ADDENDUM # 1 - City of Deltona, Florida

deltonafl.gov

ADDENDUM # 1 - City of Deltona, Florida

ADDENDUM # 1CITY OF DELTONABID # PW 13-05January 30, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATEUntil further notice:Questions regarding this bid shall be addressed in writing to:Kate KraussPurchasing ManagerEmail: kkrauss@deltonafl.govFax: 386-878-8571Questions will not be accepted over the phone.Bidders are asked to acknowledge receipt of this addendum by signing below and returning the signed addendum with their bid submittal. Failureto do so may subject the bidder to disqualification.Vendor Acknowledgement of Receipt of Addendum:SignatureReturn a signed copy of this addendum with your bidPage 1 of 1


ADDENDUM # 3CITY OF DELTONABID # PW 13-05February 12, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATEThis addendum is change the bid due date to Thursday, February 28, 2013 at 2:00 p.m. atthe Water Dept. located at 255 Enterprise Road, Deltona, Florida 32725.ALL OTHER SPECIFICATIONS AND CONDITIONS REMAIN UNCHANGED.RECEIPT OF THIS ADDENDUM IS HEREBY ACKNOWLEDGED____________________________________________________NAME OF BUSINESSBY: ________________________________________________SIGNATURE/DATE___________________________________________________NAME & TITLE, TYPED OR PRINTED___________________________________________________MAILING ADDRESS___________________________________________________CITY, STATE, ZIP CODEPage 1 of 1


ADDENDUM # 4CITY OF DELTONABID # PW 13-05February 18, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATEThis addendum includes the following:Questions / Responses, Revised Bid Item Description,Amended Section 00020 and Tetra Tech Water Main Improvement Plans.Questions / Responses:Question:Response:Question:Response:Question:Response:Question:Response:Question:Response:Question:Response:Question:Response:What is the engineers estimate for this job?$1,854,458 Roadway and UtilitiesWhat is the job duration?270 daysWhat are the liquidated damages?$1,000 per dayIs the contractor required to provide testing and who pays for the testing?Testing by CEI, contractor responsible for retesting costsAre there any permit fees that the contractor is responsible for?NoIs the contractor required to provide any temporary facilities? (Office)NoIs the contractor required to submit a MOT plan?No, the plans currently show the MOT plan. The contractor will be required tosubmit requests/ notifications and exhibits for any proposed lane or roadclosures and be responsible for providing a revised MOT plan if he intends todeviate from the current plans.Bid Form should read:Pay Item: 430-171-142 Pipe Culv (Opt Matl) (Elliptical) (42”SS) LF 77A copy of the revised Bid Form is included with this addendum.Section 00020:Section 00020-1 contains the Amended Bid Due Date, Description of Work and PurchasingAgent information.A copy of Section 00020-1 is included with the addendum.Page 1 of 2


ADDENDUM # 4CITY OF DELTONABID # PW 13-05February 18, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATETetra Tech Plans:The Tetra Tech Water Main Improvement Plans are for bid preparation purposes.ALL OTHER SPECIFICATIONS AND CONDITIONS REMAIN UNCHANGEDRECEIPT OF THIS ADDENDUM IS HEREBY ACKNOWLEDGEDNAME OF BUSINESSBY SIGNATURE / DATENAME & TITLE, TYPED OR PRINTEDMAILING ADDRESSCITY, STATE, ZIP CODEPage 2 of 2


Section 00020Announcement and Bid DocumentsForTHE CITY OF DELTONAPUBLIC WORKS DIVISIONITB # PW 13-05Normandy Boulevard (Sec. B)Saxon Boulevard to Fort Smith BlvdNOTICE IS HEREBY GIVEN: That sealed bids will be received by the City of Deltona, Public Works Division, at 255 Enterprise Road,Deltona, Florida 32725; until Thursday, February 28, 2013 at 2:00 p.m.Any bids received after the above time will not be accepted under any circumstances. Bids will not be accepted at any other locationwithin the City except for the address above. Bids will not be accepted at City Hall. Any uncertainty regarding the time a bid isreceived will be resolved against the Bidder.Bid opening will be promptly at 2:00 p.m. on Thursday, February 28, 2013 at the Deltona Water Administration 2 nd floor ConferenceRoom, 255 Enterprise Road, Deltona, Florida 32725, at which time all bids received will be publicly opened and read aloud.MANDATORY PRE-BID CONFERENCE: A pre-bid conference will be held at the City of Deltona Water Department located at 255Enterprise Road, Deltona, Florida 32725, 2 nd floor training room on Monday, February 11, 2013 at 10:00 a.m. Representatives of theCity will be present to discuss the Project. Bidders must attend the conference for your bid to be considered. City will transmit to allprospective Bidders of record such Addenda as City considers necessary in response to questions arising at the conference. Oralstatements made by the City may not be relied upon and will not be binding or legally effective.DESCRIPTION OF WORK: All work for the Project shall be constructed in accordance with the Drawings and Specifications preparedby Bowyer-Singleton & Associates, Inc. and Tetra-Tech the proposed improvements will be awarded and constructed, if award ismade, under one Contract. Bids shall be submitted for furnishing, delivering and installing all materials, equipment and services,including labor, for the Work, which generally involves:Reconstruct approx. 0.60 miles of 2 lane rural section roadway on Normandy Blvd. to a 3 lane urban section with bike lanes.Construct 2 drainage retention ponds.Construct approx. 2,912’ of 18” to 42” storm drainage pipe and approx. 31 storm drainage structures.Construct approx. 3,555 linear feet of 16-inch water main, approx. 120 linear feet of 12-inch water main, approx. 30 linear feetof 8-inch water main, approx. 1,025 linear feet of 6-inch water main and approx. 80 linear feet of 4-inch water main, approx. 37services, approx. 10 tie-ins to existing mains, and various valves, fittings, fire hydrants and appurtenances.Grouting and abandonment or removal of existing water main.Striping, signage, pavement markings, temp. traffic control devices and signalization.To obtain a copy of the Bidding Documents, requestors shall contact in writing:Kate KraussPurchasing Agent for the City of Deltona, Public Works Division255 Enterprise Road, Deltona, Florida 32725Email at kkrauss@deltonafl.govPhone number: 386-878-8571Vendors who receive the bidding documents from the Purchasing Agent directly, shall be added as a planholder on Demandstar andshall receive all corresponding documents through the Demandstar website.Section 00020 00020- 1


Bids shall be prepared from complete Bidding Documents. Addendum will be sent via DemandStar to all holders of completesolicitation Bidding Documents up to forty eight (48) hours before bid time. Brief addendums may be issued between forty eight (48)hours and twenty-four (24) hours before bid time by facsimile to all holders of complete Bidding Documents.The City reserves the right to reject any or all proposals, to waive informalities in the proposals and to re-advertise for proposals. TheCity also reserves the right to separately accept or reject any item or items of a proposal and to award and/or negotiate a contract inthe best interest of the City.All questions are to be directed, IN WRITING, to Kate Krauss at kkrauss@deltonafl.gov or faxed to (386) 878-8971 seven calendardays prior to due date in order to issue an addenda.CONTACT:All prospective proposers are hereby instructed not to contact any member of the City of DeltonaCommission, City Manager, City of Deltona Staff members or Engineers contracted by the City forthis project, other than the noted contact person OR a member of the Purchasing staff regardingthis Item to Bid or their response at any time during the Bid process. Any such contact shall because for rejection of your submittal.• Questions regarding this bid are to be addressed in writing to:Kate KraussPublic Works Purchasing Agent255 Enterprise RoadDeltona, FL 32725E-Mail Address: kkrauss@deltonafl.govOr Fax: (386) 878-8971END OF SECTIONSection 00020 00020- 2


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Pay Item Description Unit Quantity Unit Cost Total Cost101-1 Mobilization LS 1102-1 Maintenance of Traffic LS 1102-3 Commercial Material for Driveway Maintenance CY 500104-100 Erosion Control Measures LS 1110-1-1 Clearing & Grubbing AC 9110-7-1 Mailbox, F&I, Single EA 23120-1 Regular Excavation CY 16,000120-6 Embankment CY 1,500160-4 Stabilization, Type B SY 17,000285-70-9 Optional Base Group 9 SY 12,050334-1-12 Type SP Structural Course (Traffic Level B) TN 1,326334-7-30 Friction Course (FC-9.5) (Rubber) TN 663400-1-2 Conc. Class I, Endwalls CY 9400-1-11 Conc. Class I, Retaining Walls CY 0425-1-311 Inlets(Curb)(Type P-1)(


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Item No. Description Unit Quantity Unit Cost Total Cost1 Mobilization/Demobilization LS 12 General Requirements, Bonds and Insurance LS 13 Locate Utilities in Advance of Construction LS 14 Survey Layout and As-Builts LS 15 Furnish and install 4-inch DIP water main (restrained joint) LF 806 Furnish and install 6-inch PVC water main (restrained joint) LF 7107 Furnish and install 6-inch PVC water main (push) LF 1158 Furnish and install 6-inch DIP water main (restrained joint) LF 2009 Furnish and install 8-inch PVC water main (restrained joint) LF 3010 Furnish and install 8-inch PVC water main (push) LF 011 Furnish and install 12-inch DIP water main (restrained joint) LF 12012 Furnish and install 16-inch PVC water main (restrained joint) LF 234013 Furnish and install 16-inch PVC water main (push) LF 103014 Furnish and install 16-inch DIP water main (restrained joint) LF 18515 Abandon and grout fill existing water main LF 492016 Removal and disposal existing water main LF 210017 4-inch 45 Degree Bend EA 418 6-inch 45 Degree Bend EA 1619 6-inch 22.5 Degree Bend EA 220 6-inch 11.25 Degree Bend EA 321 8-inch 45 Degree Bend EA 222 12-inch 45 Degree Bend EA 423 16-inch 11.25 Degree Bend EA 724 16-inch 22.5 Degree Bend EA 125 16-inch 45 Degree Bend EA 3426 6-inch Tee EA 127 16 x 4-inch Tee EA 128 16 x 6-inch Tee EA 429 16 x 8-inch Tee EA 130 16 x 12-inch Cross EA 131 6 x 4-inch Reducer EA 232 16 x 12-inch Reducer EA 133 4-inch Gate Valve EA 134 6-inch Gate Valve EA 535 8-inch Gate Valve EA 136 12-inch Gate Valve EA 337 16-inch Gate Valve EA 438 Air Release Valve EA 6Section 00300 00300-5


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Item No. Description Unit Quantity Unit Cost Total Cost39 Fire Hydrant EA 1140 1-inch Single Service - Short EA 1341 1-inch Single Service - Long EA 542 1-inch Double Service - Short EA 543 1-inch Double Service - Long EA 1444 4-inch Direct Connect & Fitting Assembly – Potable EA 445 6-inch Direct Connect & Fitting Assembly – Potable EA 246 8-inch Direct Connect & Fitting Assembly – Potable EA 147 12-inch Direct Connect & Fitting Assembly – Potable EA 348 Testing and Laboratory Services (Allowance) LS 1SUBTOTAL UTILITY BASE BID $SUBTOTAL ROADWAY BASE BID:(IN WORDS)$(IN FIGURES)SUBTOTAL UTILITY BASE BID:(IN WORDS)$(IN FIGURES)TOTAL ROADWAY & UTILITY BASE BID:(IN WORDS)$(IN FIGURES)Section 00300 00300-6


NORMANDY BLVDPROVIDENCE BLVD.CITY OF DELTONAWATER MAIN IMPROVEMENTSNORMANDY BOULEVARD PART BSAXON BLVD201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955FAX: (407) 839-3790www.tetratech.comPROJECT LOCATION:DELTONA, FLORIDACLIENT INFORMATION:CITY OF DELTONA255 ENTERPRISE ROADDELTONA, FLORIDA 32725I-4Tt PROJECT No.:200-08534-13001CLIENT PROJECT No.:PROJECT DESCRIPTION / NOTES:DELTONA BLVDWATER MAIN REPLACEMENT ALONG:NORMANDY BOULEVARD, STARTS 400 FT SOUTHWEST OF SAXONBLVD AND ENDS 400 FEET SOUTHWEST OF FORT SMITH BOULEVARDISSUED:BID SETFT SMITH BLVDPROJECTLOCATIONVICINITY MAP:SAXON BLVDNORMANDY BLVDPROJECT LOCATIONFOR CITY OF DELTONAMAYORJOHN C. MASIARCZYK, SR.VICE MAYORZENAIDA DENIZACDISTRICT 1CITY MANAGERFAITH G. MILLERCOMMISSIONERSWEBSTER BARNABYDISTRICT 2HEIDI HERZBERGDISTRICT 3NANCY SCHLEICHERDISTRICT 4FRED LOWRYDISTRICT 5CHRIS NABICHTDISTRICT 6Michael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________DATE ______________


