOCK-OFF FORMAINTENANCE). E.C. SHALL MATCHMANUFACTURER, TYPE AND AIC RATINGS OFEXISTING CIRCUIT BREAKERS. E.C. SHALLVERIFY PRIOR TO ROUGH-IN THAT EXISTINGPANELBOARD HAS SPARE CAPACITY TOACCOMMODATE ADDITIONAL LOAD.STIPULATION FOR REUSEMECHANICAL LINES, TYPTERMINATE CONDUIT WITH BUSHINGS AT 4" ABOVE BOTTOM OF ROOF JOISTS, TYP OF 2.SECURE CONDUITS TO UNISTRUT, TYPPLACE CONDUITS, LINES AND PIPES AS CLOSELY TOGETHER AS POSSIBLE. UNISTRUT LENGTH SHALL BE KEPT TO A MINIMUM. FINAL UNISTRUT INSTALLATION SHALL HAVE NO MORE THAN A 3" EXTENSION PAST LAST PIPE SUPPORT.16.S04FURNISH AND INSTALL NEW TUBE GUARDS ANDCAPS ON ALL EXPOSED LAMPS IN THIS AREA.SECURITY CAMERA CONDUITS, TYPREF MECH FOR UNISTRUTTLE FLOORREF ARCH FOR CHASEROUTE 2 - 1" CONDUITS TO EACH PIT AND TERMINATE AT 2" PAST BOTTOM OF TLE FLOOR. TERMINATE CONDUITS WITH BUSHINGS, TYP.4%TLE ELECTRICAL CONDUIT RISERNTSPIT LIGHTING/%TLE ELECTRICAL CONDUIT RISER1/8" = 1'-0"RUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:131213 12ISSUE BLOCK07-14-11 PLAN REV. #108-05-11 ADDENDUM #115 141514TYPE1.2FURNISH AND INSTALL WP, SPRING WOUND INTERVAL 10A, 277V, 0-30 MINUTE NO HOLD TIME SWITCH, TYP.CIRCUIT SCHEDULEGENERAL CONTRACTOR TO VERIFY THAT ALL SO-CORD DROPS ARE SUSPENDED WITH GRIP STRAIN RELIEF CORD CONNECTOR. FURNISH AND INSTALL NEW AS REQUIRED.2225A, (2)#10, (1)#10G, 3/4" CTIRE & BATTERYSTORAGETIRE & BATTERYSTORAGECHECKED BY:JEECONTRACTOR TO VERIFY THERE ARE NO SECURITY CAMERA CABLES RUNNING THROUGH ABANDONED PVC CHASE INTO PIT. IF THERE ARE, COORDINATE DISCONNECTION AND RELOCATION WITH WAL-MART CONSTRUCTION MANAGER.ALL CONDUCTOR SIZES ARE BASED ON 75 DEG C RATED TERMINATIONS AND TYPE THHN/THWN-2 INSULATION; FOR TERMINATIONS OR INSULATION TYPES RATED LESS THAN 75 DEG C, MODIFY SIZES ACCORDING TO NFPA 70.DRAWN BY:PROTO:TJP18842TYP16.129PROTO CYCLE:DOCUMENT DATE:11-19-1002-09-11REPLACE BROKEN ELECTRICAL COVERS AND RECEPTACLES. TYPICAL IN ALL TLE AREAS.CUSTOMERAREA(25A-1P)22CUSTOMERAREA16.477L4TEF ETRTOILETWHLUBE & TIREMOUNTING AREAELECTRICALROOM #4POWERLINK PNLL4TL4FH4TXFMRT4T(ABOVE)EF ETRSTORAGELUBE & TIREMOUNTING AREA16.12516.S04ELECTRICALROOM #4TOILETSTORAGE16.125XFMRT4F(ABOVE)SECURITYSECURITYE5EXISTING POWER (NOT SHOWN)SHALL REMAINS:\Wal-Mart\W447\D\W447E5 4 Aug 2011 - 1:56 pm%TLE POWER PLAN1/8" = 1'-0"F%TLE LIGHTING PLAN1/8" = 1'-0"FEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGHKNOWLEDGE OF ALL DRAWINGS AND SPECIFICATIONS IN THEIRRELATED FIELD. THE FAILURE TO ACQUAINT THEMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING THE WORK PROPERLY. NO ADDITIONALCOMPENSATION SHALL BE ALLOWED BECAUSE OF CONDITIONS THATOCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.TLEELECTRICALPLANSSHEET:E5