1/9/2013 9:24:05 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\G002 GENERAL NOTES.DWG - LOPEZ, HERNANNORMANDY BOULEVARDGENERAL NOTESAND DRAWING INDEXMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7GENERAL NOTESDRAWING INDEXFED1. ALL PIPING SHALL HAVE 3'-0" MINIMUM COVER.2. ALL EXISTING PAVING, STABILIZED EARTH, DRIVEWAYS, CURBS, SIDEWALKS, FENCES,GRASSED AREAS, LANDSCAPING, CULVERTS, FRENCH DRAINS, ETC. DISTURBED BYTHE CONTRACTOR'S OPERATIONS SHALL BE RESTORED TO EQUAL OR BETTERCONDITION. RESTORATION OF GRASSED AREAS SHALL BE DONE BY SODDING.SEED-AND-MULCH IS NOT ACCEPTABLE.3. FITTINGS MAY BE USED FOR PIPE ALIGNMENT CHANGES RATHER THAN DEFLECTINGAT THE CONTRACTOR'S OPTION AND WITH NO ADDITIONAL COMPENSATION.4. THE CONTRACTOR SHALL NOT PLACE ANY FILL MATERIAL WITHIN WETTED DITCH ORWETLAND AREAS. SILTATION FENCES SHALL BE INSTALLED BY THE CONTRACTORBETWEEN WORK AND SUCH AREAS. SEE SHEET C503 DETAIL 3.5. PRIOR TO BID PREPARATION, THE CONTRACTOR MUST FAMILIARIZE HIMSELF WITHTHE OVERALL SITE CONDITIONS AND PERFORM ADDITIONAL INVESTIGATIONS ASDETERMINED NECESSARY TO UNDERSTAND THE LIMIT AND DEPTH OF EXPECTEDORGANIC SILT PEAT AREAS, ADEQUACY OF EXISTING MATERIALS TO USE AS FILL,DEWATERING REQUIREMENTS, CLEAN FILL REQUIRED FROM OFFSITE, ANDMATERIALS TO BE DISPOSED OF OFFSITE, ALL OF WHICH WILL AFFECT HIS PRICING.ANY DELAY, INCONVENIENCE, OR EXPENSE CAUSED TO THE CONTRACTOR DUE TOINADEQUATE INVESTIGATION OF EXISTING CONDITIONS SHALL BE INCIDENTAL TOTHE CONTRACT, AND NO EXTRA COMPENSATION WILL BE ALLOWED. THEMATERIALS ANTICIPATED TO BE ENCOUNTERED DURING CONSTRUCTION MAYREQUIRE DRYING PRIOR TO USE AS BACKFILL, AND THE CONTRACTOR MAY HAVE TOBRING IN MATERIALS, AT NO EXTRA COST, FROM OFFSITE TO MEET THEREQUIREMENTS FOR COMPACTION AND PROPER FILL.6. ALL CULVERTS AND EXISTING FACILITIES DAMAGED BY THE CONTRACTOR'SOPERATIONS SHALL BE REPLACED WITH MATERIAL TO MATCH EXISTING.7. ALL DRAINAGE AREAS THAT ARE CROSSED BY PIPELINES SHALL BE LEFT OPEN ATALL TIMES EXCEPT FOR SHORT PERIODS AS MAY BE NECESSARY DURING ACTUALCONSTRUCTION HOURS.8. THE CONTRACTOR SHALL OBTAIN THE SERVICES OF A REGISTERED FLORIDAPROFESSIONAL LAND SURVEYOR FOR LAYOUT OF ALL WORK, FOR RESTORING ALLMONUMENTS AND PROPERTY CORNERS DISTURBED DURING CONSTRUCTION ANDFOR PREPARATION OF PROJECT AS-BUILT DRAWINGS AND FOR PREPARATION OFPROJECT AS-BUILT DRAWINGS. PROOF OF REGISTRATION SHALL BE SUBMITTED TOENGINEER.9. THE COORDINATES AND ELEVATIONS SHOWN HEREIN ARE BASED ON INFORMATIONPROVIDED BY BOYER SINGLETON & ASSOCIATES LOCATED IN THE DRAWINGS SETNAMED "NORMANDY BLVD. SAXON BLVD. TO FORT SMITH BLVD." BID PLANS DATEDDECEMBER 2012. BENCH MARKS ARE SHOWN ON SHEETS C-102, C-106 AND C-108.10. THE CONTRACTOR SHALL LOCATE ALL PIPELINES AT PROPOSED TIE-IN LOCATIONSTO VERIFY ACTUAL LOCATION, SIZE, ELEVATION, AND MATERIAL PRIOR TO ORDERINGNEW MATERIALS.DETERMINED NECESSARY FOR CONSTRUCTION. CONTRACTOR IS SOLEYRESPONSIBLE FOR ALL COSTS WHETHER OR NOT HOLDING UTILITY POLES ISDEPICTED IN THE PROJECT DRAWINGS.15. FLORIDA LAW (F.S. 553.851) REQUIRES THAT PERSONS MAKING EXCAVATIONS INPUBLIC AND PRIVATE STREETS, ALLEYS, RIGHT-OF-WAYS OR UTILITY EASEMENTSMUST FIRST OBTAIN INFORMATION ON LOCATION OF UNDERGROUND GAS PIPELINES.16. LOCATIONS AND ELEVATIONS OF EXISTING UTILITIES EXPOSED DURINGCONSTRUCTION SHALL BE ACCURATELY RECORDED ON THE CONSTRUCTIONDRAWINGS. THE ENGINEER SHALL BE IMMEDIATELY NOTIFIED OF ANY CONFLICTSWITH PROPOSED CONSTRUCTION. THE ENGINEER AND/OR OWNER MAY WITHHOLDPROGRESS PAYMENTS IF AS-BUILT DRAWINGS ARE NOT MAINTAINED DURINGCONSTRUCTION AND KEPT UP TO DATE WITH NEW AND EXISTING UTILITIESACCURATELY RECORDED.17. CONTRACTOR SHALL COORDINATE WITH ALL UTILITIES (EXISTING AND PROPOSED)TO VERIFY FINAL LOCATIONS, DEPTHS, QUANTITIES AND SIZE OF ALL UTILITIES PRIORTO THE START OF CONSTRUCTION FOR THIS PROJECT.18. THE INFORMATION SHOWN ON THESE DRAWINGS CONCERNING TYPE AND LOCATIONOF UNDERGROUND AND OTHER UTILITIES IS BASED ON AVAILABLE RECORDS ANDSURVEYS BUT IS NOT GUARANTEED TO BE ACCURATE OR ALL INCLUSIVE. THECONTRACTOR SHALL MAKE HIS OWN DETERMINATION AS TO THE TYPE ANDLOCATION OF UTILITIES AS MAY BE NECESSARY TO AVOID DAMAGE THERETO AND ISRESPONSIBLE FOR COORDINATING UTILITY RELOCATION WITH PROJECTCONSTRUCTION. CONTRACTOR IS SOLEY RESPONSIBLE FOR ALL COSTS AND FEESASSOCIATED WITH UTILITY RELOCATION AND/OR DAMAGE INCURRED DURINGCONSTRUCTION WHETHER OR NOT THE UTILITY IS DEPICTED IN THE PROJECTDRAWINGS. CONTRACTOR WILL NOT BE COMPENSATED FOR ANY COSTSASSOCIATED WITH LOST PRODUCTION DUE TO EXISTING UTILITIES WHETHER OR NOTTHE UTILITY IS DEPICTED IN THE PROJECT DRAWINGS.19. THE CONTRACTOR SHALL COORDINATE THE LOCATION OF ALL PROPOSED FIREHYDRANTS WITH THE CITY OF DELTONA.20. ALL EXISTING WATER SERVICES WILL BE REMOVED, REPLACED, AND RECONNECTEDTO EXISTING CUSTOMERS WATER SERVICES WITH NEW SERVICES INCLUDINGMETERS AND METER BOXES TO FINISHED GRADE. SERVICE METERS SHALL BENEPTUNE T-10. METER BOXES SHALL BE NDS-PRO SERIES, DOUBLE-D1500,SINGLE-D1200, MODEL 125BCDWB OR MODEL 121BCDMCIFB. EXISTING METERSLOCATED WITHIN SIDEWALKS OR DRIVEWAYS SHALL BE RELOCATED OUT OFSIDEWALKS AND DRIVEWAYS. EXISTING METER BOXES SHALL BE REMOVED ANDCONCRETE SHALL BE REPAIRED. (REPLACE 4'X4' SIDEWALK MINIMUM).21. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE (LONG OR SHORT & SINGLE OR DOUBLE) OF ALL EXISTING ANDPROPOSED WATER SERVICES PRIOR TO START OF CONSTRUCTION. CONTRACTORSHALL MEET WITH THE CITY TO DETERMINE QUANTITIES OF ALL EXISTING ANDPROPOSED WATER SERVICES.Sheet Number-- COVERG002G003G004SHEET LIST TABLESheet TitleGENERAL NOTES AND DRAWING INDEXLEGEND AND ABBREVIATIONSKEYPLANC101 PLAN AND PROFILE - STATION 9+00 TO 14+00C102 PLAN AND PROFILE - STATION 14+00 TO 18+00C103 PLAN AND PROFILE - STATION 18+00 TO 22+50C104 PLAN AND PROFILE - STATION 22+50 TO 27+00C105 PLAN AND PROFILE - STATION 27+00 TO 31+50C106 PLAN AND PROFILE - STATION 31+50 TO 36+00C107 PLAN AND PROFILE - STATION 36+00 TO 40+00C108 PLAN AND PROFILE - STATION 40+00 TO 44+00C109C501C502C503C504PACO CT. & ECHO CT. WATER MAINDETAILSDETAILSDETAILSDETAILSDATE ______________CB11. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE HORIZONTAL& VERTICAL LOCATION OF ANY EXISTING UTILITIES OR PIPELINES PRIOR TOCONSTRUCTION. DEPTH DEPICTED IN PROFILE VIEW ARE ASSUMED TO BE 3 FEET.12. HORIZONTAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARYOR STORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST THREE FEET BETWEEN THE OUTSIDE OFTHE WATER MAIN AND THE OUTSIDE OF ANY EXISTING OR PROPOSED STORMSEWER.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST SIX FEET AND PREFERABLY TEN FEET,BETWEEN THE OUTSIDE OF THE WATER MAIN AND THE OUTSIDE OF ANYEXISTING OR PROPOSED GRAVITY-TYPE SANITARY SEWER, WASTEWATERFORCE MAIN AND RECLAIMED WATER MAIN. THE MINIMUM HORIZONTALSEPARATION DISTANCE BETWEEN WATER MAINS AND GRAVITY-TYPE SANITARYSEWERS SHALL BE REDUCED TO THREE FEET WHERE THE BOTTOM OF THEWATER MAIN IS LAID AT LEAST SIX INCHES ABOVE THE TOP OF THE SEWER.12. VERTICAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARY ORSTORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED GRAVITY-TYPE SANITARY SEWER OR STORM SEWER SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID SO THE OUTSIDE OF THE WATER MAIN IS AT LEAST SIX INCHES, ANDPREFERABLY 12 INCHES, ABOVE OR AT LEAST 12 INCHES BELOW THE OUTSIDEOF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TO LAY THE WATERMAIN ABOVE THE OTHER PIPELINE.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED WASTEWATER OR STORMWATER FORCE MAIN SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID TO THE OUTSIDE OF THE WATER MAIN AT LEAST 12 INCHES ABOVE ORBELOW THE OUTSIDE OF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TOLAY THE WATER MAIN ABOVE THE OTHER PIPELINE.C) AT THE UTILITY CROSSINGS DESCRIBED IN PARAGRAPHS (A) AND (B) ABOVE,ONE FULL LENGTH OF WATER MAIN PIPE SHALL BE CENTERED ABOVE OR BELOWTHE OTHER PIPELINE SO THE WATER MAIN JOINTS WILL BE AS FAR AS POSSIBLEFROM THE OTHER PIPELINE. ALTERNATIVELY, AT SUCH CROSSINGS, THE PIPESSHALL BE ARRANGED SO THAT ALL WATER MAIN JOINTS ARE AT LEAST THREEFEET FROM ALL JOINTS IN STORM SEWERS AND AT LEAST SIX FEET FORM ALLJOINTS IN GRAVITY-TYPE SANITARY SEWERS AND WASTEWATER FORCE MAINS.13. A MINIMUM OF ONE TRAFFIC LANE SHALL BE MAINTAINED AT ALL TIMES DURINGINSTALLATION OF PIPELINE ROADWAY CROSSINGS. CONTRACTOR SHALL BERESPONSIBLE FOR MAINTENANCE OF TRAFFIC DURING THE WORK AND FORCOORDINATION WITH THE OWNER, AS NECESSARY.14. CONTRACTOR SHALL BE RESPONSIBLE FOR CONTACTING OTHER UTILITYCOMPANIES AND ARRANGING TO HAVE UTILITY POLES HELD OR RELOCATED IF22. IF FIELD CONDITIONS REQUIRE, THE LOCATION OF PROPOSED MAINS CAN BEADJUSTED WITHIN THE RIGHT OF WAY WITH THE APPROVAL OF THE ENGINEER ANDOWNER. THE DISTANCE FROM THE OUTSIDE EDGE OF THE MAIN AND THE RIGHT OFWAY SHALL BE GREATER THAN OR EQUAL TO 4 FEET.23. IF FIELD CONDITIONS PERMIT, CONTRACTOR SHALL DEFLECT THE PROPOSED MAINSABOVE CROSS PIPE CONFLICTS, i.e. STORM DRAINS AND SEWER LATERALS, INSTEADOF BELOW, UNLESS AN INTERMEDIATE HIGH POINT IS CREATED.24. EACH BACTERIOLOGICAL SAMPLE POINT SHALL BE EQUIPPED WITH A CORPORATIONSTOP, DISCHARGE PIPE, AND ABOVE-GRADE VALVE. FOLLOWING PASSAGE OFBACTERIOLOGICAL TESTING, THE CONTRACTOR SHALL REMOVE THE CORPORATIONSTOP AND PLUG THE CONNECTION.25. CONTRACTOR WATER MAIN CLEARANCE PACKAGES SHALL CONTAIN AS-BUILTDRAWINGS SIGNED AND SEALED BY A LICENSED SURVEYOR, PASSINGBACTERIOLOGICAL TEST REPORTS, AND PRESSURE TEST FORMS SIGNED BY THECITY PROJECT INSPECTOR. SUBMITTALS SHALL INCLUDE FOUR (4) HARDCOPY SETSINCLUDING THE ORIGINAL PASSING BACTERIOLOGICAL SAMPLE REPORTS AND ONE(1) CD CONTAINING ELECTRONIC FILES OF AS-BUILT DRAWINGS IN AUTOCADFORMAT. AS-BUILT DRAWINGS SHALL DEPICT THE INFORMATION REQUIRED IN THECONTRACT DOCUMENTS ALONG WITH THE LOCATIONS OF THE BACTERIOLOGICALSAMPLES LABELED TO CORRESPOND TO THE BACTERIOLOGICAL SAMPLE REPORTS.FAILURE OF THE CONTRACTOR TO PROVIDE THE REQUIRED INFORMATION ORSUBMISSION OF POOR QUALITY AS-BUILT DRAWINGS WILL COUNT AS ANAPPLICATION REVIEW. POOR QUALITY AS-BUILT DRAWINGS WILL BE RETURNED WITHCOMMENTS ONE (1) TIME AND SUBSEQUENT REVIEWS OF POOR QUALITY AS-BUILTDRAWINGS SUBMITTED BY THE CONTRACTOR WILL BE COUNTED AS ONE (1)APPLICATION REVIEW PER INSTANCE AND THE CITY AND ENGINEER WILL DEDUCTREVIEW, HANDLING, AND DIRECT COSTS FROM THE CONTRACTOR'S PROGRESSPAYMENT APPLICATIONS AND/OR PROJECT RETAINAGE. THE PROJECT MANUALAND/OR THE DRAWINGS WILL SPECIFY THE CONTRACTOR'S RESPONSIBILITIES ANDESTIMATED COSTS. PARTIAL SUBMITTALS WILL NOT BE REVIEWED. PARTIALCLEARANCES SHALL BE FOR A STREET IN ITS ENTIRETY INCLUDING BRANCHINGSTREETS AT MINIMUM UNLESS APPROVED IN WRITING BY THE ENGINEER PRIOR TOSUBMITTAL.26. CONTRACTOR SHALL COORDINATE LIMITS OF REMOVAL AND REPLACEMENT OFASPHALT AND CONCRETE WITH CITY OF DELTONA AND THE ENGINEER.27. CONTRACTOR WILL BE REQUIRED TO INSTALL AIR RELEASE VALVES OR FIREHYDRANTS AT NO ADDITIONAL COST TO THE OWNER AT ALL HIGH POINTS CREATEDBY THE CONTRACTORS INSTALLATION AS DETERMINED BY THE ENGINEER AND THECITY OF DELTONA.28. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE OF ALL EXISTING SEWER LATERALS/SERVICES AND RELOCATETHEM AS NECESSARY TO ACCOMMODATE THE PROPOSED PROJECT. RELOCATIONOF SEWER LATERALS/SERVICES 12" BELOW THE PROPOSED WATER MAIN ISPREFERRED.29. CONTRACTOR SHALL RESTRAIN ALL EXISTING UTILITIES AS NEEDED IN ACCORDANCEWITH DETAIL 2 DRAWING C501.30. ALL PROPOSED PIPE AND FITTINGS SHALL BE MECHANICAL JOINT UNLESSOTHERWISE NOTED.31. RESTRAINED JOINTS FOR PVC PIPE SHALL BE MANUFACTURED RESTRAINED JOINTS.MARKWMSERVICEMATERIALPOTABLE WATER PVC DR-18 N/A DI CEMENT DI 250 CEMENT DI CEMENTNOTES:BURIED PIPE BURIED FITTINGS BELOW ROADWAY PIPE BELOW ROADWAY FITTINGSCLASSPIPING MATERIAL SCHEDULELININGMATERIAL1. ALL PIPE LINING, INCLUDING ANY MATERIAL WHICH COMES INTO CONTACT WITH POTABLEWATER SHALL BE NSF (STANDARD 61) APPROVED FOR USE WITH POTABLE WATER.2. BELOW GROUND PIPE SHALL BE "BLUE", COLOR OR STRIPES AS SPECIFIED IN SECTION9905 FOR THE POTABLE WATER MAINS.3. DUCTILE IRON PIPE SHALL BE ENCASED IN POLYETHYLENE TWENTY-FIVE (25) FEET ONEACH SIDE OF ANY PERPENDICULAR CROSSING OF METALLIC GAS MAINS OR ANY OTHERCATHODICALLY PROTECTED PIPELINE AND FOR LOCATIONS PARALLEL TO AND WITHIN TENFEET OF METALLIC GAS MAINS OR OTHER CATHODICALLY PROTECTED PIPE AND THROUGHTHE AREA OF INFLUENCE OF CATHODIC PROTECTION ANODE BED.4. PIPE CLASS SHALL MEET SPECIFICATION 15050.LININGMATERIALCLASS48 HOURS BEFORE DIGGINGLININGMATERIALLININGCITY OF DELTONAA32. ASBESTOS CEMENT (AC), DUCTILE IRON, AND PVC WATERMAIN IN CONFLICT WITHPROPOSED DRAINAGE IMPROVEMENTS (STRUCTURES, PIPES, ETC)SHALL BEREMOVED IN ACCORDANCE WITH SPECIFICATIONS 01100, 02050 AND 02080.CALLTOLL FREE1-800-432-4770Project No.:Designed By:Drawn By:200-08534-13001MBSPDSUNSHINE STATE ONE CALL CENTERChecked By:MADG002Bar Measures 1 inch


1/10/2013 10:12:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4' MIN.(TYP)3' MIN.(TYP)3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 9+00 TO 14+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDR/W4C502STA:13+52.67, 56.02'LDIRECT CONNECT TO6" GATE VALVE, 6" 45° BEND4 1C502 C504EXISTING 12" WMBACT. SAMPLE LOCATIONNOTE:C502 C504 (2) 12" 45° BENDSDROP INLET12" GATE VALVESTA:9+45.25, 37.61'LTOP 54.321. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR8 BACT. SAMPLE LOCATION6" TEE, (2) 6" 45° BENDS (DEFLECT PIPE UP)(2) 6" 45° BENDS (DEFLECT PIPE DOWN)STABILIZATION/BRACING OF EXISTING LIGHT POLE TO INSTALL WATER MAINSTA:13+48.73, 34.15'L4C5021C504R/W R/W6''W 6''W2C502STA:9+34.22, 31.32'LDIRECT CONNECT TOEXISTING 6" WM. (2) 6" 45°BENDS, 6" GATE VALVEBACT. SAMPLE LOCATION1C5049 + 0041WVDROP INLETTOP 55.13WV6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEPROPOSED 6" DIWATER MAIN TO BEINSTALLED AT DEPTHSUFFICIENT TO BEBELOW EXST 6" WMDROP INLETTOP 54.20SDR/WSD SDWATER545457DROP INLETTOP 53.68R/W R/W R/W R/W R/W R/W R/WSTA:9+44.14, 25.53'R16"x6" TEE, 16" CAP AND16" GATE VALVEFH ASSEMBLYBACT. SAMPLE LOCATIONSTA:9+60.09, 25.68'R(2) 16" 45° BENDSSTA:9+80.88, 55.76'LDIRECT CONNECT TO EXIST4" WM. 6"x4" REDUCER6''WEXISTING36" RCP16''WR/WR/W6''WWV30.00' EXISTINGDRAINAGE EASEMENT4''W 4''WQUINCY AVE.STA:9+74.32, 44.96'LFH ASSEMBLY6''WSTA:9+69.88, 37.79'L(2) 6" 45° BENDS(ROTATE AS REQUIRED)10 + 004" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE2C502PRC: 10+00.00STA:9+86.24, 25.41'R(2) 16" 45° BENDSR/WR/WINLET TYPE P-1TOP 55.09S INV. 50.5016''W 16''W2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2718" PIPER/W R/W11+00555516''W8''W56MITERED END SECTIONNS INV. 50.00PROPOSED 16"PVC WATER MAINSTA:10+79.65, 35.00'R(2) 16" 45° BENDS8" VALVE2-1/2' DEEP555555R/WWATERELECR/W R/W R/W8''W 8''WNORMANDY BLVD.16''WSTA:11+63.26, 33.97'R(2) 16" 45° BENDS2C5045C501PROPOSED SHORTWATER SERVICE (TYP)REMOVE AND REPLACEEXISTING DRIVEWAY(TYPICAL)EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W12 + 00PROPOSED LONGWATER SERVICE (TYP)16''W8''WR/W R/W R/WSTA:12+00.01, 33.97'R(2) 16" 45° BENDS2C5042C502R/WREMOVE AND REPLACEEXISTING SIDEWALK3C501STA:13+00.00, 34.01'RFH ASSEMBLY(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM4C502EXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/WR/W12''W12''WWATER12''WR/W8''W57SAXON BLVD.13+00 +PT: 13+04.03WV12''W 12''W16''W 16''WSTA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)1C504SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACESTA:13+50.76, 59.03'RDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONWVEXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACE12''WOPEN CUT6C50116''WWATERWATER5514 00STA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSS0MATCHLINE STA: 14+00.008''WR/WEXISTING 8" AC WM4' DEEP10 20 40TELNSCALE: 1" = 20'R/WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866647068666462CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)62B60585654525048464442FHASSEMBLY16" CAP, 16"GATE VALVE,FH ASSEMBLY16"X6"TEEEXIST. 36" RCPINV. 47.76QUINCY AVE.S-101FL 50.70(+) 0.309%12" MIN.(TYP)18" PIPE(FUTURE, SEE ROADWAYENGINEER PLANS) INV. ±50.40FL 50.50S-10418" PIPEFL 50.80(2) 16" 45°BENDSPROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(2) 16" 45°BENDS(2) 16" 45°BENDSEXISTING GRADEABOVE PROPOSED PIPE(+) 0.309% (-) 0.321%FHASSEMBLY16" 45° BENDS(ROTATE AS REQUIRED)16"x12"CROSSPROPOSED16" DI WMSAXON BLVD.EXISTING12" WM60585654525048464442CITY OF DELTONA40(2) 16" 45°BENDS(2) 16" 45° BENDS4038383636A34323432Project No.:Designed By:Drawn By:200-08534-13001MBSPD10 309+003010+00 11+00 12+00 13+00 14+00Checked By:MADC101Bar Measures 1 inch


1/9/2013 2:36:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN543' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 14+00 TO 18+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7R/W25R/WNFEDSTA:13+52.67, 56.02'LDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONSTA:13+48.73, 34.15'L(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/W12''W12''WWATER13+00 +16''WPT: 13+04.03STA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEWV12''W 12''WR/W16''W12''WWV8''WSAXON BLVD.EXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEOPEN CUT6C501MATCHLINE STA: 14+00.00WATER55R/W8''W 8''WTELVERTICAL BENCHMARK 007CODN 1654429.94E 584739.67ELEV 55.39R/W R/W R/W14 00 +16''WSTA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSSR/WEXISTING 8" AC WM4' DEEPARVR/WPC: 14+54.035315 008''W 8''W16''W 16''W 16''WSTA:14+22.78, 35.00'RARV ASSEMBLY(2) 16" 45° BEND7C501UTILITYCONFLICTR/W R/W R/W4C504WV5252EXISTING 8" AC WM4-1/2' DEEPSTA:15+00.00, 35.00'R416" GATE VALVENOTE:R/W5151NORMANDY BLVD.16 + 00REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTC50216''W50R/W R/W R/W8''W 8''W 8''WR/W R/WPROPOSED 16" PVCWATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 274949484816''W 16''W17 + 00R/W R/W R/W R/W48R/W R/W R/W R/W R/WSTA:16+65.14, 35.00'RFH ASSEMBLYPROPOSED LONGWATER SERVICE (TYP)2C5022C50447464645458''W 8''W 8''WPRC: 17+58.0516''W 16''W18 + 00MATCHLINE STA: 18+00.00010 20 40SCALE: 1" = 20'494916''WDATE ______________R/WSTA:13+50.76, 59.03'RDIRECT CONNECT TO12''W70687068SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C66646266646260585654(-) 1.417%(2) 16" 45°BENDS(-) 2.697%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINE6058565452FOC5250FOC18" PIPES-20350B484644424038ARVPROPOSED16" DI WM16" GATEVALVEPROPOSED16" PVC WMS-201FL 44.30(-) 2.697%FOCFHASSEMBLY(+) 0.599%18" PIPE18" PIPEFL 43.4018" PIPE484644424038CITY OF DELTONA3634EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA3634A3232303014+00 15+00 16+00 17+00 18+00Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMADC102Bar Measures 1 inch