CIRCUIT SCHEDULEGENERAL REFRIGERATION ELECTRICAL NOTES1. PROVIDE ALL CONDUIT AND WIRE AS INDICATED ON DRAWING. NEATLY BUNDLECIRCUITS AND CLEARLY TAG AND LABEL EACH CIRCUIT WITH BRANCH CIRCUITDESIGNATION AND REFRIGERATION SYSTEM NUMBER FOR TERMINATION BYREFRIGERATION CONTRACTOR.2. COORDINATE ALL WORK WITH REFRIGERATION CONTRACTOR PRIOR TOINSTALLATION.3. KEEP PENETRATIONS THROUGH COOLER AND FREEZER BOXES TO A MINIMUM.ROUTE ALL CONDUITS SERVING FREEZERS AND COOLERS ON INSIDE OF BOX.4. UNDERSLAB CIRCUITS SHALL NOT BE ROUTED UNDER WALK-IN FREEZERS ANDSHALL BE ROUTED ABOVE REFRIGERANT LINES WHERE THEY CROSS.GROCERY EQUIPMENT SCHEDULENO.MISC. GROCERY EQUIPMENT SCHEDULEMG21ELECTRICAL EQUIPMENT SCHEDULE NOTESA.B.C.D.E.F.DESCRIPTIONWASTE COOKING OIL TANKPROVIDE CORROSION RESISTANT PLUG, CONNECTOR, AND WEATHERPROOF BOOTS. CONNECTOR AND WEATHERBOOTS SHALL BE FROM THE SAME MANUFACTURER.PROVIDE MATCHING CORD AND MALE PLUG.WIRING DEVICE ON DROP CORD FROM CEILING. REFER TO SUSPENDED DROP CORD DETAILS.WIRING DEVICE CIRCUITED TO SHUNT-TRIP BREAKER.PROVIDE WEATHERTIGHT FLEX CONDUIT AND WIRING FROM DISCONNECT SWITCH OR JUNCTION BOX TO EQUIPMENT KNOCKOUT OR ELECTRICAL CONNECTION POINT.MAKE FINAL CONNECTIONS TO EQUIPMENT.MANUFACTURERCLEANSTARMODEL NO.2500-CWVOLT/PH120/1AMPSHP1/3VATERMINATIONSIMPLEX; NEMA 5-20RMTG. HT.+48"NOTESNOT USED{ALL CONDUCTOR SIZES ARE BASED ON 75 DEG C RATED TERMINATION AND COPPER CONDUCTORS WITH TYPE THHN/ THWN-2 INSULATION. WHERE ALUMINUM CONDUCTORS ARE ALLOWED PER SPECIFICATIONS AND FOR TERMINATION OR INSULATION TYPES RATED LESS THAN 75 DEG C, MODIFY SIZES ACCORDING TO NFPA 70.}ANY CONDUIT INSTALLED AT EXISTING WALLS REQUIRING IT BE SURFACE-MOUNTED SHALL BE ATTACHED WITH PROPER STAND-OFF SEPARATION TO ALLOW FOR CLEANING OF WALL SURFACES.5. ON GROUPS OF THREE OR MORE REFRIGERATED CASES WITH ELECTRIC DEFROST,REFRIGERATION CONTRACTOR SHALL CONNECT CASES TO CREATE A THREE-PHASEHEATER CIRCUIT. HEATER LOADS SHALL BE BALANCED BETWEEN PHASES AS EVENLYAS POSSIBLE (REF CASE DEFROST WIRING DETAIL).6. ROUTE REFRIGERATED CASE AND COIL FAN, LIGHTS, ANTI-SWEAT AND DEFROSTBRANCH CIRCUITS TO WIREWAYS PROVIDED AT REFRIGERATION EQUIPMENT. PROVIDEAN ADDITIONAL 6 FEET OF CONDUCTOR AT REFRIGERATION EQUIPMENT TO ALLOWADEQUATE LENGTH FOR TERMINATION. FINAL TERMINATION AT REFRIGERATED CASESBY REFRIGERATION CONTRACTOR.STIPULATION FOR REUSEG.PROVIDE CORROSION PROOF PLUGS AND RECEPTACLES FOR EQUIPMENT SPECIFIED ON ELECTRICAL EQUIPMENT SCHEDULE NOTES.H.J.K.IF EQUIPMENT IS FURNISHED WITH A DIFFERENT PLUG, E.C. SHALL CUT OFF OLD PLUG AND INSTALL NEW PLUG AS SPECIFIED.VERIFY EXACT POINT(S) OF CONNECTION(S) AND FIELD WIRING REQUIREMENTS WITH EQUIPMENT INSTALLER.IF NOT FURNISHED WITH EQUIPMENT, FURNISH AND INSTALL 6'-0" LONG SJO CORD WITH GROUNDING CONDUCTOR, SIZED AS FOLLOWS:5 CONDUCTORS: #8W.(28A), #10W.(20A), #12W.(16A), #14W.(12A). 4 CONDUCTORS: #4,(60A), #8W.(35A), #10W.(25A), #12W.(20A), #14W.(15A).3 CONDUCTORS: #8W.(40A), #10W.(30A), #12W.(25A), #14W.(18A). FURNISH AND INSTALL GROUNDING TYPE ATTACHMENT CAPCAP ON CORD FOR USE WITH INDICATED RECEPTACLE OR CONNECTOR.SEE ELECTRICAL SPECIFICATIONS FOR RECEPTACLE, CONNECTOR, AND PLUG INFORMATION. PROVIDE AS REQUIRED.CORD AND PLUG FURNISHED WITH EQUIPMENT.4CASE CONNECTION WIRINGNTSREFRIGERATED CASE WIRING NOTES1. PROVIDE CONDUIT AND WIRE FOR REFRIGERATED CASE FANS,LIGHTS AND ANTI-SWEAT HEATERS TO WIREWAY AT REFRIGERATIONEQUIPMENT, UNLESS NOTED OTHERWISE. WIRE SIZE AS INDICATED INSCHEDULE. FINAL TERMINATIONS AT CASE AND AT REFRIGERATIONEQUIPMENT BY R.C. REF CASE CONNECTION WIRING DETAIL.2. REFRIGERATED CASE WIRING COMPARTMENT REPRESENTED ONDRAWING BY RECTANGULAR BOX.COMPRESSORHOUSE #2(ON ROOF)RACK C150 KVAXFMRRACK D480VSERVICEPNL3. CIRCUITS FOR REFRIGERATED CASES SERVED BY UNDERSLABREFRIGERATION PIPING ARE TO BE ROUTED UNDERSLAB. REFER TOCASE CONNECTION WIRING DETAIL.4. ALL UNDERSLAB CONDUITS SHALL BE 3/4" MIN.5. CIRCUITS FOR REFRIGERATED CASES SERVED BY OVERHEADREFRIGERATION PIPING ARE TO BE ROUTED DOWN FROM STRUCTUREAT THE SAME LOCATION AS THE REFRIGERATION PIPING AND EXTENDEDTO THE FIRST CASE IN EACH SYSTEM BY THE E.C. WIRE AND CONDUITFOR SLAVE WIRING BETWEEN CASES SHALL BE PROVIDED BY THE R.C.ELECTRICAL KEYNOTESRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:ISSUE BLOCKLCU07-14-11 PLAN REV. #108-05-11 ADDENDUM #1CH2A16.492EC SHALL COORDINATE WITH GENERALCH2B208VSERVICE PNLCONTRACTOR AND ARCHITECTURALDEMOLITION PLANS THE EXTENT OFELECTRICAL DEMOLITION. REMOVECONDUITS AND WIRES ALL THE WAYBACK TO ORIGINATING JUNCTIONBOXES OR PANELBOARDS. DEMOLITIONSHALL NOT AFFECT ACTIVE CIRCUITS.LABEL DEMOLISHED CIRCUIT(S) INPANELBOARDS AS "SPARE".COORDINATE EXACT REQUIREMENTS WITH4EXISTING CONDITIONS PRIOR TO BID.EXISTING POWER (NOT SHOWN) SHALL REMAINCHECKED BY:JEEDRAWN BY:TJPPROTO:188PROTO CYCLE:11-19-10HALLWAYEXISTING DOORS WITH LED LIGHTING TO REMAINDOCUMENT DATE:02-09-11GROCERY SALESEF ETRDELI FREEZERDELI PREPSEAFOODPREPDELI COOLERL5D3DEPT. 82208VSERVICE PNLLCU-CH3DAIRY COOLER225 KVAXFMRCH3225 KVAXFMRSERVICE DELI480V SERVICEPNLRACK EEXISTINGSTACKEDDISCONNECTS16.49216.492 16.49216.492EXISTING POWER (NOT SHOWN) SHALL REMAINRACK E CONTROLLERCOMPRESSORHOUSE #3(ON ROOF)CAKE DECORATING16.492BAKERYNOTE: REFRIGERATION CONTRACTOR IS RESPONSIBLE FOR ALL FINAL REFRIGERATION ELECTRICAL TERMINATIONS TO REFRIGERATION EQUIPMENT.SUBWAYS:\Wal-Mart\W447\D\W447GE2 2 Aug 2011 - 5:02 pmREAR GROCERY POWER PLAN1/8"=1'-0"RFRONT GROCERY POWER PLAN1/8"=1'-0"16.492BEXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGHKNOWLEDGE OF ALL DRAWINGS AND SPECIFICATIONS IN THEIRRELATED FIELD. THE FAILURE TO ACQUAINT THEMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING THE WORK PROPERLY. NO ADDITIONAL COMPENSATIONSHALL BE ALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.GROCERYPOWERPLANSHEET:GE2