1/9/2013 2:43:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANWATER WATER3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 18+00 TO 22+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra TechFE481R/W R/W R/W R/W47464645458''W 8''W 8''WPRC: 17+58.0516''W18 + 00R/W R/W R/WMATCHLINE STA: 18+00.00492 3 4 5 6 74916''WWATER5050515216''W535324R/W R/W R/W8''W 8''W19 + 004949NOTE:R/W R/W R/W4949231. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2716''WPROPOSED LONGWATER SERVICE (TYP)16''W8''W2C50420 + 00R/W R/W R/WNORMANDY BLVD.R/W8''W 8''WREMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)WATER16''W 16''WINLET TYPE P-1TOP 49.75NE INV. 42.4021+00R/W R/W R/W16''W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE50R/W8''W24" PIPE2C502EXISTING 4" AC WM3-1/2' DEEP51525354R/W16''W4''W22+00WV4748PACO CT.MANHOLE P-7TOP 50.03SW INV. 42.204950FOUND ND LB1221R/W R/W R/W51TEL5253STA:22+69.50, 40.95'LFOUND IR 1/2 LB5383ARV ASSEMBLYBACT. SAMPLE LOCATION54R/W8''W 8''W16''W6''WARV6''WPROPOSED 6"PVC WATER MAINSEE SHT. C109 FOR PACO CT. WATER MAINSTA:22+00.00, 34.66'RFH ASSEMBLY0MATCHLINE STA: 22+50.00NSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM10 20 40SCALE: 1" = 20'WVPROPOSED 6"DI WATER MAIN16''WOPEN CUTR/WWATERWATER23+00WATERSTA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEDATE ______________D2C504PROPOSED SHORTWATER SERVICE (TYP)STA:21+69.13, 34.55'R(2) 16" 45° BENDSSTA:21+93.30, 34.55'R(2) 16" 45° BENDSSCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866646260706866646260B585654525048464442403818" PIPEFL 43.10S-20518" PIPEFL 44.40FL 42.60PROPOSED GRADEAT ROAD CENTERLINEPROPOSED GRADE ATPIPE CENTERLINES-20718" PIPEFL 45.4024" PIPE 24" PIPEPROPOSED16" PVC WMFL 42.40EXISTING GRADEABOVE PROPOSED PIPE(4) 16" 45°BENDSFHASSEMBLYPACO CT.(+) 0.599% (-) 1.000%S-209A50.495856545250484644424038CITY OF DELTONAA363432EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA363432Project No.:Designed By:Drawn By:200-08534-13001MBSPD3018+00 19+00 20+00 21+00 22+0030Checked By:MADC103Bar Measures 1 inch


1/10/2013 10:24:18 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4''W6''W3' MIN.(TYP)4646MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 22+50 TO 27+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 74545F4''W42434445456''WWATERWATERBlock 381NOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 272C504STA:26+04.54, 130.00'LARV ASSEMBLYBACT. SAMPLE LOCATION1C504PROPOSED LONG DOUBLEWATER SERVICE (TYP)4C504R/WWMARVWV STUBPROPOSED LONG DOUBLEWATER SERVICE (TYP)2C5044748R/WWMWATER0N10 20 40SCALE: 1" = 20'4''W 4''WR/W R/W46462C504PROPOSED SHORT SINGLEWATER SERVICE (TYP)EXISTING 4" AC WM3-1/2' DEEPR/WEDCSEE SHT. C109 FOR PACO CT. WATER MAINEXISTING 4" AC WM3-1/2' DEEP22 + 00R/W4''WWV51525016''W5316''W54PACO CT.R/W R/W R/W494847TEL6''WWATERR/W12R/W R/W8''W 8''W 8''W 8''W6''WWVARV23 + 00R/W R/W5049494545464724 + 004848WATER11R/W R/W R/W R/WNORMANDY BLVD.8''W 8''W 8''WMANHOLE P-7TOP 50.03PROPOSED 6"SW INV. 42.20 DI WATER MAININLET TYPE P-1TOP 46.996OPEN CUTNE INV. 41.80MATCHLINE STA: 22+50.00STA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEPROPOSED 6"PVC WATER MAINSTA:22+69.50, 40.95'LARV ASSEMBLYBACT. SAMPLE LOCATIONSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMC50116''W4C5041C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACT16''W16''WPT: 24+39.5416''W48R/W R/W R/W R/W R/W R/W R/W R/W R/W2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PROPOSED 16"PVC WATER MAINSTA:25+12.75, 28.65'R16" 11.25° BENDPROPOSED SHORTWATER SERVICE (TYP)PROPOSED 4"PVC WATER MAINSTA:25+94.69, 39.63'L(2) 4" 45° BENDS(ROTATE AS REQUIRED)STA:25+94.46, 22.47'L(2) 4" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM3-1/2' DEEPR/W4''W4''W 4''W478''W 8''W 8''W25 + 00 26 + 00 +16''W 16''WSTA:25+70.36, 35.00'R16" 11.25° BENDSTA:25+97.01, 32.69'R16"x4" TEE16" GATE VALVE4" GATE VALVEWVWV16''WWVOPEN CUTPROPOSED 4"DI WATER MAINSTA:26+35.49, 29.35'R16" 11.25° BEND6C5014" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.16''W24" PIPESTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501TELTELMATCHLINE STA: 27+00.0027 0016''W47R/W4747504846464949R/W16''WDATE ______________64626462SCALE:HORIZ. 1"= 20'VERT. 1" = 5'606058585656B5452504846444224" PIPE24" PIPES-20918" PIPEFL 44.60PROPOSED GRADEAT ROAD CENTERLINE24" PIPE(-) 1.000%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINES-21118" PIPECLAY CT.54525048464442CITY OF DELTONAA4038363432FL 42.2016"X6" TEE6" GATE VALVEFL 42.10PROPOSED 16"PVC WATER MAINEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA16" 11.25°BEND(-) 0.600%16" 11.25°BENDFL 41.8016"X4" TEE16" GATE VALVE4" GATE VALVEFL 42.6016" 11.25°BENDFHASSEMBLY4038363432Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMAD303023+00 24+00 25+00 26+00 27+00C104Bar Measures 1 inch


1/10/2013 10:32:54 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 27+00 TO 31+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FED16''WBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.24" PIPEFOUND ND BLACKBURNLB1221TEL TEL47R/WR/W4747504646484949WATERWATERR/W R/W R/W R/W R/W R/W8''W 8''W 8''W 8''W 8''W 8''W47474646R/W R/W R/W R/W R/W R/W R/W R/W R/WSTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501MATCHLINE STA: 27+00.0027 + 00 28 + 00 +16''WNOTE:REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAIN4545NORMANDY BLVD.16''W 16''W 16''W 16''W 16''WSTA:28+58.90, 35.00'R(2) 16" 45° BENDS7C5012C502UTILITYCROSSING1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2724" PIPESTA:28+95.00, 35.00'RFH ASSEMBLYSTA:28+81.00, 35.00'R(2) 16" 45° BENDSINLET TYPE P-1TOP 44.64SW INV. 39.904444WATER29 00 +STA:29+64.54, 35.00'R16" 11.25° BEND2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PC: 29+64.54PROPOSED SHORTWATER SERVICE (TYP)WATERWATERWATER WATERGAS43R/W R/W R/W8''W 8''W 8''W30 00PROPOSED LONGWATER SERVICE (TYP)16''W2C504STA:29+90.57, 30.02'R16" 11.25° BEND16''WGASR/W R/W R/WSTA:30+62.93, 35.00'R16" 11.25° BEND4C5021C5044231+00EXISTING 6" AC WM3' DEEP8" CAPBEGIN/END GROUT FILLEXISTING 8" WM TO BEGROUT FILLED ANDABANDON IN PLACER/W41WATERR/W R/W8''WWV8''W16''W 16''WSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMPROPOSED8" PVC WMSTA:31+36.94, 57.73'RDIRECT CONNECT TOEXISTING 8" WM(2) 8" 45° BENDS(ROTATE AS REQUIRED)8" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 16"DI WATER MAIN8''W0MATCHLINE STA: 31+50.00E. LEHIGHDR.N10 20 40SCALE: 1" = 20'OPENCUT6C50116''WR/W32+00R/W4141NOTE:DATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'6060C585856565452504846(-) 0.600%FHASSEMBLY(-) 1.499%S-21318" PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINEEXISTING GRADEABOVE PROPOSED PIPE5452504846444224" PIPE18" PIPEFL 40.30S-213S-21518" PIPEE. LEHIGHDR.4442B40383634323028FL 39.90FL 39.00FL 40.30FL 39.00(4) 16" 45°BENDS24" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED 16"PVC WATER MAIN16" 11.25°BEND16" 11.25°BENDFL 37.2016" 11.25°BENDFL 37.60FL 34.00(2) 16" 45°BENDS16"X8"TEE12" MIN.(TYP)30" PIPE40383634323028CITY OF DELTONA26PROPOSED16" DI WM26A24222422Project No.:Designed By:Drawn By:200-08534-13001MBSPD2027+00 28+00 29+00 30+00 31+002018Checked By:MADC105Bar Measures 1 inch


1/9/2013 3:06:43 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.COVER12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 31+50 TO 36+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FOUND NDR/W R/W R/W31+00R/WR/WWV8''W8''W16''W41E. LEHIGHDR.8''WR/WWATERR/W16''W414132 + 00R/W R/W R/W406''W 6''W 6''W3916''W 16''WR/W R/W R/W3933 + 00R/WBENCHMARK IR #2N 1655767.23E 586032.23ELEV 36.793816''WR/WWATER37WATERWATERWATERWATERR/W R/W6''W363634 + 00353534R/W R/W R/W R/W6''W 6''WNORMANDY BLVD.16''W 16''WR/W R/W R/W33333335+00R/W R/W R/WR/W6''W16''W 16''WPRC: 35+46.80326''W16''W36+0033R/WR/W16''WWV6''W 6''W6" PVC WMNFEDSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 6" AC WM3' DEEPMATCHLINE STA: 31+50.00OPENCUTNOTE:6C501STA:31+81.68, 38.44'R16" 11.25° BENDPROPOSED 16"DI WATER MAIN2C502STA:32+87.57, 35.00'RFH ASSEMBLY1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAINPROPOSED 16"PVC WATER MAIN2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27STA:33+57.10, 34.95'R(2) 16" 45° BENDSPROPOSED LONGWATER SERVICE (TYP)2C504PROPOSED SHORTWATER SERVICE (TYP)2C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)CONTRACTOR TO RESTABLISHSLOPES AND RIPRAP TO ORIGINALCONDITIONS OR BETTERENDWALLW INV. 27.5053"x34" ERCPSTA:35+43.11, 31.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)ENDWALLE INV. 28.60MITERED END SECTIONW INV. 22.50INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.1030" PIPESTA:35+99.05, 38.08'R16" 22.5° BENDSEENOTE 118" PIPESTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDER0 10 20 40EXISTING 6" WMBACT. SAMPLESCALE: LOCATION 1" = 20'MATCHLINE STA: 36+00.001C50418" PIPEWVR/WSTA:36+11.35, 34.88'R16" 22.5° BENDDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'52525050C48CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)484644EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINE464442E. LEHIGHDR.S-217APROPOSED GRADEAT ROAD CENTERLINE4240S-21740(-) 1.499%(-) 3.552%(-) 3.552% (+) 3.350%B383634323028262422FL 33.90PROPOSED16" DI WM16" 11.25°BEND30" PIPEFL 32.0039.33PROPOSED16" PVC WM38.9438.4737.93FH ASSEMBLY18" PIPEFL 32.10FL 31.2037.31FL 29.5016" 45°BENDS30" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA30" PIPEFL 27.90S-21934" X 53" PIPEFL 24.20FL 28.0530" PIPE(2) 16" 45° BENDS(ROTATE AS REQUIRED)S-221S-220FL 28.2012" MIN.(TYP)30" PIPEFL 24.10 , S-220FL 24.00, S-221383634323028262422CITY OF DELTONA2018PROPOSED16" PVC WM30" PIPEINV. ±23.6016" 22.5°BEND2018A16161414121210109+00 32+00 33+00 34+00 35+00 36+00Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC106Bar Measures 1 inch


1/10/2013 10:38:20 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.6''WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 36+00 TO 40+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDPRC: 35+46.8016''WR/W R/W6''W 6''W32INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.10SEENOTE 16" PVC WMR/W R/W36+0016''W336''W 6''WFOUND ND35ECHO CT.FOUND IP 1SEE SHT. C109 FOR ECHO CT. WATER MAINSTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 6" WMBACT. SAMPLELOCATION30" PIPE1C504MATCHLINE STA: 36+00.0018" PIPE3418" PIPER/WWV16''W3434WV4''WWVPROPOSED 6"DI WATER MAINOPENCUT6C501FOUND ND LB1221R/WSTA:36+11.35, 34.88'R16" 22.5° BENDR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE6''WEXISTING 4" AC WM44" DEEP4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE3537+0016''WR/WR/WR/W3636INLET TYPE P-2TOP 34.75S INV. 30.406''W16''WR/WNOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 273738 + 0016''WR/WR/W38R/W39R/WNORMANDY BLVD.PROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W6''W4040R/WR/WPROPOSED LONGWATER SERVICE (TYP)39 + 0016''W2C502EXISTING SURVEYEDWATER MAIN2C50441R/W6''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY4C504WATER4216''WR/WSTA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYR/W44ARV4343R/W40 + 0016''WR/WMATCHLINE STA: 40+00.00R/W4PT: 40+41.4216''WR/WR/W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEUTILITYCROSSINGR/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDS0EXISTING 6" AC WM3-1/2' DEEPSEE NOTE 1N10 20 40SCALE: 1" = 20'7C50116''WMARYSVILLE DR.4241 + 00WATERDATE ______________STA:35+99.05, 38.08'R16" 22.5° BENDSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C605856546058565452CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)525048EXISTING GRADEABOVE PROPOSED PIPE50484644PROPOSED GRADE ATPIPE CENTERLINE4644BA424038363432302826242216" 22.5°BEND16" 22.5°BEND18" PIPECLAY CT.16"X6" TEE16" GATE VALVE6" GATE VALVES-22418" PIPEFL 30.40PROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(+) 3.350%EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA202036+00 37+00 38+00 39+00 40+001818FHASSEMBLYARV4240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC107Bar Measures 1 inch


1/9/2013 3:21:12 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANR/WPT: 40+41.423' MIN.16''WSEE *3' MIN.MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 40+00 TO 44+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEXISTING SURVEYEDWATER MAINR/WR/WR/WR/WMARYSVILLE DR.EXISTING 6" AC WM3-1/2' DEEP6''WWVR/W16''WR/WSTA:40+90.12, 47.09'LDIRECT CONNECT TO4EXISTING 6" WM6" 45° BENDC5026" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 6" PVCWATER MAIN1C50412C504PROPOSED 16"PVC WATER MAINWATERWATER28STA:42+98.38, 36.80'LCONNECT TOEXISTING 12" WM16"x12" REDUCER12" GATE VALVEBAC. SAMPLE LOCATIONR/W R/W R/W R/W WV R/W16''W 16''W 16''W4C5021C504PROPOSED SHORTWATER SERVICE (TYP)2C504FHR/WR/WWATER4''WMONTEREYDR.N0 10 20 40SCALE: 1" = 20'WATERED16''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY STA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYC50443MATCHLINE STA: 40+00.0040+0044ARV43R/W16''W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE16''WUTILITYCROSSINGSEE NOTE 1424141NORMANDY BLVD.OPENCUTWATERWATERR/W R/W R/W R/W R/W R/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDSSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)7C501NOTE:STA:41+00.56, 34.64'L16"x6" TEE(2) 16" 45° BENDS(ROTATE AS REQUIRED)6" CAPEXISTING SURVEYEDBEGIN/END GROUT FILLWATER MAINEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE41+00 42 + 00 43 + 00 44 +6C501PROPOSED 16"DI WATER MAINPROPOSED LONGWATER SERVICE (TYP)1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAIN2. DUCTILE IRON UNDER ROAD DOES NOT SHOW IN PROFILE FOR CLARITY3. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTOR'S RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 272C504R/WBENCHMARK 0084"x4" C.M.D. "CITY OF DELTONA BM-008"STA. 44+11.43, 38.05' RTEL 32.443 CHAIN CL NORMANDY BLVD.N 1,656,585.832, E 586,604.273R/W4''W 4''W 4''WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C60585654526058565452504846EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADEAT ROAD CENTERLINECONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)50484644PROPOSED GRADE ATPIPE CENTERLINE44BA4240383634323028262422(2) 16" 45°BENDSPROPOSED16" PVC WMEXIST6" WM(4) 16" 45°BENDSEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED16" PVC WM(-) 4.298%PROPOSED PROFILE OFWM PIPE AT NORTH-WESTSIDE OF NORMANDY BLVD.* DEPTH SUFFICIENT TO DEFLECT BELOW EXISTING WATER MAIN16"X12" REDUCER & 12"GATE VALVE. CONNECT TOEXISTING WATER MAIN LINE202040+00 41+00 42+00 43+00 44+0018184240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC108Bar Measures 1 inch


1/9/2013 3:33:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C109.DWG - LOPEZ, HERNANR/WR/WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PACO CT. & ECHO CT.WATER MAINwww.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7PT: 24+39.54FEDCBA0SCALE: 1" = 20'NOTE:2C504PROPOSED LONGWATER SERVICE (TYP)36R/W1C504R/W35FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655000.58E 585192.85WMFOUND ND LS2494WMWM3C502FOUND IP 11. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THECONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.0N10 20 40SCALE: 1" = 20'N10 20 40FOUND IRR/WR/WWMR/W34R/WR/W3535R/W6''W6''WFOUND IR 1/2 LS2564366''WPROPOSED SHORTWATER SERVICE (TYP)6" 11.25° BENDN 1654986.51E 585228.214''W 4''W 4''W 4''WR/WFOUND NDFOUND IRR/W2C50436FOUND ND6''W 6''W37PROPOSED LONGWATER SERVICE (TYP)R/W R/W6" 11.25° BENDN 1655992.24E 585755.89FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655954.48E 585741.693C502ECHO CT.38EXISTING 4" AC WM3-1/2' DEEPR/W374''WR/W R/W1C5046" 11.25° BENDN 1656018.88E 585773.632C504STA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM6" 22.5° BENDSTA:22+69.50, 40.95'LN 1654970.39ARV ASSEMBLYE 585315.63BACT. SAMPLE LOCATION4 1PROPOSED 6"C504 C504PVC WATER MAINFOUND IR 1/2 LB5383TEL6" DI WMMANHOLE P-7FOUND ND LB1221WVTOP 50.03SW INV. 42.204" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEARV ASSEMBLYFOUND IRCONTRACTOR TO LOCATE ARV ATACTUAL HIGH POINT OF WATER MAIN(WATER MAIN TO BE 4-FT DEEP AT ARV)N 1656092.97E 585897.50 4WMWATERC5046" 22.5° BENDN 1656095.10E 585890.01WM6" 22.5° BENDEXISTING 4" AC WMN 1656089.0944" DEEPE 585850.49WM WMFOUND IRREMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEINCLUDED IN PAY ITEM #5C501(WATERMAIN IMPROVEMENTS)PROPOSED 6"PROPOSED SHORT 2PVC WATER MAINWATER SERVICE (TYP)C504REMOVE AND REPLACEEXISTING DRIVEWAY TO BE 5INCLUDED IN PAY ITEM #5 C501(WATERMAIN IMPROVEMENTS)REMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEC501 INCLUDED IN PAY ITEM #5(WATERMAIN IMPROVEMENTS)NOTE:STA:36+44.00, 40.61'L1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THE1 (4) 6" 45° BENDSCONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.C504 TO DEFLECT UNDEREXISTING 8" WMBACT. SAMPLE LOCATION39R/WR/W40R/W4''W41414''W42R/WR/WR/W436''W38444''W4''WR/W4545R/WR/WARVR/W46466''W47R/WR/WPACO CT.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.4''W48496''W3722 + 0037ARV50R/W6''W5152544545R/W R/W23 + 00OPENCUT46WV47NORMANDY BLVD.16''W5316''WWATERWATER8''W 8''W 8''W 8''WR/W R/W R/W4''W 4''W 4''W386''W 6''W 6''W 6''WR/W R/W R/W363635FOUND NDR/W6C50124 + 00REMOVE AND REPLACEEXISTING DRIVEWAYR/W R/W R/W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEECHO CT.ECHO CT.6''W34FOUND IP 136 + 0049495016''W 16''WSTA:22+71.08, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE33R/W6''WWV3434OPENCUT16''WR/W R/W R/WR/WR/W35WVWVR/W6''W37 + 006C5016" DI WMFOUND ND LB122116''W18" PIPER/W3616''WR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE37R/W16''W38 + 00NORMANDY BLVD.INLET TYPE P-2TOP 34.75S INV. 30.4038CITY OF DELTONADATE ______________Project No.: 200-08534-13001Designed By:Drawn By:Checked By:C109Bar Measures 1 inch


12/13/2012 12:22:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C501.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FBACKFILLBd(SEE NOTE 1)BcANGLE TO MEET THEREQUIREMENTS OF THEFLORIDA TRENCH SAFETYACT.1/2" EXP JOINTFULL DEPTH OF WALKMAX 15'-0" SPACINGNOTES FOR REPLACEMENT URBAN FLARED TURNOUTS1. DRIVEWAY 6" CONCRETE PAVEMENT AND DROP CURB SHALL MEET THE MATERIAL ANDCONSTRUCTION REQUIREMENTS OF SECTIONS 522 AND 520 RESPECTIVELY OF THE FDOTSTANDARD SPECIFICATIONS. THE DRIVEWAY FOUNDATION SHALL MEET THE REQUIREMENT OFSUBARTICLE 522-4.SPRINGLINE OF PIPE12"COMMON FILLCOVER MATERIAL5'-0" MAX5'-0" MAX5'-0" MAX2. DRIVEWAYS AND DRIVEWAY APRONS SHALL BE 6" INCHES THICK, CLASS B CONCRETE, WITH6X6-10/10 WWM.EDNOTES:VERTICAL TRENCH WALLS(TYPICAL)PIPE BELLFOUNDATION,IF REQUIRED(SEE NOTE 2)SUBGRADEUNDERCUT TRENCHTYPICAL DETAIL-OPEN CUTNON-UNDERCUT TRENCHTRENCHING, PIPE BEDDING, BACKFILLING & COMPACTING1. DIMENSION Bc = PIPE O.D.DIMENSION Bd = TRENCH WIDTH AT TOP OF PIPEMAXIMUM Bd = Bc + 30"MINIMUM BdSUBGRADE= MAXIMUM DIMENSION OF BELL + 8" (UNSHEETED TRENCH)= MINIMUM DIMENSION OF BELL + 12" (SHEETED TRENCH){PIPE BEDDING & TRENCHING DETAIL}SELECT COMMON FILLHAUNCHING(Bc x 0.50)6" SELECT COMMONFILL BEDDING(SEE NOTE 8)2. REMOVE UNSUITABLE OR UNSTABLE MATERIAL, AS DETERMINED BY CITY OF DELTONA STAFF ORENGINEER, ENCOUNTERED BELOW THE TRENCH BOTTOM, AS REQUIRED TO PRODUCE A SUITABLEFOUNDATION OF BEDDING ROCK. FURNISH, PLACE AND COMPACT FOUNDATION AS SPECIFIED.3. FURNISH, PLACE AND COMPACT BEDDING, HAUNCHING, COVER MATERIAL AND BACKFILL AS SPECIFIED.4. PIPE BEDDING: SELECT COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PER AASHTO T-80.5. TRENCH BACKFILL (NON-ROADWAY): COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PERAASHTO T-180.6. USE OF SELECT COMMON FILL BEDDING TO BE DETERMINED IN FIELD BY CITY OF DELTONA STAFF ORENGINEER.7. REFER TO SPECIFICATIONS, SECTION 02221, AND CITY OF DELTONA FOR DESCRIPTION OF SELECTCOMMON FILL, COMMON FILL, AND BEDDING ROCK MATERIAL.8. WHEN UNSUITABLE MATERIAL IS ENCOUNTERED THE CONTRACTOR TO REMOVE, CARRY EXCAVATIONDEEPER AND REPLACE EXCAVATED MATERIAL WITH BEDDING ROCK TO AN ELEVATION EQUIVALENT TO6" BELOW PIPE BEDDING ELEVATION.3"1'-0"2"TOP SOILWWF SUPPORTSPLANAS SHOWN ON PLANS (TO MATCH EXISTING)4" (6" FOR 2"8'-0" WIDE WALKS)WELL TAMPED ORUNDISTURBEDEARTHNOTE: 2,500 PSI CONC (MIN)SECTIONSIDEWALK, CONCRETE3/16" X 1" TOOLEDOR CUT JOINTS3/4" RADIUSFIN GR6" X 6" X 6/6 WWF(2 LAYERS FOR8'-0" WALKS) WWFSHALL BE SUPPLIEDIN FLATS. ROLLSARE NOT ACCEPTABLE3. DRIVEWAY SHALL CONFORM WITH FDOT STANDARD INDEX NO. 515.4.1 2 " JOINTS SHALL BE CONSTRUCTED WITH PREFORMED JOINT FILLER MATERIAL.REFER TO FDOTINDEX NO. 310(WHEREAPPLICABLE)FLARE SHAPE TOMATCH EXISTINGPROPOSED PIPEVARIES4" CONC.SIDEWALK(WHEREAPPLICABLE)EXIST CONCDRIVEWAYMATCHEXISTMATCH EXIST CURB ANDGUTTER (REF FDOT INDEX NO300)MATCH EXIST EDGE OFASPHALT PAVEMENT5' - 6" CONC.SIDEWALK(WHEREAPPLICABLE)MATCH EXISTING WIDTH1 2 " JT (NOTE4)6%(MAX)2%(MAX)MATCH EXISTING WIDTHRELPACEMENT DRIVEWAY TURNOUT - FDOT INDEX 515REPLACEDRIVEWAYTO FIRSTCONST JTOR 5' WHICHEVER ISGREATERREPLACEDRIVEWAYTOASPHALTPAVEMENT6" CONC. DRIVEWAYAND SIDEWALK(WHEREAPPLICABLE)FIN GR3'-0"CONSTRUCT UNIFORM PIPE DEFLECTION - NOT TOEXCEED 75% OF MANUFACTURER RECOMMENDEDMAXIMUM DEFLECTION PER PIPE JOINTTYPICAL UTILITY±20'-0" CENTERON UTILITY±120'-0"VARIES20'O.D.12"ALLOWABLE JOINT DEFLECTIONFOR 16" PIPEDEFLECTION TYPE UTILITY CROSSING3'-0"PROPOSED UTILITY15"3°-35' (R 320)DATE ______________DETAIL 1SCALE: NTS-DETAIL 3SCALE: NTS-DETAIL 5SCALE: NTS-DETAIL 7SCALE: NTS-CBBENDSTANDARD FITTINGS/APPURTENANCESREQUIRED LENGTH OF RESTRAINED PIPE EACH WAY (FT)PIPE DIAMETER4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"11-1/4°22-1/2°45°90°1818182118181830181818361818184418182051181822601818266418182766181831751818368818194097182245109182450121182654132182859142DEAD END* 60 85 110 133 155 177 198 218 238 277 330 379 423 465 506*NOTE: IN-LINE VALVES AND TEES (BRANCH) SHALL BE RESTRAINED AS DEAD ENDS.DIAMETER4"6"8"10"12"14"16"18"20"24"30"36"42"48"REDUCERS - REQUIRED LENGTH OF RESTRAINED PIPE AT LARGE SIDE (FT)**4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"44 79 10846134 15981 113 141 16644 82 115 14445 84 11745 84**A MINIMUM OF 20 FEET OF PIPE SHALL BE RESTRAINED ON THE SMALL SIDE.1. THE ABOVE REQUIREMENTS WERE CALCULATED IN ACCORDANCE WITH "THRUSTRESTRAINT FOR DUCTILE IRON PIPE,"THIRD EDITION, 1992, PUBLISHEDBY DIPRA, WITH THE FOLLOWING ASSUMPTIONS:SOIL CONDITIONS: SAND/SILTLAYING CONDITION: 4MINIMUM COVER: 3 FTIF FIELD CONDITIONS DIFFER FROM THE ABOVE, CONTRACTOR SHALL NOTIFY ENGINEER.PIPE RESTRAINT, RESTRAINED JOINTPOLYETHYLENE WRAPPED DIP OR PVC PIPE, 150 PSI TEST PRESSURE17114711845 8419617514911844 8322620417915144 11983274254232207180115258 324207 281114345204 280 349110 201 2822. THE RESTRAINED JOINT LENGTHS CALCULATED ABOVE FOR BENDS WERE FOR BENDS INTHE HORIZONTAL DIRECTION OR VERTICAL UP DIRECTION. IF A BEND IS ORIENTED INTHE VERTICAL DOWN POSITION, THE RESTRAINED JOINT LENGTH CALCULATED ABOVE FORTHAT BEND SHALL BE MULTIPLIED BY 3.5.108 203112UNDISTURBEDEARTH5'NOTES:1'-6"RESTRAINEDLENGTHEXISTING WM MAINTHRUST COLLARSEE DETAILSTAINLESS STEEL TAPPING SLEEVE5'TAPPING VALVE& BOXLINE STOP & PLUGCAP OR PLUGEXISTING WM MAINTO BE ABANDONEDPROPOSED MAIN1. CONTRACTOR SHALL WRAP SLEEVE AND VALVE WITH POLYETHYLENEEXCAVATION DEPTHSHALL BE 1' BELOWBOTTOM OF MAIN2. FOR RESTRAINED LENGTHS, SEE THRUST COLLAR DETAIL 3, SHEET D-4.3D1043'MIN LIMITS OFEXCAVATIONWET TAP CONNECTION TO EXISTING MAIN - WATER OR RECLAIMED2'MINREPLACEMENT CONC W/6X6-6/6 WWF(MONOLITHIC POUR)EXISTINGCONCNOTES:1.2.3.4.5.6.4" MIN1'-6"2' MINTRENCH WALL(TYP)DUCTILE IRONUTILITY PIPE5' MIN3' MINCONCRETE RESTORATION8"MINASPHALT RESTORATION1 1/2" SURFACEREPLACEMENTEXISTINGBASEBASE COMPACTED TO98% MAX. DENSITYAASHTO T-180(2T OR 8 INCHES,WHICHEVER IS GREATER)(W = PIPE OD (ft) + 2')SUBGRADE COMPACTEDTO 98% MAX. DENSITYAASHTO T-180EXISTING SURFACE AND BASE CUTS SHALL BE MECHANICALLY SAWN.LONGITUDINAL CUTS REQUIRE OVERLAY/RESURFACING TO THE COMPLETE WIDTHOF THE ROAD.CUTS AT INTERSECTIONS REQUIRE COMPLETE OVERLAY/RESURFACING TO THEEND OF ALL RETURN RADII AND/OR 10 FT BEYOND CUT, WHICHEVER IS GREATER.CUTS THROUGH TURNOUTS AND CUL-DE-SACS REQUIRE COMPLETE OVERLAY/RESURFACING.ALL UTILITY PIPE INSTALLED UNDERNEATH ASPHALT OR CONCRETE ROADWAY SHALLBE DUCTILE IRON.2T(W)W/2 + 2'TRENCH WIDTHT1'-6"SURFACE JOINTEXISTING ASPHALTCONTRACTOR SHALL FILL OPEN CUT TO ALLOW TRAFFIC TO PASS FREELY ANDSAFELY PROMPTLY AFTER INSTALLATION. IF PERMANENT RESTORATION IS TO BEDEFERRED, THE CONTRACTOR SHALL MAINTAIN THE TEMPORARY CONDITION TO THERESIDENT INSPECTOR'S SATISFACTION.TRENCHING DETAIL - ROADWAY OPEN CUTEXISTINGWM OR FMTO REMAININ SERVICETHRUST COLLARSEE DETAIL 3SHEET C504EXISTING DRAINAGE STRUCTUREOR OTHER OBSTRUCTIONNEW WMOR FMTHRUST COLLARSEE DETAIL 3SHEET C504±20' CENTEREDON UTILITYEXISTING WM OR FMTO BE REMOVED12"MIN.EXISTING BURIEDUTILITY TO REMAINVERTICAL TRANSITION AT OBSTRUCTION±20' CENTEREDON UTILITY3' MIN.45° RJ BEND45° RJBENDNEW WM OR FMNEW WMOR FMHORIZONTAL TRANSITION AT OBSTRUCTIONUTILITY CONFLICTFINISHED GRADENEW WM OR FMEXISTINGWM OR FMTO REMAININ SERVICERESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)RESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)CITY OF DELTONAADETAIL 2SCALE: NTS-DETAIL 4SCALE: NTS-DETAIL 6SCALE: NTS-DETAIL 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC501Bar Measures 1 inch