SINKGENERAL REFRIGERATION EMS NOTESGENERAL EMS NOTES1. EMS CONTRACTOR SHALL CONTACT THE EMS SUPPLIERTO OBTAIN A CURRENT MODULE CONFIGURATION PRINTOUTBEFORE TERMINATING SENSOR LEADS AT INPUT MODULES.THE REQUEST FOR THE CONFIGURATION PRINTOUT SHALLBE MADE PRIOR TO THE INSTALLATION OF EMS CABLES.WIRING TERMINATIONS SHALL BE LANDED ACCORDING TOTHE EMS SUPPLIER CONFIGURATION SHEETS.2. EMS CONTRACTOR SHALL PROVIDE COMPLETEDREFRIGERATION SENSOR INPUT VERIFICATION FORMS TOTHE EMS SUPPLIER AT THE BEGINNING OF THEREFRIGERATION EQUIPMENT STARTUP. EMS INSTALLERSHALL PROVIDE ASSISTANCE TO THE EMS SUPPLIER FORSPOT CHECKING OF SENSORS FOR ACCURACY.1.TEMPERATURE SENSOR MOUNTING: PROVIDE 1/2"CONDUIT AND EMS CABLE FROM SENSOR TO RTU.MOUNT SENSOR ON BOX. ALL SENSORS TO BEMOUNTED AT +84" UNLESS NOTED OTHERWISE.SENSORS ON SALES FLOOR SHALL BE MOUNTED ONTHE FRONT OF THE COLUMN. DO NOT INSTALLSENSORS IN HVAC SUPPLY AIR PATH OR IN DIRECTSUNLIGHT. REF MECHANICAL DRAWINGS FOR EXACTLOCATIONS.A. GYPSUM BOARD WALLS: PROVIDE A4" SQUARE RECESSED BOX WITH A SINGLEGANG PLASTER RING FLUSH MOUNTEDVERTICALLY.EXISTING MASTER CONTROLLERELECTRICAL ROOM #1 (REAR)INDOOR SENSORS AND ETMS FOR AC UNITS NOTED "***" ARE NEW AND SHALL BE FIELD SERIES WIRE TO THE NEAREST EXISTING RTUPROVIDE CONDUIT, FITTINGS, WIRE-TIES, CONNECTORS, LABELS, AND ANY OTHER MISC. PARTS NEEDED TO INSTALL AND START THE SYSTEM.OWNER WILL FURNISH ALL MAJOR E.M.S. DEVICES (INCLUDING 24 VOLT TRANSFORMERS AND RELAYS).4EXISTINGIOMER5AELECTRICAL ROOM #5 (GROCERY)WIRE LEGEND%PARTIAL%E.M.S. ONE-LINE DIAGRAMNTSWIR-1010 (TAN CABLE 18-2, 20-2 TWISTED PAIR)WIR-2020 (BLUE CABLE 22-2 TWISTED PAIR)BELDEN 8719 (16-2 TWISTED PAIR){NOTES}:BELDEN 1120A (18-3 TWISTED PAIR)1. ALL CABLE WIR-2020 UNLESS NOTEDOTHERWISE.2. ALL WIR-1010 AND WIR-2020 CABLEFURNISHED BY OWNER FOR INSTALLATION BYCONTRACTOR.3. ALL BELDEN CABLE FURNISHED ANDINSTALLED BY CONTRACTOR.EXISTINGPNLBDL2D2ELECTRICAL ROOM #2 (GR VESTIBULE)3. EMS CONTRACTOR SHALL BE PRESENT AND AVAILABLETO RESOLVE ISSUES AND PROVIDE REFRIGERATIONSTARTUP ASSISTANCE UNTIL RELEASED BY THE EMSSUPPLIER AND WAL-MART REFRIGERATION CONSTRUCTIONCOORDINATOR.4. DURING THE REFRIGERATION STARTUP, EMSCONTRACTOR SHALL COMPLETE ALL UNRESOLVEDREFRIGERATION WORK PRIOR TO WORKING ON OTHER EMSINSTALLATION ITEMS.5. WHEN THE EMS SUPPLIER IS NOT