12/6/2012 1:43:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C502.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FEARLY WARNING TAPE WITH METALLICDETECTOR STRIP AND/OR WIRE6" MIN.12" MAX.FINISHED GRADEGROUND LEVELMETER BOXMETALLIC OR VINYL CONTINUOUS IDENTIFICATION/WARNING TAPEWIRE TO BE PLACED INSIDE PIPE WITH A MIN. OF 12"OF EXCESS WIRE - COILED (TYP.)DOUBLE METER BOX(18" x 24" MIN.)FINISHED GRADE2" GATE VALVE W/2-INCH SQUARE NUT DRIVE2" QUICK DISCONNECTEDNOTES:6" MIN.12" MAX.FINISHEDGRADEPVC WATER MAINOR FORCE MAINEARLYWARNINGTAPETRACING WIRE10 GAUGEBRAIDED SOLIDCOPPER1. ALL MAINS INSTALLED BY OPEN CUT SHALL HAVE A "EARLY WARNING" PROTECTION TAPE AND/OR WIRE INSTALLEDCONTINUOUSLY ALONG THE ALIGNMENT. THE PROTECTION TAPE SHALL BE TERRA-TAPE OR EQUAL. TAPE SHALL BE INSTALLEDDURING BACKFILLING 6"-12" BELOW FINISHED GRADE DIRECTLY OVER THE PIPE AND SHALL BE CONTINUOUSLY MARKED FOR THETYPE OF PIPE (EXAMPLE: "CAUTION, WATER MAIN BURIED BELOW"). THE TAPE SHALL HAVE A METALLIC DETECTABLE STRIPINCLUDED AND COLOR CODED AS FOLLOWS:BLUE - POTABLE WATERGREEN - SANITARY FORCE MAINPURPLE - EFFLUENT REUSERED - DEDICATED FIRE LINE2. ALL PVC MAINS SHALL BE A SOLID COLOR OR WRAPPED WITH COLOR CODED BAGS. ALL LETTERING SHALL APPEAR ON THREE(3) SIDES OF THE PIPE AND SHALL RUN THE ENTIRE LENGTH OF THE PIPE AND SHALL BE A MINIMUM OF 3/4 INCH IN HEIGHT WITHTHE APPROPRIATE WORDING APPEARING ONE OR MORE TIMES EVERY 21 INCHES ALONG THE LENGTH OF PIPE. THE LETTERINGMUST BE PERMANENTLY STENCILED TO THE PIPE SURFACE. LETTERING SHALL READ AS IS ACCEPTABLE FOR THE INTENDEDUSE. ALL LETTERING SHALL BE APPLIED BY THE PIPE MANUFACTURER DURING PRODUCTION.3. ALL DUCTILE IRON MAINS SHALL BE WRAPPED WITH COLOR CODED BAGS.4. ALL PVC POTABLE WATER PIPE SHALL BEAR THE NATIONAL SANITATION FOUNDATION (NSF) SEAL OF APPROVAL.6"-12"6"TYPICAL UTILITY PIPE1/2" PVC PIPE (TYP.)VALVE BOXDEAD ENDALL PVC PIPE, OR OTHER APPROVED NONMETALLIC PIPE INSTALLED WITHIN DELTONAWATER'S WATER, SANITARY SEWER, OR REUSE WATER SYSTEMS, SHALL BE INSTALLEDWITH 10 GAUGE SOLID COPPER TRACING WIRE.THE TRACING WIRE MUST BE INSTALLED DIRECTLY BELOW THE PIPE AND BROUGHT TO THESURFACE AT 500' MINIMUM INTERVALS. WIRE SHALL EXTEND A MINIMUM OF 12" ABOVEGRADE AT EACH INTERVAL AND BE COILED AND PLACED IN A VALVE BOX, METER BOX,MANHOLE, CLEANOUT OR OTHER APPLICABLE STRUCTURE.TRACING WIRE BETWEEN INTERVALS SHALL BE INSTALLED SO AS TO PROVIDECONTINUOUS CURRENT WHEN LINE LOCATION EQUIPMENT IS CONNECTED TO THETRACING WIRE. WIRE BRANCHING FROM MAIN LINES SHALL BE LINKED BY A DELTONAWATER APPROVED CONNECTOR SUCH AS KING # 2011 SAFETY SEALED CONNECTORS ORAPPROVED EQUAL.COLOR CODING:POTABLE WATER SYSTEM: BLUEREUSE WATER SYSTEM: LAVENDERSANITARY SEWER FORCE AND LOW PRESSURE SEWER SYSTEMS: GREENUTILITY PIPE LOCATION MATERIALSDETAIL 1SCALE: NTS-GENERAL NOTES:1. FOR LOW PRESSURE SEWER, POTABLE WATER AND REUSE WATER SYSTEMS: WIRE SHALL BEINSTALLED BELOW ALL MAINS AND SERVICE LINES AND ATTACHED TO VALVES, HYDRANTS ANDFITTINGS. WIRE INSTALLED WITH SERVICE LINES SHALL CONNECT TO THE WIRE INSTALLED BELOWTHE MAIN AND EXTEND TO THE CURB STOP.2. FIRE SPRINKLER LINES: WIRE SHALL CONNECT TO THE WIRE INSTALLED BELOW THE MAIN ANDEXTEND TO THE RISER CONNECTION.3. SANITARY SEWER FORCE MAINS: WIRE SHALL BE INSTALLED BELOW THE FORCE MAIN ANDATTACHED TO ALL VALVES AND FITTINGS AND BROUGHT TO THE SURFACE AND PLACED IN A METAL,DELTONA WATER APPROVED, VALVE BOX.4. DEAD END MAINS: WIRE SHALL BE PLACED IN A PROPERLY IDENTIFIED METAL VALVE BOX AT THEEND OF THE RUN.5. WIRE SHALL NOT BE FASTENED OR COILED TO VALVE OPERATING NUT.6. UTILIZE SPLIT BOLTS TO JOIN WIRE SEGMENTS.2" 90° BENDWATER MAINTAPPED CAPNOTES:1. ALL 2" PIPE AND FITTINGS SHALL BE BRASS WITHTHREADED (NPT) JOINTS.2. TAPPED CAP SHALL BE RESTRAINED AS PER THERESTRAINED JOINT DETAIL (DEAD END).BLOWOFF VALVE DETAILDETAIL 3SCALE: NTS-2"6"6" BEDDING ROCKDATE ______________ANCHOR TEEAS REQUIREDCB6"-90° BENDANCHOR TEE6" RESILIENT SEAT GATEVALVEINSTALLATION PARALLEL TO MAIN6" RESILIENT SEATGATE VALVEFIRE HYDRANTFIRE HYDRANTMAIN LINE2'-0" SQ. x 4" MIN. COLLAR W/ 1#3 CONT. REINF.SET TOP 2"ABOVE FINISHGRADE INUNPAVED AREAADJUSTABLE TYPE C.I.VALVE BOXLENGTH VARIES, NO BENDS PREFERRED4 1/2" PUMPERNOZZLE (FACINGSTREET)2- 2 1/2" HOSENOZZLE6" RESILIENT SEAT GATEVALVECONCRETE REACTION BLOCKING3"CLEAR1'-6" MIN.2'-0" MAX.8 CU. FT. OF GRAVELOR CRUSHED STONEFOR DRAINAGE SUMPPROVIDE CONC.1.0 CU. FT.NOTES:ASPHALTSURFACESCREW ORSLIDE TYPEVALVE BOXPROVIDEEXTENSIONAS REQ'D.TYPE 1VALVECAST IRON STAY-PUT COVERW/RAISED LETTERS MARKED"WATER" OR "SEWER"WIRE TO BE PLACED INSIDE PIPEWITH A MIN. OF 12" OF EXCESSWIRE - COILED W/PVC INVERTEDTHREADED CAP (TYP.)12"(MAX.)1" SCHED 40PVC PIPE(TYP.)CONCRETERIBBON FORBOX SUPPORT(TYPICAL)TYPE 236" (MIN.)COVERTRACING WIRE12 THHN SOLIDCOPPER4" x 4" x 12" LG. PRECAST CONC. POSTW/3" Ø BRONZE DISC, AS SHOWN ONCONC. COLLAR DET.1. GATE VALVES SHALL BE DUCTILE IRON RESILIENT SEAT TYPE, RATED AT 200 P.S.I. AND SHALL COMPLY WITHANSI/AWWA C509.2. CONCRETE COLLAR AND VALVE COVER SHALL BE PAINTED FEDERAL SAFETY BLUE FOR POTABLE WATER.TYPE 1 (PAVED AREAS)SOIL CEMENT,LIMEROCK ORASPHALT BASESIZE OF VALVETYPE OF VALVESERVICEDIRECTION &NO. OF TURNSTO OPENFINISHEDGRADE# 3 CONT.1" SCHED 40 PVC PIPEFOR TRACER WIRE(TYP.)12"12"WATER12"G.V.WATERR-2024" SQ.4"4"4"4"2"3" Ø BRONZE DISCANCHORED TO CONC.PAD24" x 24" x 4" THICK CONC. PADAT EACH VALVE BOX W/1-#3CONT. REINF.1/8" LETTERS TO BE CAST W/ 3" ØBRONZE DISC AS MFD. BYSHELDON BRONZE CO.ANCHOR RECESSEDBRONZE INDENT. DISC.SEE DETAIL ABOVE2" (MIN.)CITY OF DELTONAAINSTALLATIONPERPENDICULAR TO MAINFIRE HYDRANT ASSEMBLY INSTALLATIONDETAIL 2SCALE: NTS-TOTAL ASSEMBLY TO BE RESTRAINEDFROM MAIN LINE TO FIRE HYDRANTNOTES:1. A TAPPING SLEEVE WITH VALVE AND BOX SHALL BEINSTALLED WHEN CONNECTING A PROPOSED FIREHYDRANT TO AN EXISTING MAIN, OR RELOCATING ANEXISTING FIRE HYDRANT.2. HYDRANTS SHALL HAVE BREAKAWAYSECTION OR REMOVABLE BARREL.GATE VALVE AND BOX DETAILDETAIL 4SCALE: NTS-TYPE 2 (NON-PAVED AREAS)Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC502Bar Measures 1 inch


12/6/2012 1:44:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C503.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FCARRIER PIPE MAIN6"6" 10'-0"10'-0"E6" 6"# 4 BARS (TYP)FULL ENCASEMENT3" MINSAND CUSHIONSANITARY SEWEROR WATER MAINDATE ______________NOTE: USE ENCASEMENT WHERE VERTICAL CLEARANCE BETWEEN WATER MAIN ANDSEWER IS LESS THAN 18". DUCTILE IRON PIPE MAY BE USED IN LIEU OF CONCRETEENCASEMENT AT SEWER LINE CROSSING WITH A LENGTH OF PIPE CENTERED AT THEPOINT OF CROSSING, SO AS TO LOCATE JOINTS AT A MAXIMUM DISTANCE FROMTHE SEWER LINE.DTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, URBANDAY OR NIGHT OPERATIONSDETAILS 1SCALE: NTS-UTILITY CROSSING - CONCRETE ENCASEMENTDETAILS 4SCALE: NTS-CPost (Options: 2" x 4"or 2 1/2" Min. Dia. Wood;Steel 1.33 Lbs/Ft. Min.)3' Or More12" Min.15"to18"8"6' Max.Optional Post PositionsFilter Fabric (InConformance WithSec. 985 FDOT Spec.)Vertical20`Principle Post Position(Canted 20 Toward Flow)Filter FabricSilt FlowSECTIONELEVATIONNote: Silt Fence to be paid for under the contract unit price for Staked Silt Fence (LF).TYPE III SILT FENCESilt FlowNote: Spacing for Type III Fence to be in accordance withFDOT Design Index No. 102, Chart I, Sheet 1 of 3 andditch installations at drainage structures Sheet 2 of 3.Type III Silt FenceBTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, RURALDAY OR NIGHT OPERATIONSSilt FlowType III Silt FenceType III Silt Fence ProtectionAround Ditch Bottom Inlets.Do not deploy in a manner that silt fences will act as a dam across permanent flowingwatercourses. Silt fences are to be used at upland locations and turbidity barriersused at permanent bodies of water.SILT FENCE APPLICATIONSEROSION CONTROL - SILT FENCECITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 3SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC503Bar Measures 1 inch


12/13/2012 11:49:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C504.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FGATE VALVE2" RPZ BACKFLOW PREVENTER(FEBCO 806YD OR EQUAL)#4 AT 8" EACH FACEEACH WAYDIAGONALS: LENGTHPIPE OD +12"THREADED NIPPLE (TYP)PRESSURE GAUGEWITH VALVE (TYP)GATE VALVE90° BEND(TYP)EDAWWA TYPECC THREADSSERVICESADDLE1.2.3.4.NOTES:30 - 45 DEG.WATER MAIN AND RAW WATER MAINALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.ALL SERVICE SADDLES SHALL BE SMITH-BLAIR SUITABLE FORUSE WITH HDPE OR DIP PIPE, AS REQUIRED OR EQUAL.EACH TEST SERVICE SHALL TERMINATE ABOVE GRADE WITH A CURBSTOP AND SMOOTH NOSED SAMPLING TAP.EACH TEST SERVICE SHALL BE PROPERLY SAFE GUARDED AGAINSTVANDALISM DURING TESTING. THE CONTRACTOR WILL BE REQUIRED TOREMOVE TEST SERVICE FOLLOWING SUCCESSFUL BACTERIOLOGICALTESTING.BACTERIOLOGICAL TEST CONNECTIONSCORPORATION STOP& FITTING(NORMALLY OPEN)DOUBLE METER BOXASSEMBLY3/4" POLYETHYLENESERVICE LINE18"4" x 4" x 1/2" STEELBEARING PLATE(TYP.)#4 BARSUNDISTURBEDEARTHMIN.ENCASE TIE RODS IN1-1/2" PVC SLEEVEREINFORCEMENT DETAIL18"BBNOTES:1. ADDITIONAL REINFORCEMENTS SHALLBE AS SPECIFIED BY THE ENGINEER.2. MINIMUM COMPRESSIVE STRENGTH FORCONCRETE SHALL BE 3000 PSI.3. BEDDING, BACKFILL, AND COMPACTIONSHALL BE AS SPECIFIED ELSEWHERE INTHE STANDARD DRAWINGS.4. ALL FORM BOARDS SHALL BE REMOVEDPRIOR TO BACKFILL.5. NO ALLOWANCE SHALL BE MADE FORFRICTION BETWEEN THE PIPE WALL ANDTHE THRUST COLLAR.6. DESIGN PRESSURE:______ 150 P.S.I.*TRENCHLIMITSC3" COVER#4 BARS ALL AROUND(MIN. 2" CLEARANCEAROUND PIPE.)9" MIN. (TYP.)TIE RODS INCLUDINGNUTS AND WASHERS(SEE SCHEDULE BELOW)MECHANICALJOINTSSEE TRENCH DETAILSFOR PIPE BEDDINGREQUIREMENTSSCHEDULE OF DIMENSIONS AND MATERIALSPIPE DIMENSIONS (FT.) TIE RODS REQ'DSIZE(INCHES) A B C D DIA. NO.4 2.0 2.0 1.0 3/4 26810121620242.02.53.55.06.08.09.02.02.53.03.04.05.06.01.01.01.01.01.51.51.53/43/43/43/43/43/43/42222468NOTE: THRUST COLLAR AREAS TO BE COMPUTEDON BASIS OF 2000 LBS. PER SQ. FT. SOILRESTRAINT BEARING.THRUST COLLAR DETAIL FOR WATER MAIN (150 psi)ARESTRAINED LENGTH DD=3XB OR MIN. 10'-0"NOTES:1.2. THIS DETAIL IS TO BE USED FOR FILLING ANY NEWWATER MAIN AND FOR FLUSHING OF NEWMAINS UP TO 8" DIAMETER (2.5 FPS MINIMUMVELOCITY), AND FOR BACTERIOLOGICAL SAMPLINGPOINTS AT THE ENDS OF THE PROPOSED MAINS.THE JUMPER CONNECTIONS SHALL BE MAINTAINEDUNTIL AFTER FILLING, FLUSHING, TESTING,AND DISINFECTION OF THE PROPOSED MAIN HAS BEENSUCCESSFULLY COMPLETED AND CLEARANCE FOR USEFROM THE FDEP HAS BEEN RECEIVED. THIS JUMPERCONNECTION SHALL ALSO BE USED TO MAINTAIN AMINIMUM PRESSURE OF 20 PSI IN THE PROPOSEDMAINS AFTER DISINFECTION AND UNTIL THE FDEPCLEARANCE LETTER IS OBTAINED.3.B.2" SCHED 80 PVCFINISHED GRADE2" CORPORATION STOPA TEMPORARY JUMPER CONNECTION IS REQUIRED ATALL CONNECTIONS BETWEEN EXISTING ACTIVE WATERMAINS AND PROPOSED WATER MAIN IMPROVEMENTS.FLUSHING OF THE 10" DIAMETER AND LARGER WATERMAIN MAY BE DONE THROUGH THE TIE-IN VALVEUNDER VERY CONTROLLED CONDITIONS, AS FOLLOWS:A. THE TIE-IN VALVES SHALL BE OPERATED ANDPRESSURE TESTED IN THE PRESENCE OF THE UTILITYCOMPANY AND ENGINEER TO VERIFY WATER TIGHTNESSPRIOR TO TIE-IN. VALVES WHICH ARE NOT WATERTIGHTSHALL BE REPLACED.THE TEMPORARY JUMPER CONNECTION SHALL BECONSTRUCTED AS DETAILED. THE JUMPER CONNECTIONSHALL BE USED TO FILL THE NEW MAIN AND FORBACTERIOLOGICAL SAMPLING OF THE NEW MAIN ASREQUIRED BY THE FDEP PERMIT.- FLUSHING SHALL NOT BE ATTEMPTED DURING PEAKDEMAND HOURS OF THE EXISTING WATER MAINS.- ALL DOWNSTREAM VALVES IN THE NEW SYSTEMMUST BE OPEN PRIOR TO OPENING THE TIE-IN VALVE.UNION(2 REQD)TEMPORARY JUMPER CONNECTION12" MIN16" MAXEXISTING MAIN AND TIE-IN VALVE(OR TAPPING SLEEVE AND VALVE)4.5.6.7.8.SAMPLINGTAPSERVICE SADDLE WITH2" CORPORATION STOPNEW WATER LINE- MONITOR THE PRESSURE AT THE TIE-IN POINT.THE PRESSURE IN THE EXISTING MAIN MUST NOTDROP BELOW 35 PSI.- TIE-IN VALVE SHALL BE OPENED A FEW TURNS ONLYENSURING A PRESSURE DROP ACROSS THE VALVE ISALWAYS GREATER THAN 10 PSI.C. THE TIE-IN VALVE SHALL BE LOCKED CLOSED BYTHE UTILITY UNTIL FLUSHING BEGINS.D. THE TIE-IN VALVE SHALL BE OPENED ONLY FORFLUSHING OF THE NEW MAIN. THE PROCEDURE SHALL BEDIRECTED BY THE UTILITY AND OBSERVED BY THEENGINEER.E.AFTER FLUSHING, THE TIE-IN VALVE SHALL BE CLOSEDAND LOCKED IN THE CLOSED POSITION BY THE UTILITY.THE CONTRACTOR SHALL PROVIDE DOCUMENTATIONDEMONSTRATING THAT THE DOUBLE CHECK VALVE BACKFLOWPREVENTION DEVICE HAS BEEN TESTED AND IS IN GOODWORKING ORDER AT THE TIME OF INSTALLATION.EXCEPT AS REQUIRED TO FLUSH LINES GREATER THAN8" IN DIAMETER, THE TIE-IN VALVE SHALL REMAIN LOCKEDCLOSED UNTIL THE NEW SYSTEM HAS BEEN CLEAREDFOR USE BY FDEP AND ALL OTHER PERTINENT AGENCIES.UPON RECEIPT OF CLEARANCE FOR USE FROM FDEP,THE CONTRACTOR SHALL REMOVE THE TEMPORARY JUMPERCONNECTION. STOPS ARE TO BE CLOSED AND PLUGGEDWITH 2" BRASS PLUGS.ALL INSTALLATION AND MAINTENANCE OF THE TEMPORARYJUMPER CONNECTION AND ASSOCIATED BACKFLOWPREVENTION DEVICE, FITTINGS, VALVE, ETC. SHALL BE THERESPONSIBILITY OF THE CONTRACTOR.$400 REFUNDABLE DEPOSIT FOR TEMPORARY JUMPER METER.CONTRACTOR SHALL PAY FOR WATER AT RATES PROVIDED BYTHE CITY AT PROJECT INITIATION.NOT USEDDATE ______________DETAILS 1SCALE: NTS-DETAILS 3SCALE: NTS-DETAILS 5SCALE: NTS-DETAILS 7SCALE: NTS-CBWATER MAIN1-1/4 SCH. 40 PVCENCASEMENTCORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)SINGLE METER BOXAND WATER METERSINGLE SERVICEAWWA TYPECC THREADSSADDLECURB STOP(SEE NOTE 3)ADD 1-1/2" SCH 40PVC CASINGWATER MAINMARK WITHWOOD PAINTEDBLUE & WITHLOT NUMBERS1-1/4 SCH. 40 PVCENCASEMENTWATER SERVICE CONNECTIONS1-1/4 SCH. 40 PVCENCASEMENTNOTES:1. ALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.2. NO SERVICE LINE SHALL TERMINATE UNDER A DRIVEWAY.3. EACH SERVICE SHALL TERMINATE AT A CURB STOP(S) WHICHSHALL BE BURIED APPROXIMATELY 3" BELOW FINAL GRADE ANDSHALL BE CLEARLY MARKED WITH A 2" X 2" X 18" STAKE WITHTHE TOP PAINTED BLUE AND MARKED WITH THE NUMBER OF THELOT(S) TO BE SERVED.4. EXISTING WELLS SHALL BE PHYSICALLY SEPERATED FROM THE EXISTINGPIPING AND A BACKFLOW PREVENTER SHALL BE INSTALLED AT THE METER.5. SERVICE TUBING SHALL BE BLUE POLYETHYLENE ENDOPURE OR APPROVED EQUAL.WATER MAINCORPORATION STOP& FITTING(NORMALLY OPEN)30 - 45 DEG.CORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)DOUBLE METER BOXAND WATER METERDOUBLE SERVICETO METER BOXASSEMBLYBLUEPOLYETHYLENETUBINGU-BRANCHFITTING(1" x 3/4"x 3/4")CURB STOP2 EA.PREMOLDEDPLASTICJOINT FILLER5" WALLS(MIN)2" TEE2" POLY PIPE1.2.3.4.CAST IRON FRAME ANDCOVER, WITH ACCESS LID(SEE NOTE 3)NOTES:4'X4' PRECASTCONCRETE VAULT36" SQ.17 1/4"ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE. ASSPECIFIED IN SPECIFICATION 15050. CHANGE PIPE AND FITTINGSACCORDINGLY. FOR OTHER VALVE SIZES AND TYPES. VALVE SIZESTO BE DETERMINED BY THE ENGINEER AND APPROVED BY THE CITYPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM TOP OF PIPE TO FINISHEDGRADE SHALL BE 4.0 FEET.LID TO BE LETTERED WITH THE APPROPRIATE WORD "WATER".8"EXTEND GSP BLOW-OFF TO 1'-3" ABOVE GRADE, SCREEN END W/ STSTEEL SCREEN.STAINLESS STEELSCREENGROUTAIR RELEASE VALVE - WATERSLOPE 1" PER 1'2" AIR RELEASEVALVE W/ONEWAY AIR VALVE1" CURB STOP2"X1" REDUCER& 1" SHORT NIPPLE2" GATE VALVEBRONZE DOUBLE STRAPSADDLE6"16"Ø WATERPLUSPOLYETHYLENE(BLUE)POLY PIPE8"x16" REINFORCED CONCRETE FOOTING6"4"Ø HOLE, GROUTAFTER INSTALLATION20"x20"x6" P.C.C. PAD,CLASS "C"ARV ENCLOSURE(BLUE FOR WATER)STAINLESSSTEELSCREEN36"x36"x6"P.C.C. PAD,CLASS "C"4"Ø HOLE,GROUT AFTERINSTALLATION6" MIN.#57 BEDDING ROCKPREMOLDEDPLASTICJOINT FILLER4" MAX.SLOPE 1" PER 1'5" WALL (MIN.)2" TEE2" THREADEDGALV. STEEL PIPE2" SQUARE NUTRESILIENT SEATGATE VALVEo2" 90 BENDFITTINGS ANDPIPE FORA.R.V. SHALLBE BRASS6" BEDDING ROCK1.2.3.4' x 4' PRECASTCONCRETE VAULT36" DIA.17-1/4"8"WATER MAINSERVICE SADDLEPER SPECIFICATIONSECTION 50.5.4NOTES:ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE.CHANGE PIPE AND FITTINGS ACCORDINGLYFOR OTHER VALVE SIZES AND TYPES. VALVE SIZES TO BEDETERMINED BY THE ENGINEER AND APPROVED BY DELTONA WATERPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM ELBOW INVERT TO FINISHEDGRADE SHALL BE 4.0 FEET.VALVE BOX SHALL BE IN COMPLIANCE WITH FIGURE 2-031.OFFSET AIR RELEASE VALVE - WATERCAST IRON FRAMEAND COVER WITHACCESS LID.GROUTFINISHED GRADE2" AIR RELEASEVALVE W/ONE WAYAIR VALVE1" CURB STOP2"X1" REDUCER &1" SHORT NIPPLESEE NOTE 3GROUT (TYP.)2" UNION2" BRASS PIPE2" SQUARE NUTRESILIENT SEATGATE VALVE8" x 16" REINFORCEDCONCRETE FOOTING.EXISTING /PROPOSEDPAVEMENTCAST IRONVALVE BOXTOP SECTIONEXTENSIONROD ASREQUIREDo2" 90 BEND2" NIPPLENOT USEDCITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 4SCALE: NTS-DETAILS 6SCALE: NTS-DETAILS 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC504Bar Measures 1 inch


NORMANDY BLVDPROVIDENCE BLVD.CITY OF DELTONAWATER MAIN IMPROVEMENTSNORMANDY BOULEVARD PART BSAXON BLVD201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955FAX: (407) 839-3790www.tetratech.comPROJECT LOCATION:DELTONA, FLORIDACLIENT INFORMATION:CITY OF DELTONA255 ENTERPRISE ROADDELTONA, FLORIDA 32725I-4Tt PROJECT No.:200-08534-13001CLIENT PROJECT No.:PROJECT DESCRIPTION / NOTES:DELTONA BLVDWATER MAIN REPLACEMENT ALONG:NORMANDY BOULEVARD, STARTS 400 FT SOUTHWEST OF SAXONBLVD AND ENDS 400 FEET SOUTHWEST OF FORT SMITH BOULEVARDISSUED:BID SETFT SMITH BLVDPROJECTLOCATIONVICINITY MAP:SAXON BLVDNORMANDY BLVDPROJECT LOCATIONFOR CITY OF DELTONAMAYORJOHN C. MASIARCZYK, SR.VICE MAYORZENAIDA DENIZACDISTRICT 1CITY MANAGERFAITH G. MILLERCOMMISSIONERSWEBSTER BARNABYDISTRICT 2HEIDI HERZBERGDISTRICT 3NANCY SCHLEICHERDISTRICT 4FRED LOWRYDISTRICT 5CHRIS NABICHTDISTRICT 6Michael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________DATE ______________


1/9/2013 9:24:05 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\G002 GENERAL NOTES.DWG - LOPEZ, HERNANNORMANDY BOULEVARDGENERAL NOTESAND DRAWING INDEXMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7GENERAL NOTESDRAWING INDEXFED1. ALL PIPING SHALL HAVE 3'-0" MINIMUM COVER.2. ALL EXISTING PAVING, STABILIZED EARTH, DRIVEWAYS, CURBS, SIDEWALKS, FENCES,GRASSED AREAS, LANDSCAPING, CULVERTS, FRENCH DRAINS, ETC. DISTURBED BYTHE CONTRACTOR'S OPERATIONS SHALL BE RESTORED TO EQUAL OR BETTERCONDITION. RESTORATION OF GRASSED AREAS SHALL BE DONE BY SODDING.SEED-AND-MULCH IS NOT ACCEPTABLE.3. FITTINGS MAY BE USED FOR PIPE ALIGNMENT CHANGES RATHER THAN DEFLECTINGAT THE CONTRACTOR'S OPTION AND WITH NO ADDITIONAL COMPENSATION.4. THE CONTRACTOR SHALL NOT PLACE ANY FILL MATERIAL WITHIN WETTED DITCH ORWETLAND AREAS. SILTATION FENCES SHALL BE INSTALLED BY THE CONTRACTORBETWEEN WORK AND SUCH AREAS. SEE SHEET C503 DETAIL 3.5. PRIOR TO BID PREPARATION, THE CONTRACTOR MUST FAMILIARIZE HIMSELF WITHTHE OVERALL SITE CONDITIONS AND PERFORM ADDITIONAL INVESTIGATIONS ASDETERMINED NECESSARY TO UNDERSTAND THE LIMIT AND DEPTH OF EXPECTEDORGANIC SILT PEAT AREAS, ADEQUACY OF EXISTING MATERIALS TO USE AS FILL,DEWATERING REQUIREMENTS, CLEAN FILL REQUIRED FROM OFFSITE, ANDMATERIALS TO BE DISPOSED OF OFFSITE, ALL OF WHICH WILL AFFECT HIS PRICING.ANY DELAY, INCONVENIENCE, OR EXPENSE CAUSED TO THE CONTRACTOR DUE TOINADEQUATE INVESTIGATION OF EXISTING CONDITIONS SHALL BE INCIDENTAL TOTHE CONTRACT, AND NO EXTRA COMPENSATION WILL BE ALLOWED. THEMATERIALS ANTICIPATED TO BE ENCOUNTERED DURING CONSTRUCTION MAYREQUIRE DRYING PRIOR TO USE AS BACKFILL, AND THE CONTRACTOR MAY HAVE TOBRING IN MATERIALS, AT NO EXTRA COST, FROM OFFSITE TO MEET THEREQUIREMENTS FOR COMPACTION AND PROPER FILL.6. ALL CULVERTS AND EXISTING FACILITIES DAMAGED BY THE CONTRACTOR'SOPERATIONS SHALL BE REPLACED WITH MATERIAL TO MATCH EXISTING.7. ALL DRAINAGE AREAS THAT ARE CROSSED BY PIPELINES SHALL BE LEFT OPEN ATALL TIMES EXCEPT FOR SHORT PERIODS AS MAY BE NECESSARY DURING ACTUALCONSTRUCTION HOURS.8. THE CONTRACTOR SHALL OBTAIN THE SERVICES OF A REGISTERED FLORIDAPROFESSIONAL LAND SURVEYOR FOR LAYOUT OF ALL WORK, FOR RESTORING ALLMONUMENTS AND PROPERTY CORNERS DISTURBED DURING CONSTRUCTION ANDFOR PREPARATION OF PROJECT AS-BUILT DRAWINGS AND FOR PREPARATION OFPROJECT AS-BUILT DRAWINGS. PROOF OF REGISTRATION SHALL BE SUBMITTED TOENGINEER.9. THE COORDINATES AND ELEVATIONS SHOWN HEREIN ARE BASED ON INFORMATIONPROVIDED BY BOYER SINGLETON & ASSOCIATES LOCATED IN THE DRAWINGS SETNAMED "NORMANDY BLVD. SAXON BLVD. TO FORT SMITH BLVD." BID PLANS DATEDDECEMBER 2012. BENCH MARKS ARE SHOWN ON SHEETS C-102, C-106 AND C-108.10. THE CONTRACTOR SHALL LOCATE ALL PIPELINES AT PROPOSED TIE-IN LOCATIONSTO VERIFY ACTUAL LOCATION, SIZE, ELEVATION, AND MATERIAL PRIOR TO ORDERINGNEW MATERIALS.DETERMINED NECESSARY FOR CONSTRUCTION. CONTRACTOR IS SOLEYRESPONSIBLE FOR ALL COSTS WHETHER OR NOT HOLDING UTILITY POLES ISDEPICTED IN THE PROJECT DRAWINGS.15. FLORIDA LAW (F.S. 553.851) REQUIRES THAT PERSONS MAKING EXCAVATIONS INPUBLIC AND PRIVATE STREETS, ALLEYS, RIGHT-OF-WAYS OR UTILITY EASEMENTSMUST FIRST OBTAIN INFORMATION ON LOCATION OF UNDERGROUND GAS PIPELINES.16. LOCATIONS AND ELEVATIONS OF EXISTING UTILITIES EXPOSED DURINGCONSTRUCTION SHALL BE ACCURATELY RECORDED ON THE CONSTRUCTIONDRAWINGS. THE ENGINEER SHALL BE IMMEDIATELY NOTIFIED OF ANY CONFLICTSWITH PROPOSED CONSTRUCTION. THE ENGINEER AND/OR OWNER MAY WITHHOLDPROGRESS PAYMENTS IF AS-BUILT DRAWINGS ARE NOT MAINTAINED DURINGCONSTRUCTION AND KEPT UP TO DATE WITH NEW AND EXISTING UTILITIESACCURATELY RECORDED.17. CONTRACTOR SHALL COORDINATE WITH ALL UTILITIES (EXISTING AND PROPOSED)TO VERIFY FINAL LOCATIONS, DEPTHS, QUANTITIES AND SIZE OF ALL UTILITIES PRIORTO THE START OF CONSTRUCTION FOR THIS PROJECT.18. THE INFORMATION SHOWN ON THESE DRAWINGS CONCERNING TYPE AND LOCATIONOF UNDERGROUND AND OTHER UTILITIES IS BASED ON AVAILABLE RECORDS ANDSURVEYS BUT IS NOT GUARANTEED TO BE ACCURATE OR ALL INCLUSIVE. THECONTRACTOR SHALL MAKE HIS OWN DETERMINATION AS TO THE TYPE ANDLOCATION OF UTILITIES AS MAY BE NECESSARY TO AVOID DAMAGE THERETO AND ISRESPONSIBLE FOR COORDINATING UTILITY RELOCATION WITH PROJECTCONSTRUCTION. CONTRACTOR IS SOLEY RESPONSIBLE FOR ALL COSTS AND FEESASSOCIATED WITH UTILITY RELOCATION AND/OR DAMAGE INCURRED DURINGCONSTRUCTION WHETHER OR NOT THE UTILITY IS DEPICTED IN THE PROJECTDRAWINGS. CONTRACTOR WILL NOT BE COMPENSATED FOR ANY COSTSASSOCIATED WITH LOST PRODUCTION DUE TO EXISTING UTILITIES WHETHER OR NOTTHE UTILITY IS DEPICTED IN THE PROJECT DRAWINGS.19. THE CONTRACTOR SHALL COORDINATE THE LOCATION OF ALL PROPOSED FIREHYDRANTS WITH THE CITY OF DELTONA.20. ALL EXISTING WATER SERVICES WILL BE REMOVED, REPLACED, AND RECONNECTEDTO EXISTING CUSTOMERS WATER SERVICES WITH NEW SERVICES INCLUDINGMETERS AND METER BOXES TO FINISHED GRADE. SERVICE METERS SHALL BENEPTUNE T-10. METER BOXES SHALL BE NDS-PRO SERIES, DOUBLE-D1500,SINGLE-D1200, MODEL 125BCDWB OR MODEL 121BCDMCIFB. EXISTING METERSLOCATED WITHIN SIDEWALKS OR DRIVEWAYS SHALL BE RELOCATED OUT OFSIDEWALKS AND DRIVEWAYS. EXISTING METER BOXES SHALL BE REMOVED ANDCONCRETE SHALL BE REPAIRED. (REPLACE 4'X4' SIDEWALK MINIMUM).21. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE (LONG OR SHORT & SINGLE OR DOUBLE) OF ALL EXISTING ANDPROPOSED WATER SERVICES PRIOR TO START OF CONSTRUCTION. CONTRACTORSHALL MEET WITH THE CITY TO DETERMINE QUANTITIES OF ALL EXISTING ANDPROPOSED WATER SERVICES.Sheet Number-- COVERG002G003G004SHEET LIST TABLESheet TitleGENERAL NOTES AND DRAWING INDEXLEGEND AND ABBREVIATIONSKEYPLANC101 PLAN AND PROFILE - STATION 9+00 TO 14+00C102 PLAN AND PROFILE - STATION 14+00 TO 18+00C103 PLAN AND PROFILE - STATION 18+00 TO 22+50C104 PLAN AND PROFILE - STATION 22+50 TO 27+00C105 PLAN AND PROFILE - STATION 27+00 TO 31+50C106 PLAN AND PROFILE - STATION 31+50 TO 36+00C107 PLAN AND PROFILE - STATION 36+00 TO 40+00C108 PLAN AND PROFILE - STATION 40+00 TO 44+00C109C501C502C503C504PACO CT. & ECHO CT. WATER MAINDETAILSDETAILSDETAILSDETAILSDATE ______________CB11. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE HORIZONTAL& VERTICAL LOCATION OF ANY EXISTING UTILITIES OR PIPELINES PRIOR TOCONSTRUCTION. DEPTH DEPICTED IN PROFILE VIEW ARE ASSUMED TO BE 3 FEET.12. HORIZONTAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARYOR STORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST THREE FEET BETWEEN THE OUTSIDE OFTHE WATER MAIN AND THE OUTSIDE OF ANY EXISTING OR PROPOSED STORMSEWER.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST SIX FEET AND PREFERABLY TEN FEET,BETWEEN THE OUTSIDE OF THE WATER MAIN AND THE OUTSIDE OF ANYEXISTING OR PROPOSED GRAVITY-TYPE SANITARY SEWER, WASTEWATERFORCE MAIN AND RECLAIMED WATER MAIN. THE MINIMUM HORIZONTALSEPARATION DISTANCE BETWEEN WATER MAINS AND GRAVITY-TYPE SANITARYSEWERS SHALL BE REDUCED TO THREE FEET WHERE THE BOTTOM OF THEWATER MAIN IS LAID AT LEAST SIX INCHES ABOVE THE TOP OF THE SEWER.12. VERTICAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARY ORSTORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED GRAVITY-TYPE SANITARY SEWER OR STORM SEWER SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID SO THE OUTSIDE OF THE WATER MAIN IS AT LEAST SIX INCHES, ANDPREFERABLY 12 INCHES, ABOVE OR AT LEAST 12 INCHES BELOW THE OUTSIDEOF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TO LAY THE WATERMAIN ABOVE THE OTHER PIPELINE.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED WASTEWATER OR STORMWATER FORCE MAIN SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID TO THE OUTSIDE OF THE WATER MAIN AT LEAST 12 INCHES ABOVE ORBELOW THE OUTSIDE OF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TOLAY THE WATER MAIN ABOVE THE OTHER PIPELINE.C) AT THE UTILITY CROSSINGS DESCRIBED IN PARAGRAPHS (A) AND (B) ABOVE,ONE FULL LENGTH OF WATER MAIN PIPE SHALL BE CENTERED ABOVE OR BELOWTHE OTHER PIPELINE SO THE WATER MAIN JOINTS WILL BE AS FAR AS POSSIBLEFROM THE OTHER PIPELINE. ALTERNATIVELY, AT SUCH CROSSINGS, THE PIPESSHALL BE ARRANGED SO THAT ALL WATER MAIN JOINTS ARE AT LEAST THREEFEET FROM ALL JOINTS IN STORM SEWERS AND AT LEAST SIX FEET FORM ALLJOINTS IN GRAVITY-TYPE SANITARY SEWERS AND WASTEWATER FORCE MAINS.13. A MINIMUM OF ONE TRAFFIC LANE SHALL BE MAINTAINED AT ALL TIMES DURINGINSTALLATION OF PIPELINE ROADWAY CROSSINGS. CONTRACTOR SHALL BERESPONSIBLE FOR MAINTENANCE OF TRAFFIC DURING THE WORK AND FORCOORDINATION WITH THE OWNER, AS NECESSARY.14. CONTRACTOR SHALL BE RESPONSIBLE FOR CONTACTING OTHER UTILITYCOMPANIES AND ARRANGING TO HAVE UTILITY POLES HELD OR RELOCATED IF22. IF FIELD CONDITIONS REQUIRE, THE LOCATION OF PROPOSED MAINS CAN BEADJUSTED WITHIN THE RIGHT OF WAY WITH THE APPROVAL OF THE ENGINEER ANDOWNER. THE DISTANCE FROM THE OUTSIDE EDGE OF THE MAIN AND THE RIGHT OFWAY SHALL BE GREATER THAN OR EQUAL TO 4 FEET.23. IF FIELD CONDITIONS PERMIT, CONTRACTOR SHALL DEFLECT THE PROPOSED MAINSABOVE CROSS PIPE CONFLICTS, i.e. STORM DRAINS AND SEWER LATERALS, INSTEADOF BELOW, UNLESS AN INTERMEDIATE HIGH POINT IS CREATED.24. EACH BACTERIOLOGICAL SAMPLE POINT SHALL BE EQUIPPED WITH A CORPORATIONSTOP, DISCHARGE PIPE, AND ABOVE-GRADE VALVE. FOLLOWING PASSAGE OFBACTERIOLOGICAL TESTING, THE CONTRACTOR SHALL REMOVE THE CORPORATIONSTOP AND PLUG THE CONNECTION.25. CONTRACTOR WATER MAIN CLEARANCE PACKAGES SHALL CONTAIN AS-BUILTDRAWINGS SIGNED AND SEALED BY A LICENSED SURVEYOR, PASSINGBACTERIOLOGICAL TEST REPORTS, AND PRESSURE TEST FORMS SIGNED BY THECITY PROJECT INSPECTOR. SUBMITTALS SHALL INCLUDE FOUR (4) HARDCOPY SETSINCLUDING THE ORIGINAL PASSING BACTERIOLOGICAL SAMPLE REPORTS AND ONE(1) CD CONTAINING ELECTRONIC FILES OF AS-BUILT DRAWINGS IN AUTOCADFORMAT. AS-BUILT DRAWINGS SHALL DEPICT THE INFORMATION REQUIRED IN THECONTRACT DOCUMENTS ALONG WITH THE LOCATIONS OF THE BACTERIOLOGICALSAMPLES LABELED TO CORRESPOND TO THE BACTERIOLOGICAL SAMPLE REPORTS.FAILURE OF THE CONTRACTOR TO PROVIDE THE REQUIRED INFORMATION ORSUBMISSION OF POOR QUALITY AS-BUILT DRAWINGS WILL COUNT AS ANAPPLICATION REVIEW. POOR QUALITY AS-BUILT DRAWINGS WILL BE RETURNED WITHCOMMENTS ONE (1) TIME AND SUBSEQUENT REVIEWS OF POOR QUALITY AS-BUILTDRAWINGS SUBMITTED BY THE CONTRACTOR WILL BE COUNTED AS ONE (1)APPLICATION REVIEW PER INSTANCE AND THE CITY AND ENGINEER WILL DEDUCTREVIEW, HANDLING, AND DIRECT COSTS FROM THE CONTRACTOR'S PROGRESSPAYMENT APPLICATIONS AND/OR PROJECT RETAINAGE. THE PROJECT MANUALAND/OR THE DRAWINGS WILL SPECIFY THE CONTRACTOR'S RESPONSIBILITIES ANDESTIMATED COSTS. PARTIAL SUBMITTALS WILL NOT BE REVIEWED. PARTIALCLEARANCES SHALL BE FOR A STREET IN ITS ENTIRETY INCLUDING BRANCHINGSTREETS AT MINIMUM UNLESS APPROVED IN WRITING BY THE ENGINEER PRIOR TOSUBMITTAL.26. CONTRACTOR SHALL COORDINATE LIMITS OF REMOVAL AND REPLACEMENT OFASPHALT AND CONCRETE WITH CITY OF DELTONA AND THE ENGINEER.27. CONTRACTOR WILL BE REQUIRED TO INSTALL AIR RELEASE VALVES OR FIREHYDRANTS AT NO ADDITIONAL COST TO THE OWNER AT ALL HIGH POINTS CREATEDBY THE CONTRACTORS INSTALLATION AS DETERMINED BY THE ENGINEER AND THECITY OF DELTONA.28. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE OF ALL EXISTING SEWER LATERALS/SERVICES AND RELOCATETHEM AS NECESSARY TO ACCOMMODATE THE PROPOSED PROJECT. RELOCATIONOF SEWER LATERALS/SERVICES 12" BELOW THE PROPOSED WATER MAIN ISPREFERRED.29. CONTRACTOR SHALL RESTRAIN ALL EXISTING UTILITIES AS NEEDED IN ACCORDANCEWITH DETAIL 2 DRAWING C501.30. ALL PROPOSED PIPE AND FITTINGS SHALL BE MECHANICAL JOINT UNLESSOTHERWISE NOTED.31. RESTRAINED JOINTS FOR PVC PIPE SHALL BE MANUFACTURED RESTRAINED JOINTS.MARKWMSERVICEMATERIALPOTABLE WATER PVC DR-18 N/A DI CEMENT DI 250 CEMENT DI CEMENTNOTES:BURIED PIPE BURIED FITTINGS BELOW ROADWAY PIPE BELOW ROADWAY FITTINGSCLASSPIPING MATERIAL SCHEDULELININGMATERIAL1. ALL PIPE LINING, INCLUDING ANY MATERIAL WHICH COMES INTO CONTACT WITH POTABLEWATER SHALL BE NSF (STANDARD 61) APPROVED FOR USE WITH POTABLE WATER.2. BELOW GROUND PIPE SHALL BE "BLUE", COLOR OR STRIPES AS SPECIFIED IN SECTION9905 FOR THE POTABLE WATER MAINS.3. DUCTILE IRON PIPE SHALL BE ENCASED IN POLYETHYLENE TWENTY-FIVE (25) FEET ONEACH SIDE OF ANY PERPENDICULAR CROSSING OF METALLIC GAS MAINS OR ANY OTHERCATHODICALLY PROTECTED PIPELINE AND FOR LOCATIONS PARALLEL TO AND WITHIN TENFEET OF METALLIC GAS MAINS OR OTHER CATHODICALLY PROTECTED PIPE AND THROUGHTHE AREA OF INFLUENCE OF CATHODIC PROTECTION ANODE BED.4. PIPE CLASS SHALL MEET SPECIFICATION 15050.LININGMATERIALCLASS48 HOURS BEFORE DIGGINGLININGMATERIALLININGCITY OF DELTONAA32. ASBESTOS CEMENT (AC), DUCTILE IRON, AND PVC WATERMAIN IN CONFLICT WITHPROPOSED DRAINAGE IMPROVEMENTS (STRUCTURES, PIPES, ETC)SHALL BEREMOVED IN ACCORDANCE WITH SPECIFICATIONS 01100, 02050 AND 02080.CALLTOLL FREE1-800-432-4770Project No.:Designed By:Drawn By:200-08534-13001MBSPDSUNSHINE STATE ONE CALL CENTERChecked By:MADG002Bar Measures 1 inch