SCHEDULED TOPERFORM THE ON SITE REFRIGERATION STARTUP, THECONTRACTOR IS RESPONSIBLE FOR PERFORMING ALLCHECKS AND TEST TO ENSURE A FULLY FUNCTIONALREFRIGERATION CONTROL SYSTEM. CONTACT THE EMSSUPPLIER FOR THE BLANK TEST VERIFICATION FORMS ANDINSTRUCTIONS FOR COMPLETING. ALL COMPLETED TESTVERIFICATION FORMS SHALL BE RETURNED TO THEWAL-MART MECHANICAL SERVICES CONSTRUCTIONMANAGER.6. REFER TO ARCHITECTURAL DRAWINGS FOR PIPINGINSTALLATION AND SEALING REQUIREMENTS FOR DEVICESSHOWN ON COOLER/FREEZER PANELS. DO NOT INSTALLPIPING WITHIN COOLER/FREEZER PANELS.7. ROUTE ALL UTILITY SERVICE LINES (PIPES AND CONDUIT)WITHIN STUD WALLS WHEREVER POSSIBLE. ONCOOLER/FREEZER PANELS IN FOOD PREP AREAS WHEREUTILITIES MUST BE EXPOSED, CONTRACTOR TO HAVE THEOPTION OF THE FOLLOWING:A. SURFACE MOUNT UTILITIES WITH NON-CORROSIVEANCHORS; SEAL BOTH SIDES OF PIPE/CONDUIT TO PANELCONTINUOUSLY WITH SEALANT.B. INSTALL UTILITIES 1/2" OFF FACE OF PANEL TO ALLOWFOR CLEANING; USE ONLY NON-CORROSIVE MATERIALS FORSPACERS AND ANCHORS.C. COVER UTILITIES WITH 20 GAUGE STAINLESS STEELBENT PLATES MOUNTED TO WALL WITH NON-CORROSIVEANCHORS; APPLY CONTINUOUS SEALANT ALONG EDGESLTA-XRC2-XERIMROMCIMDISREM SYMBOLSREFRIGERATION CIRCUITREFRIGERATION RACK CONTROLLERRACK INPUT MODULERACK OUTPUT MODULECASE INPUT MODULEDIGITAL INPUT SWITCH (DUAL-TEMP)2.3.4.5.6.7.B. BLOCK WALLS AND COLUMNS:PROVIDE A 2"x4" BOX SURFACE MOUNTEDVERTICALLY.C. INSULATE BEHIND SENSORSMOUNTED ON EXTERIOR WALLS WITH 1/2"POLYSTYRENE SPACER.TERMINATIONS SHALL BE MADE IN ACCORDANCEWITH EMS SUPPLIER INSTALLATION INSTRUCTIONS.NO FOIL OR UNUSED WIRE(S) SHALL BE EXPOSEDAFTER APPLICATION OF HEAT SHRINK.CABLE: PROVIDE CABLE ACCORDING TO DRAWINGS.NO DEVIATION FROM DRAWINGS WILL BE ACCEPTED.CABLES SHALL HAVE EACH END LABELED INDICATINGWHERE THE OPPOSITE END TERMINATES. CABLESHALL BE INSTALLED IN CONDUIT OR CABLE TRAY INFINISHED AREAS OF BUILDING.MINOR CHANGES IN MATERIALS OR TERMINATIONPOINTS SHALL NOT INCREASE CONTRACT COST.ROUTE EMS CONDUITS IN SALES AREA CONCEALED (INWALLS, PIPE RACKS AND/OR CHASES). PROVIDE ATRANSITION FROM THE PVC UNDERSLAB EMSCONDUIT TO EMT OR FLEX. EMS CABLES SHALL BERUN IN CONDUIT FULL LENGTH, BENEATHREFRIGERATED CASES. EMS CABLES AT BAR JOISTLEVEL IN THE STOCKROOM CAN BE EXPOSED.{DEMOLITION:} COORDINATE WITH ARCHITECTURALDEMOLITION PLANS THE EXTENT OF EMS DEMOLITION.REMOVE CONDUIT AND WIRES ALL THE WAY BACK TOORIGINATING JUNCTION BOXES OR DEVICES.DEMOLITION SHALL NOT AFFECT ACTIVE CIRCUITS.EMS CONTRACTOR SHALL PROVIDE ASSISTANCE TOTHE EMS SUPPLIER ON PERFORMING EQUIPMENTAHUCAHUS#ALSETMIDSITSODSOTSEMS SYMBOLSAHU CONTROLLERAHU TEM/RH SENSORANALOG LIGHT SENSORELECTRONIC THERMOSTAT MODULEINDOOR DEWPOINT SENSORINDOOR TEMPERATURE SENSOROUTDOOR DEWPOINT SENSOROUTDOOR TEMPERATURE SENSORSTIPULATION FOR REUSEISSUE BLOCKRUSTON, LOUISIANASTORE NO. 0023-201GENERAL REMODEL2010-0452JOB NUMBER:WIRE LEGENDWIR-1010 (TAN CABLE 18-2, 20-2 TWISTED PAIR)WIR-2020 (BLUE CABLE 22-2 TWISTED PAIR)NOTE: ALL EMS CABLES FURNISHED BY OWNER FOR INSTALLATION BY EMS CONTRACTOR. ALL CABLE WR-2020 UNLESS NOTED OTHERWISE.15 14 13 12 11 10BALERPHARMACY STORAGEELECTRICALROOM #1SPRINKLERUPC/INVOICINGTRAININGPHOTO STORAGEMANAGER'S OFFICEMARKET MANAGER'S OFFICE4EXISTING CIMSE1, E2, E3, E4CIMFIXTURE STORAGERIBRELAY IN A BOXCASE/COIL TEMPERATURE MODULEBALERS-XTS-XBAPCO2WALL TEMPERATURE SENSORTEMPERATURE SENSORBURGLAR ALARM PANELCARBON DIOXIDE SENSOR07-14-11 PLAN REV. #108-05-11 ADDENDUM #106.15.09CIM NOTES(E) - EXISTING DEVICE TO REMAIN(R) - EXISTING DEVICE TO RELOCATE ANDRECONNECT## - MONITORING ONLY DEVICE** - FACTORY INSTALLED DEVICENOTE: ALL DEVICES NOT NOTED ARE NEWCOMPRESSOR HOUSE #2RACK 'C' CONTROLLERCIM(C1)REMCCOMPRESSOR HOUSE #3RACK 'E' CONTROLLERCIM(E1)CIM-C1 SCHEDULE (E)SPARE4SPAREMTC-10MTC-11aAUX4AUXMTC-11bMTC-12SPARESPARESPARECIM-E2 SCHEDULE (E)MTE-4a (SENSOR)MTE-4b (SENSOR)SPARESPARESPARESPAREMTE-8SPARESPARE(SENSOR)(SENSOR)(SENSOR)(SENSOR)(E)(E)(E)(E)(E)(E)(SENSOR) (E)COMPACTORTIRE & BATTERY STORAGELUBE & TIRE MOUNTING AREACUSTOMERSERVICESTORAGERECEIVING-{GM }TOILETELECTRICAL ROOM #4SECURITYBIKE BUILDERS DESKSTOCKROOMCORRIDORSTOCKROOMCLAIMSSECURITYROOMJANITORSITE TO STOREPET WALLBREAKROOMASSOCIATES MEN'S RESTROOMASSOCIATES WOMEN'S RESTROOMPERSONNELFIXTURESCUSTOMER WOMENAP OFFICECUSTOMERMENCORRIDORDAIRY COOLERMANAGEMENTDELI FREEZERDELI COOLERHALLWAYDELI PREPDEPT. 82SERVICE DELIMEATCOOLERRECEIVING-{GR}STOCKROOMGROCERY FREEZERCOMPACTORFELECTRICALROOM #5LINGO XEFDIHIRIAOIFPIOMIRC#MINioPLMPSOPPSPROPXCM-10BUILDING EMS CONTROLLERFLUORESCENT DIMMER INTERFACEHUMIDITY INTERFACE RELAYINTERFACE ANALOG OUTPUTINTERFACE PANELINPUT/OUTPUT MODULEINTERFACE RELAYCONTACTORAHU INTERFACE MODULE AND/OR I/O MODULEPHASE LOSS MONITORPOWER SWITCHING OVERRIDE PANELPOWER SWITCHING PANELREMOTE OVERRIDE PANELAHU INTERFACE MODULECHECKED BY:DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:JEETJP18811-19-1002-09-11CIM(C2)CIM(E2)SALESCIM(C3)CIM(E3)MEAT PREPECIM(C4)CIM(E4)PHOTO LABGROCERY SALESCOOLERMEAT HOLDINGGROCERY COOLERS:\Wal-Mart\W447\D\W447EM1 3 Aug 2011 - 5:43 pmONE-LINE DIAGRAM OFREFRIGERATION "SPECTRUM" EMSNTSNOT USEDZONE TEMPERATURE%SENSOR MOUNTING DETAILNTSSEASONAL SHOPGARDEN CENTERPHARMACYELECTRICAL ROOM #3OTHER INCOME-GMGM CART STORAGEGM VESTIBULEVISION CENTERCOUNTCORRIDORCOURTESY DESKJANITORPICTURE MECASHMONEYCENTERCUSTOMER MENCUSTOMER WOMENREGAL NAILSSMART STYLEBANK%ENERGY MANAGEMENT PLAN1/32" = 1'-0"WIRELESS STOREGR VESTIBULECAKE