1/9/2013 9:17:02 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\COVER & G004 KEYPLAN.DWG - LOPEZ, HERNANMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429www.tetratech.comKEYPLAN________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FNEC108FT. SMITH BLVD.DC109C107C106CC109C104 C105SAXON BLVD.C101 C102C103BNORMANDY BLVD.CITY OF DELTONADATE ______________AProject No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMADG004Bar Measures 1 inch


1/10/2013 10:12:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4' MIN.(TYP)3' MIN.(TYP)3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 9+00 TO 14+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDR/W4C502STA:13+52.67, 56.02'LDIRECT CONNECT TO6" GATE VALVE, 6" 45° BEND4 1C502 C504EXISTING 12" WMBACT. SAMPLE LOCATIONNOTE:C502 C504 (2) 12" 45° BENDSDROP INLET12" GATE VALVESTA:9+45.25, 37.61'LTOP 54.321. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR8 BACT. SAMPLE LOCATION6" TEE, (2) 6" 45° BENDS (DEFLECT PIPE UP)(2) 6" 45° BENDS (DEFLECT PIPE DOWN)STABILIZATION/BRACING OF EXISTING LIGHT POLE TO INSTALL WATER MAINSTA:13+48.73, 34.15'L4C5021C504R/W R/W6''W 6''W2C502STA:9+34.22, 31.32'LDIRECT CONNECT TOEXISTING 6" WM. (2) 6" 45°BENDS, 6" GATE VALVEBACT. SAMPLE LOCATION1C5049 + 0041WVDROP INLETTOP 55.13WV6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEPROPOSED 6" DIWATER MAIN TO BEINSTALLED AT DEPTHSUFFICIENT TO BEBELOW EXST 6" WMDROP INLETTOP 54.20SDR/WSD SDWATER545457DROP INLETTOP 53.68R/W R/W R/W R/W R/W R/W R/WSTA:9+44.14, 25.53'R16"x6" TEE, 16" CAP AND16" GATE VALVEFH ASSEMBLYBACT. SAMPLE LOCATIONSTA:9+60.09, 25.68'R(2) 16" 45° BENDSSTA:9+80.88, 55.76'LDIRECT CONNECT TO EXIST4" WM. 6"x4" REDUCER6''WEXISTING36" RCP16''WR/WR/W6''WWV30.00' EXISTINGDRAINAGE EASEMENT4''W 4''WQUINCY AVE.STA:9+74.32, 44.96'LFH ASSEMBLY6''WSTA:9+69.88, 37.79'L(2) 6" 45° BENDS(ROTATE AS REQUIRED)10 + 004" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE2C502PRC: 10+00.00STA:9+86.24, 25.41'R(2) 16" 45° BENDSR/WR/WINLET TYPE P-1TOP 55.09S INV. 50.5016''W 16''W2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2718" PIPER/W R/W11+00555516''W8''W56MITERED END SECTIONNS INV. 50.00PROPOSED 16"PVC WATER MAINSTA:10+79.65, 35.00'R(2) 16" 45° BENDS8" VALVE2-1/2' DEEP555555R/WWATERELECR/W R/W R/W8''W 8''WNORMANDY BLVD.16''WSTA:11+63.26, 33.97'R(2) 16" 45° BENDS2C5045C501PROPOSED SHORTWATER SERVICE (TYP)REMOVE AND REPLACEEXISTING DRIVEWAY(TYPICAL)EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W12 + 00PROPOSED LONGWATER SERVICE (TYP)16''W8''WR/W R/W R/WSTA:12+00.01, 33.97'R(2) 16" 45° BENDS2C5042C502R/WREMOVE AND REPLACEEXISTING SIDEWALK3C501STA:13+00.00, 34.01'RFH ASSEMBLY(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM4C502EXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/WR/W12''W12''WWATER12''WR/W8''W57SAXON BLVD.13+00 +PT: 13+04.03WV12''W 12''W16''W 16''WSTA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)1C504SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACESTA:13+50.76, 59.03'RDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONWVEXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACE12''WOPEN CUT6C50116''WWATERWATER5514 00STA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSS0MATCHLINE STA: 14+00.008''WR/WEXISTING 8" AC WM4' DEEP10 20 40TELNSCALE: 1" = 20'R/WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866647068666462CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)62B60585654525048464442FHASSEMBLY16" CAP, 16"GATE VALVE,FH ASSEMBLY16"X6"TEEEXIST. 36" RCPINV. 47.76QUINCY AVE.S-101FL 50.70(+) 0.309%12" MIN.(TYP)18" PIPE(FUTURE, SEE ROADWAYENGINEER PLANS) INV. ±50.40FL 50.50S-10418" PIPEFL 50.80(2) 16" 45°BENDSPROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(2) 16" 45°BENDS(2) 16" 45°BENDSEXISTING GRADEABOVE PROPOSED PIPE(+) 0.309% (-) 0.321%FHASSEMBLY16" 45° BENDS(ROTATE AS REQUIRED)16"x12"CROSSPROPOSED16" DI WMSAXON BLVD.EXISTING12" WM60585654525048464442CITY OF DELTONA40(2) 16" 45°BENDS(2) 16" 45° BENDS4038383636A34323432Project No.:Designed By:Drawn By:200-08534-13001MBSPD10 309+003010+00 11+00 12+00 13+00 14+00Checked By:MADC101Bar Measures 1 inch


1/9/2013 2:36:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN543' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 14+00 TO 18+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7R/W25R/WNFEDSTA:13+52.67, 56.02'LDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONSTA:13+48.73, 34.15'L(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/W12''W12''WWATER13+00 +16''WPT: 13+04.03STA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEWV12''W 12''WR/W16''W12''WWV8''WSAXON BLVD.EXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEOPEN CUT6C501MATCHLINE STA: 14+00.00WATER55R/W8''W 8''WTELVERTICAL BENCHMARK 007CODN 1654429.94E 584739.67ELEV 55.39R/W R/W R/W14 00 +16''WSTA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSSR/WEXISTING 8" AC WM4' DEEPARVR/WPC: 14+54.035315 008''W 8''W16''W 16''W 16''WSTA:14+22.78, 35.00'RARV ASSEMBLY(2) 16" 45° BEND7C501UTILITYCONFLICTR/W R/W R/W4C504WV5252EXISTING 8" AC WM4-1/2' DEEPSTA:15+00.00, 35.00'R416" GATE VALVENOTE:R/W5151NORMANDY BLVD.16 + 00REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTC50216''W50R/W R/W R/W8''W 8''W 8''WR/W R/WPROPOSED 16" PVCWATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 274949484816''W 16''W17 + 00R/W R/W R/W R/W48R/W R/W R/W R/W R/WSTA:16+65.14, 35.00'RFH ASSEMBLYPROPOSED LONGWATER SERVICE (TYP)2C5022C50447464645458''W 8''W 8''WPRC: 17+58.0516''W 16''W18 + 00MATCHLINE STA: 18+00.00010 20 40SCALE: 1" = 20'494916''WDATE ______________R/WSTA:13+50.76, 59.03'RDIRECT CONNECT TO12''W70687068SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C66646266646260585654(-) 1.417%(2) 16" 45°BENDS(-) 2.697%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINE6058565452FOC5250FOC18" PIPES-20350B484644424038ARVPROPOSED16" DI WM16" GATEVALVEPROPOSED16" PVC WMS-201FL 44.30(-) 2.697%FOCFHASSEMBLY(+) 0.599%18" PIPE18" PIPEFL 43.4018" PIPE484644424038CITY OF DELTONA3634EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA3634A3232303014+00 15+00 16+00 17+00 18+00Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMADC102Bar Measures 1 inch


1/9/2013 2:43:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANWATER WATER3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 18+00 TO 22+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra TechFE481R/W R/W R/W R/W47464645458''W 8''W 8''WPRC: 17+58.0516''W18 + 00R/W R/W R/WMATCHLINE STA: 18+00.00492 3 4 5 6 74916''WWATER5050515216''W535324R/W R/W R/W8''W 8''W19 + 004949NOTE:R/W R/W R/W4949231. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2716''WPROPOSED LONGWATER SERVICE (TYP)16''W8''W2C50420 + 00R/W R/W R/WNORMANDY BLVD.R/W8''W 8''WREMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)WATER16''W 16''WINLET TYPE P-1TOP 49.75NE INV. 42.4021+00R/W R/W R/W16''W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE50R/W8''W24" PIPE2C502EXISTING 4" AC WM3-1/2' DEEP51525354R/W16''W4''W22+00WV4748PACO CT.MANHOLE P-7TOP 50.03SW INV. 42.204950FOUND ND LB1221R/W R/W R/W51TEL5253STA:22+69.50, 40.95'LFOUND IR 1/2 LB5383ARV ASSEMBLYBACT. SAMPLE LOCATION54R/W8''W 8''W16''W6''WARV6''WPROPOSED 6"PVC WATER MAINSEE SHT. C109 FOR PACO CT. WATER MAINSTA:22+00.00, 34.66'RFH ASSEMBLY0MATCHLINE STA: 22+50.00NSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM10 20 40SCALE: 1" = 20'WVPROPOSED 6"DI WATER MAIN16''WOPEN CUTR/WWATERWATER23+00WATERSTA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEDATE ______________D2C504PROPOSED SHORTWATER SERVICE (TYP)STA:21+69.13, 34.55'R(2) 16" 45° BENDSSTA:21+93.30, 34.55'R(2) 16" 45° BENDSSCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866646260706866646260B585654525048464442403818" PIPEFL 43.10S-20518" PIPEFL 44.40FL 42.60PROPOSED GRADEAT ROAD CENTERLINEPROPOSED GRADE ATPIPE CENTERLINES-20718" PIPEFL 45.4024" PIPE 24" PIPEPROPOSED16" PVC WMFL 42.40EXISTING GRADEABOVE PROPOSED PIPE(4) 16" 45°BENDSFHASSEMBLYPACO CT.(+) 0.599% (-) 1.000%S-209A50.495856545250484644424038CITY OF DELTONAA363432EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA363432Project No.:Designed By:Drawn By:200-08534-13001MBSPD3018+00 19+00 20+00 21+00 22+0030Checked By:MADC103Bar Measures 1 inch


1/10/2013 10:24:18 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4''W6''W3' MIN.(TYP)4646MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 22+50 TO 27+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 74545F4''W42434445456''WWATERWATERBlock 381NOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 272C504STA:26+04.54, 130.00'LARV ASSEMBLYBACT. SAMPLE LOCATION1C504PROPOSED LONG DOUBLEWATER SERVICE (TYP)4C504R/WWMARVWV STUBPROPOSED LONG DOUBLEWATER SERVICE (TYP)2C5044748R/WWMWATER0N10 20 40SCALE: 1" = 20'4''W 4''WR/W R/W46462C504PROPOSED SHORT SINGLEWATER SERVICE (TYP)EXISTING 4" AC WM3-1/2' DEEPR/WEDCSEE SHT. C109 FOR PACO CT. WATER MAINEXISTING 4" AC WM3-1/2' DEEP22 + 00R/W4''WWV51525016''W5316''W54PACO CT.R/W R/W R/W494847TEL6''WWATERR/W12R/W R/W8''W 8''W 8''W 8''W6''WWVARV23 + 00R/W R/W5049494545464724 + 004848WATER11R/W R/W R/W R/WNORMANDY BLVD.8''W 8''W 8''WMANHOLE P-7TOP 50.03PROPOSED 6"SW INV. 42.20 DI WATER MAININLET TYPE P-1TOP 46.996OPEN CUTNE INV. 41.80MATCHLINE STA: 22+50.00STA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEPROPOSED 6"PVC WATER MAINSTA:22+69.50, 40.95'LARV ASSEMBLYBACT. SAMPLE LOCATIONSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMC50116''W4C5041C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACT16''W16''WPT: 24+39.5416''W48R/W R/W R/W R/W R/W R/W R/W R/W R/W2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PROPOSED 16"PVC WATER MAINSTA:25+12.75, 28.65'R16" 11.25° BENDPROPOSED SHORTWATER SERVICE (TYP)PROPOSED 4"PVC WATER MAINSTA:25+94.69, 39.63'L(2) 4" 45° BENDS(ROTATE AS REQUIRED)STA:25+94.46, 22.47'L(2) 4" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM3-1/2' DEEPR/W4''W4''W 4''W478''W 8''W 8''W25 + 00 26 + 00 +16''W 16''WSTA:25+70.36, 35.00'R16" 11.25° BENDSTA:25+97.01, 32.69'R16"x4" TEE16" GATE VALVE4" GATE VALVEWVWV16''WWVOPEN CUTPROPOSED 4"DI WATER MAINSTA:26+35.49, 29.35'R16" 11.25° BEND6C5014" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.16''W24" PIPESTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501TELTELMATCHLINE STA: 27+00.0027 0016''W47R/W4747504846464949R/W16''WDATE ______________64626462SCALE:HORIZ. 1"= 20'VERT. 1" = 5'606058585656B5452504846444224" PIPE24" PIPES-20918" PIPEFL 44.60PROPOSED GRADEAT ROAD CENTERLINE24" PIPE(-) 1.000%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINES-21118" PIPECLAY CT.54525048464442CITY OF DELTONAA4038363432FL 42.2016"X6" TEE6" GATE VALVEFL 42.10PROPOSED 16"PVC WATER MAINEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA16" 11.25°BEND(-) 0.600%16" 11.25°BENDFL 41.8016"X4" TEE16" GATE VALVE4" GATE VALVEFL 42.6016" 11.25°BENDFHASSEMBLY4038363432Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMAD303023+00 24+00 25+00 26+00 27+00C104Bar Measures 1 inch


1/10/2013 10:32:54 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 27+00 TO 31+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FED16''WBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.24" PIPEFOUND ND BLACKBURNLB1221TEL TEL47R/WR/W4747504646484949WATERWATERR/W R/W R/W R/W R/W R/W8''W 8''W 8''W 8''W 8''W 8''W47474646R/W R/W R/W R/W R/W R/W R/W R/W R/WSTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501MATCHLINE STA: 27+00.0027 + 00 28 + 00 +16''WNOTE:REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAIN4545NORMANDY BLVD.16''W 16''W 16''W 16''W 16''WSTA:28+58.90, 35.00'R(2) 16" 45° BENDS7C5012C502UTILITYCROSSING1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2724" PIPESTA:28+95.00, 35.00'RFH ASSEMBLYSTA:28+81.00, 35.00'R(2) 16" 45° BENDSINLET TYPE P-1TOP 44.64SW INV. 39.904444WATER29 00 +STA:29+64.54, 35.00'R16" 11.25° BEND2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PC: 29+64.54PROPOSED SHORTWATER SERVICE (TYP)WATERWATERWATER WATERGAS43R/W R/W R/W8''W 8''W 8''W30 00PROPOSED LONGWATER SERVICE (TYP)16''W2C504STA:29+90.57, 30.02'R16" 11.25° BEND16''WGASR/W R/W R/WSTA:30+62.93, 35.00'R16" 11.25° BEND4C5021C5044231+00EXISTING 6" AC WM3' DEEP8" CAPBEGIN/END GROUT FILLEXISTING 8" WM TO BEGROUT FILLED ANDABANDON IN PLACER/W41WATERR/W R/W8''WWV8''W16''W 16''WSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMPROPOSED8" PVC WMSTA:31+36.94, 57.73'RDIRECT CONNECT TOEXISTING 8" WM(2) 8" 45° BENDS(ROTATE AS REQUIRED)8" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 16"DI WATER MAIN8''W0MATCHLINE STA: 31+50.00E. LEHIGHDR.N10 20 40SCALE: 1" = 20'OPENCUT6C50116''WR/W32+00R/W4141NOTE:DATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'6060C585856565452504846(-) 0.600%FHASSEMBLY(-) 1.499%S-21318" PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINEEXISTING GRADEABOVE PROPOSED PIPE5452504846444224" PIPE18" PIPEFL 40.30S-213S-21518" PIPEE. LEHIGHDR.4442B40383634323028FL 39.90FL 39.00FL 40.30FL 39.00(4) 16" 45°BENDS24" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED 16"PVC WATER MAIN16" 11.25°BEND16" 11.25°BENDFL 37.2016" 11.25°BENDFL 37.60FL 34.00(2) 16" 45°BENDS16"X8"TEE12" MIN.(TYP)30" PIPE40383634323028CITY OF DELTONA26PROPOSED16" DI WM26A24222422Project No.:Designed By:Drawn By:200-08534-13001MBSPD2027+00 28+00 29+00 30+00 31+002018Checked By:MADC105Bar Measures 1 inch