DECORATINGSUBWAYRGR CART STORAGEELECTRICAL ROOM #2OTHER INCOME-GRSEAFOOD COOLERBAKERYPLUMBING/MECHANICALSEAFOOD PREPPRODUCE COOLERSEAFOOD COOLERPRODUCE PREPFIRE CORRIDORBAKERY COOLERBAKERY FREEZERBNOTE: ALL WORK ON THIS SHEET IS TO BE COMPLETED BY WALMART APPROVED CONTRACTOR.EXISTING CONDITIONS WERE TAKEN FROM ORIGINAL DRAWINGS AND MAY NOT REFLECT EXACT "AS-BUILT" CONDITIONS. CONTRACTOR SHALL FIELD VERIFY ALL EXISTING CONDITIONS PRIOR TO SUBMITTING FINAL BIDS. CONTRACTOR SHALL CAREFULLY COORDINATE NEW WORK AND DEMOLITION WITH ALL OTHER DISCIPLINES AND EXISTING CONDITIONS.EACH SUBCONTRACTOR IS RESPONSIBLE FOR HAVING A THOROUGHKNOWLEDGE OF ALL DRAWINGS AND SPECIFICATIONS IN THEIRRELATED FIELD. THE FAILURE TO ACQUAINT THEMSELF WITH THISKNOWLEDGE DOES NOT RELIEVE THE RESPONSIBILITY OFPERFORMING THE WORK PROPERLY. NO ADDITIONAL COMPENSATIONSHALL BE ALLOWED BECAUSE OF CONDITIONS THAT OCCUR DUETO FAILURE TO FAMILIARIZE WORKERS WITH THISKNOWLEDGE.ENERGYMANAGEMENTPLANSSHEET:EM1


EXISTING WALL STUDSWOOD BLOCKINGNOTE:HALF GONDOLAS SHALL BE ANCHORED TO WALL ASSHOWN TO SATISFY OWNER REQUIREMENTS. WALLANCHORAGE IS NOT REQUIRED FOR SEISMIC DESIGNOR CODE COMPLIANCE.OUTSIDE FACE OF END FRAME12 GA STL ANCHOR PL (BY SUPPLIER) TYP AT EACH END2'-0" 4'-0"BOLT ALL UPRIGHTS TO WALL, REF GONDOLA UPRIGHT ANCHORAGE AT WALLGONDOLA UPRIGHT FRAME,REF PLAN{WOOD BLOCKING AT EXISTING STUD WALLS}29{SECTION AT} {END FRAME}LIGHT GAUGE STEEL STRAP(22 GA MIN THICKNESS)(BY WALMART AND INSTALLED BY GC)REF 1-FXS2 FOR PLACEMENT OF STRAPS{GONDOLA UPRIGHTANCHORAGE AT WALL}OUTSIDE FACE OF END FRAMELIGHT GAUGE STEEL STRAP(22 GA MIN THICKNESS)(BY WALMART AND INSTALLED BY GC)REF 1-FXS2 FOR PLACEMENT OF STRAPSANCHOR BOLTS: (1) 3/8" DIAPOWERS WEDGE BOLT+, REF 4-FXS2.hnom = 2 1/8", ho = 2 3/4", (UNO).BOLT ALL (NON-SUPER DUTY) UPRIGHTS TO WALL AT 6'-0" AFF. USE (1) 3/8"x5" LARGE DIAMETER TAPCON (LDT-3850) CONCRETE SCREW AT CMU OR 1/4"X6" LAG SCREW WITH 1/2" DIA WASHER AT STUD WALLS. INSTALLED BY GCGONDOLA UPRIGHT FRAME,REF FINAL MERCHANDISE PLANGONDOLAS PROVIDED BY WALMART. GONDOLA ANCHORING FURNISHED BY WALMART AND INSTALLED BY GC.METHOD OF BOLTING WILL VARY DUE TO DIFFERENT EXISTING WALL MATERIALS.REF1-FXS2REF 1-FXS2 FOR BASE ANCHORAGE (INSTALLED BY GC)ANCHOR AT HALF GONDOLA UPRIGHTN.T.S. 7-32LathnomBASE DECK SHELVING REMOVED FOR CLARITYhoINSTALLATION NOTES:1. GAPS BETWEEN SHELVESSHALL NOT EXCEED 5/8".2. UPRIGHT DEFLECTIONSHALL NOT EXCEED 1 3/8"IN A HORIZONTAL PLANE.3. SHELVES SHALL NOTSLOPE DOWN TO THEFRONT DUE TO UPRIGHTDEFLECTION.4. SHELVES ABOVE BASEDECK SHELVING LEVELSHALL NOT EXTENDBEYOND BASE DECKSHELVING AT ANY TIME.5. EXTENDERS SHALL NOTBEUSED ON ANY HALFGONDOLA THAT WILLCREATE A HEIGHTOF 72" OR TALLER UNLESSIT IS ANCHORED TO THEWALL. ALL HALF GONDOLAS72" OR TALLER MUST BEANCHORED TO THE WALLAT 72" AFF, REF GONDOLAUPRIGHT ANCHORAGE ATt - PL THICKNESShnom - EMBEDMENT DEPTHho - MIN HOLE DEPTHLa - LENGTH OF ANCHORALL ANCHOR BOLTS SHALL BE POWERS WEDGE BOLT+. INSTALL PER ICCESR-2526. REF BASE PLATE DETAIL FOR DIAMETER AND EMBEDMENT. REFSHEET FXS1 FOR SPECIAL INSPECTION REQUIREMENTS WITH CONCRETEANCHOR BOLT.ACCEPTABLE ALTERNATE ANCHOR TYPES ARE;1) SIMPSON STRONG TIE TITEN HD SCREW ANCHOR,INSTALL PER ICC ESR-27132) HILTI KWIK HUS-EZ SCREW ANCHOR,INSTALL PER ICC ESR-3027USING SAME QUANTITY, SIZE AND EMBEDMENT DEPTH NOTED IN ANCHORDETAILS.STIPULATION FOR REUSECONSULTANTSC O N S U L T I N G S T R U C T U R A L E N G I N E E R SJohnston Burkholder AssociatesJohnston Burkholder AssociatesISSUE BLOCKCopyright 2011 Johnston Burkholder AssociatesRUSTON, LOUISIANA0023-201STORE NO.1 07/14/11 PR # 12 08/05/11 ADD #1930 CENTRAL - KANSAS CITY, MISSOURI 64105c2010-0452GENERAL REMODELJOB NUMBER:ANCHOR BOLTS: (1) 3/8" DIAPOWERS WEDGE BOLT+, REF 4-FXS2.hnom = 2 1/8", ho = 2 3/4", (UNO).ANCHOR AT DEEP3{}"MIN{SECTION AT} {INTERIOR FRAME}ANCHOR BOLTS: (2) 3/8" DIAPOWERS WEDGE BOLT+, REF 4-FXS2.hnom = 2 1/8", ho = 2 3/4", (UNO).TYPICAL ANCHORNOTE:IF CENTERLINE OF ANCHOR BOLTS FALLS WITHIN 1" OFCONTROL JOINT, SHIFT FIXTURE 2" (MAX) PERPENDICULARTO THE JOINT, OTHERWISE SUBMIT RFI TO THE ARCHITECTFOR ALTERNATE INSTALLATION BEFORE INSTALLING BOLTS.8/3/2011 5:26:37 PM DDW8/3/2011 5:27:38 PMS:\4-WALMART STORAGE RACKS\2011 PROJECTS\SN-0000\0023 - RUSTON, LA (PB2)\DRAWINGS\5020 - FXS2 RACK AND SHELVING ANCHORAGE DETAILS - 0023238END CAP FRAMES1 1/2"=1'-0" 7-33NOT USED1NOT USEDNOT USED2226NOT USED215AT GONDOLA FRAMES1 1/2"=1'-0" 7-06VARIESREF SCHEDULEVARIES{GONDOLA FRONT VIEW}END OFFRAME-TYPEACH SIDEEXIST WALLOR FIXTUREFRAMECL OFANCHORBOLTSTYP4"(INTERIOR)5-FXS2(END)5-FXS2{1/2GONDOLAVARIESTYP5-FXS2{1/2 GONDOLASIDE VIEW AT WALLOR FIXTURE FRAME}2 1/2"MIN6 1/2"MAXAT 24" GONDOLAANCHOR STRAP BY WALMARTGONDOLAUPRIGHTFRAME, TYPREF 9-FXS2 FOR UPRIGHT POST CONNECTION TO EXIST WALL PER OWNER REQUIREMENTSGONDOLA SHELVING BY SUPPLIERTYPICAL GONDOLA AND DEEP END CAP SHELVING ELEVATIONS3/8"=1'-0" 7-01GONDOLASHELVESABOVEANCHOR STRAP BY WALMARTEXISTING WALLOR FIXTUREFRAME4'-0"4'-0"ANCHOR STRAP BY WALMART2TYPTYPANCHOR SPACING = 8'-0" MAX (UNO)4ANCHOR BOLT DETAILNTS 7-05REF PLAN{DEEP END CAPPLAN VIEW}VARIES{DEEP END CAPSIDE VIEW}TYP8-FXS2TYPANCHOR PL BY SUPPLIER, TYPGONDOLA SHELVING BY SUPPLIERTYP8-FXS2VARIESREF SCHEDULECHECKED BY:DRAWN BY:PROTO:PROTO CYCLE:DOCUMENT DATE:RACK ANDSHELVINGANCHORAGEDETAILSSHEET:FXS2DGHCSH18811-19-1002-09-11JBA PROJ # 10349000231

More magazines by this user
Similar magazines