1/9/2013 3:06:43 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.COVER12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 31+50 TO 36+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FOUND NDR/W R/W R/W31+00R/WR/WWV8''W8''W16''W41E. LEHIGHDR.8''WR/WWATERR/W16''W414132 + 00R/W R/W R/W406''W 6''W 6''W3916''W 16''WR/W R/W R/W3933 + 00R/WBENCHMARK IR #2N 1655767.23E 586032.23ELEV 36.793816''WR/WWATER37WATERWATERWATERWATERR/W R/W6''W363634 + 00353534R/W R/W R/W R/W6''W 6''WNORMANDY BLVD.16''W 16''WR/W R/W R/W33333335+00R/W R/W R/WR/W6''W16''W 16''WPRC: 35+46.80326''W16''W36+0033R/WR/W16''WWV6''W 6''W6" PVC WMNFEDSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 6" AC WM3' DEEPMATCHLINE STA: 31+50.00OPENCUTNOTE:6C501STA:31+81.68, 38.44'R16" 11.25° BENDPROPOSED 16"DI WATER MAIN2C502STA:32+87.57, 35.00'RFH ASSEMBLY1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAINPROPOSED 16"PVC WATER MAIN2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27STA:33+57.10, 34.95'R(2) 16" 45° BENDSPROPOSED LONGWATER SERVICE (TYP)2C504PROPOSED SHORTWATER SERVICE (TYP)2C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)CONTRACTOR TO RESTABLISHSLOPES AND RIPRAP TO ORIGINALCONDITIONS OR BETTERENDWALLW INV. 27.5053"x34" ERCPSTA:35+43.11, 31.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)ENDWALLE INV. 28.60MITERED END SECTIONW INV. 22.50INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.1030" PIPESTA:35+99.05, 38.08'R16" 22.5° BENDSEENOTE 118" PIPESTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDER0 10 20 40EXISTING 6" WMBACT. SAMPLESCALE: LOCATION 1" = 20'MATCHLINE STA: 36+00.001C50418" PIPEWVR/WSTA:36+11.35, 34.88'R16" 22.5° BENDDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'52525050C48CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)484644EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINE464442E. LEHIGHDR.S-217APROPOSED GRADEAT ROAD CENTERLINE4240S-21740(-) 1.499%(-) 3.552%(-) 3.552% (+) 3.350%B383634323028262422FL 33.90PROPOSED16" DI WM16" 11.25°BEND30" PIPEFL 32.0039.33PROPOSED16" PVC WM38.9438.4737.93FH ASSEMBLY18" PIPEFL 32.10FL 31.2037.31FL 29.5016" 45°BENDS30" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA30" PIPEFL 27.90S-21934" X 53" PIPEFL 24.20FL 28.0530" PIPE(2) 16" 45° BENDS(ROTATE AS REQUIRED)S-221S-220FL 28.2012" MIN.(TYP)30" PIPEFL 24.10 , S-220FL 24.00, S-221383634323028262422CITY OF DELTONA2018PROPOSED16" PVC WM30" PIPEINV. ±23.6016" 22.5°BEND2018A16161414121210109+00 32+00 33+00 34+00 35+00 36+00Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC106Bar Measures 1 inch


1/10/2013 10:38:20 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.6''WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 36+00 TO 40+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDPRC: 35+46.8016''WR/W R/W6''W 6''W32INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.10SEENOTE 16" PVC WMR/W R/W36+0016''W336''W 6''WFOUND ND35ECHO CT.FOUND IP 1SEE SHT. C109 FOR ECHO CT. WATER MAINSTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 6" WMBACT. SAMPLELOCATION30" PIPE1C504MATCHLINE STA: 36+00.0018" PIPE3418" PIPER/WWV16''W3434WV4''WWVPROPOSED 6"DI WATER MAINOPENCUT6C501FOUND ND LB1221R/WSTA:36+11.35, 34.88'R16" 22.5° BENDR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE6''WEXISTING 4" AC WM44" DEEP4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE3537+0016''WR/WR/WR/W3636INLET TYPE P-2TOP 34.75S INV. 30.406''W16''WR/WNOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 273738 + 0016''WR/WR/W38R/W39R/WNORMANDY BLVD.PROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W6''W4040R/WR/WPROPOSED LONGWATER SERVICE (TYP)39 + 0016''W2C502EXISTING SURVEYEDWATER MAIN2C50441R/W6''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY4C504WATER4216''WR/WSTA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYR/W44ARV4343R/W40 + 0016''WR/WMATCHLINE STA: 40+00.00R/W4PT: 40+41.4216''WR/WR/W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEUTILITYCROSSINGR/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDS0EXISTING 6" AC WM3-1/2' DEEPSEE NOTE 1N10 20 40SCALE: 1" = 20'7C50116''WMARYSVILLE DR.4241 + 00WATERDATE ______________STA:35+99.05, 38.08'R16" 22.5° BENDSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C605856546058565452CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)525048EXISTING GRADEABOVE PROPOSED PIPE50484644PROPOSED GRADE ATPIPE CENTERLINE4644BA424038363432302826242216" 22.5°BEND16" 22.5°BEND18" PIPECLAY CT.16"X6" TEE16" GATE VALVE6" GATE VALVES-22418" PIPEFL 30.40PROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(+) 3.350%EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA202036+00 37+00 38+00 39+00 40+001818FHASSEMBLYARV4240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC107Bar Measures 1 inch


1/9/2013 3:21:12 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANR/WPT: 40+41.423' MIN.16''WSEE *3' MIN.MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 40+00 TO 44+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEXISTING SURVEYEDWATER MAINR/WR/WR/WR/WMARYSVILLE DR.EXISTING 6" AC WM3-1/2' DEEP6''WWVR/W16''WR/WSTA:40+90.12, 47.09'LDIRECT CONNECT TO4EXISTING 6" WM6" 45° BENDC5026" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 6" PVCWATER MAIN1C50412C504PROPOSED 16"PVC WATER MAINWATERWATER28STA:42+98.38, 36.80'LCONNECT TOEXISTING 12" WM16"x12" REDUCER12" GATE VALVEBAC. SAMPLE LOCATIONR/W R/W R/W R/W WV R/W16''W 16''W 16''W4C5021C504PROPOSED SHORTWATER SERVICE (TYP)2C504FHR/WR/WWATER4''WMONTEREYDR.N0 10 20 40SCALE: 1" = 20'WATERED16''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY STA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYC50443MATCHLINE STA: 40+00.0040+0044ARV43R/W16''W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE16''WUTILITYCROSSINGSEE NOTE 1424141NORMANDY BLVD.OPENCUTWATERWATERR/W R/W R/W R/W R/W R/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDSSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)7C501NOTE:STA:41+00.56, 34.64'L16"x6" TEE(2) 16" 45° BENDS(ROTATE AS REQUIRED)6" CAPEXISTING SURVEYEDBEGIN/END GROUT FILLWATER MAINEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE41+00 42 + 00 43 + 00 44 +6C501PROPOSED 16"DI WATER MAINPROPOSED LONGWATER SERVICE (TYP)1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAIN2. DUCTILE IRON UNDER ROAD DOES NOT SHOW IN PROFILE FOR CLARITY3. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTOR'S RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 272C504R/WBENCHMARK 0084"x4" C.M.D. "CITY OF DELTONA BM-008"STA. 44+11.43, 38.05' RTEL 32.443 CHAIN CL NORMANDY BLVD.N 1,656,585.832, E 586,604.273R/W4''W 4''W 4''WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C60585654526058565452504846EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADEAT ROAD CENTERLINECONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)50484644PROPOSED GRADE ATPIPE CENTERLINE44BA4240383634323028262422(2) 16" 45°BENDSPROPOSED16" PVC WMEXIST6" WM(4) 16" 45°BENDSEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED16" PVC WM(-) 4.298%PROPOSED PROFILE OFWM PIPE AT NORTH-WESTSIDE OF NORMANDY BLVD.* DEPTH SUFFICIENT TO DEFLECT BELOW EXISTING WATER MAIN16"X12" REDUCER & 12"GATE VALVE. CONNECT TOEXISTING WATER MAIN LINE202040+00 41+00 42+00 43+00 44+0018184240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC108Bar Measures 1 inch


1/9/2013 3:33:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C109.DWG - LOPEZ, HERNANR/WR/WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PACO CT. & ECHO CT.WATER MAINwww.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7PT: 24+39.54FEDCBA0SCALE: 1" = 20'NOTE:2C504PROPOSED LONGWATER SERVICE (TYP)36R/W1C504R/W35FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655000.58E 585192.85WMFOUND ND LS2494WMWM3C502FOUND IP 11. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THECONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.0N10 20 40SCALE: 1" = 20'N10 20 40FOUND IRR/WR/WWMR/W34R/WR/W3535R/W6''W6''WFOUND IR 1/2 LS2564366''WPROPOSED SHORTWATER SERVICE (TYP)6" 11.25° BENDN 1654986.51E 585228.214''W 4''W 4''W 4''WR/WFOUND NDFOUND IRR/W2C50436FOUND ND6''W 6''W37PROPOSED LONGWATER SERVICE (TYP)R/W R/W6" 11.25° BENDN 1655992.24E 585755.89FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655954.48E 585741.693C502ECHO CT.38EXISTING 4" AC WM3-1/2' DEEPR/W374''WR/W R/W1C5046" 11.25° BENDN 1656018.88E 585773.632C504STA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM6" 22.5° BENDSTA:22+69.50, 40.95'LN 1654970.39ARV ASSEMBLYE 585315.63BACT. SAMPLE LOCATION4 1PROPOSED 6"C504 C504PVC WATER MAINFOUND IR 1/2 LB5383TEL6" DI WMMANHOLE P-7FOUND ND LB1221WVTOP 50.03SW INV. 42.204" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEARV ASSEMBLYFOUND IRCONTRACTOR TO LOCATE ARV ATACTUAL HIGH POINT OF WATER MAIN(WATER MAIN TO BE 4-FT DEEP AT ARV)N 1656092.97E 585897.50 4WMWATERC5046" 22.5° BENDN 1656095.10E 585890.01WM6" 22.5° BENDEXISTING 4" AC WMN 1656089.0944" DEEPE 585850.49WM WMFOUND IRREMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEINCLUDED IN PAY ITEM #5C501(WATERMAIN IMPROVEMENTS)PROPOSED 6"PROPOSED SHORT 2PVC WATER MAINWATER SERVICE (TYP)C504REMOVE AND REPLACEEXISTING DRIVEWAY TO BE 5INCLUDED IN PAY ITEM #5 C501(WATERMAIN IMPROVEMENTS)REMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEC501 INCLUDED IN PAY ITEM #5(WATERMAIN IMPROVEMENTS)NOTE:STA:36+44.00, 40.61'L1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THE1 (4) 6" 45° BENDSCONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.C504 TO DEFLECT UNDEREXISTING 8" WMBACT. SAMPLE LOCATION39R/WR/W40R/W4''W41414''W42R/WR/WR/W436''W38444''W4''WR/W4545R/WR/WARVR/W46466''W47R/WR/WPACO CT.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.4''W48496''W3722 + 0037ARV50R/W6''W5152544545R/W R/W23 + 00OPENCUT46WV47NORMANDY BLVD.16''W5316''WWATERWATER8''W 8''W 8''W 8''WR/W R/W R/W4''W 4''W 4''W386''W 6''W 6''W 6''WR/W R/W R/W363635FOUND NDR/W6C50124 + 00REMOVE AND REPLACEEXISTING DRIVEWAYR/W R/W R/W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEECHO CT.ECHO CT.6''W34FOUND IP 136 + 0049495016''W 16''WSTA:22+71.08, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE33R/W6''WWV3434OPENCUT16''WR/W R/W R/WR/WR/W35WVWVR/W6''W37 + 006C5016" DI WMFOUND ND LB122116''W18" PIPER/W3616''WR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE37R/W16''W38 + 00NORMANDY BLVD.INLET TYPE P-2TOP 34.75S INV. 30.4038CITY OF DELTONADATE ______________Project No.: 200-08534-13001Designed By:Drawn By:Checked By:C109Bar Measures 1 inch


12/13/2012 12:22:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C501.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FBACKFILLBd(SEE NOTE 1)BcANGLE TO MEET THEREQUIREMENTS OF THEFLORIDA TRENCH SAFETYACT.1/2" EXP JOINTFULL DEPTH OF WALKMAX 15'-0" SPACINGNOTES FOR REPLACEMENT URBAN FLARED TURNOUTS1. DRIVEWAY 6" CONCRETE PAVEMENT AND DROP CURB SHALL MEET THE MATERIAL ANDCONSTRUCTION REQUIREMENTS OF SECTIONS 522 AND 520 RESPECTIVELY OF THE FDOTSTANDARD SPECIFICATIONS. THE DRIVEWAY FOUNDATION SHALL MEET THE REQUIREMENT OFSUBARTICLE 522-4.SPRINGLINE OF PIPE12"COMMON FILLCOVER MATERIAL5'-0" MAX5'-0" MAX5'-0" MAX2. DRIVEWAYS AND DRIVEWAY APRONS SHALL BE 6" INCHES THICK, CLASS B CONCRETE, WITH6X6-10/10 WWM.EDNOTES:VERTICAL TRENCH WALLS(TYPICAL)PIPE BELLFOUNDATION,IF REQUIRED(SEE NOTE 2)SUBGRADEUNDERCUT TRENCHTYPICAL DETAIL-OPEN CUTNON-UNDERCUT TRENCHTRENCHING, PIPE BEDDING, BACKFILLING & COMPACTING1. DIMENSION Bc = PIPE O.D.DIMENSION Bd = TRENCH WIDTH AT TOP OF PIPEMAXIMUM Bd = Bc + 30"MINIMUM BdSUBGRADE= MAXIMUM DIMENSION OF BELL + 8" (UNSHEETED TRENCH)= MINIMUM DIMENSION OF BELL + 12" (SHEETED TRENCH){PIPE BEDDING & TRENCHING DETAIL}SELECT COMMON FILLHAUNCHING(Bc x 0.50)6" SELECT COMMONFILL BEDDING(SEE NOTE 8)2. REMOVE UNSUITABLE OR UNSTABLE MATERIAL, AS DETERMINED BY CITY OF DELTONA STAFF ORENGINEER, ENCOUNTERED BELOW THE TRENCH BOTTOM, AS REQUIRED TO PRODUCE A SUITABLEFOUNDATION OF BEDDING ROCK. FURNISH, PLACE AND COMPACT FOUNDATION AS SPECIFIED.3. FURNISH, PLACE AND COMPACT BEDDING, HAUNCHING, COVER MATERIAL AND BACKFILL AS SPECIFIED.4. PIPE BEDDING: SELECT COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PER AASHTO T-80.5. TRENCH BACKFILL (NON-ROADWAY): COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PERAASHTO T-180.6. USE OF SELECT COMMON FILL BEDDING TO BE DETERMINED IN FIELD BY CITY OF DELTONA STAFF ORENGINEER.7. REFER TO SPECIFICATIONS, SECTION 02221, AND CITY OF DELTONA FOR DESCRIPTION OF SELECTCOMMON FILL, COMMON FILL, AND BEDDING ROCK MATERIAL.8. WHEN UNSUITABLE MATERIAL IS ENCOUNTERED THE CONTRACTOR TO REMOVE, CARRY EXCAVATIONDEEPER AND REPLACE EXCAVATED MATERIAL WITH BEDDING ROCK TO AN ELEVATION EQUIVALENT TO6" BELOW PIPE BEDDING ELEVATION.3"1'-0"2"TOP SOILWWF SUPPORTSPLANAS SHOWN ON PLANS (TO MATCH EXISTING)4" (6" FOR 2"8'-0" WIDE WALKS)WELL TAMPED ORUNDISTURBEDEARTHNOTE: 2,500 PSI CONC (MIN)SECTIONSIDEWALK, CONCRETE3/16" X 1" TOOLEDOR CUT JOINTS3/4" RADIUSFIN GR6" X 6" X 6/6 WWF(2 LAYERS FOR8'-0" WALKS) WWFSHALL BE SUPPLIEDIN FLATS. ROLLSARE NOT ACCEPTABLE3. DRIVEWAY SHALL CONFORM WITH FDOT STANDARD INDEX NO. 515.4.1 2 " JOINTS SHALL BE CONSTRUCTED WITH PREFORMED JOINT FILLER MATERIAL.REFER TO FDOTINDEX NO. 310(WHEREAPPLICABLE)FLARE SHAPE TOMATCH EXISTINGPROPOSED PIPEVARIES4" CONC.SIDEWALK(WHEREAPPLICABLE)EXIST CONCDRIVEWAYMATCHEXISTMATCH EXIST CURB ANDGUTTER (REF FDOT INDEX NO300)MATCH EXIST EDGE OFASPHALT PAVEMENT5' - 6" CONC.SIDEWALK(WHEREAPPLICABLE)MATCH EXISTING WIDTH1 2 " JT (NOTE4)6%(MAX)2%(MAX)MATCH EXISTING WIDTHRELPACEMENT DRIVEWAY TURNOUT - FDOT INDEX 515REPLACEDRIVEWAYTO FIRSTCONST JTOR 5' WHICHEVER ISGREATERREPLACEDRIVEWAYTOASPHALTPAVEMENT6" CONC. DRIVEWAYAND SIDEWALK(WHEREAPPLICABLE)FIN GR3'-0"CONSTRUCT UNIFORM PIPE DEFLECTION - NOT TOEXCEED 75% OF MANUFACTURER RECOMMENDEDMAXIMUM DEFLECTION PER PIPE JOINTTYPICAL UTILITY±20'-0" CENTERON UTILITY±120'-0"VARIES20'O.D.12"ALLOWABLE JOINT DEFLECTIONFOR 16" PIPEDEFLECTION TYPE UTILITY CROSSING3'-0"PROPOSED UTILITY15"3°-35' (R 320)DATE ______________DETAIL 1SCALE: NTS-DETAIL 3SCALE: NTS-DETAIL 5SCALE: NTS-DETAIL 7SCALE: NTS-CBBENDSTANDARD FITTINGS/APPURTENANCESREQUIRED LENGTH OF RESTRAINED PIPE EACH WAY (FT)PIPE DIAMETER4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"11-1/4°22-1/2°45°90°1818182118181830181818361818184418182051181822601818266418182766181831751818368818194097182245109182450121182654132182859142DEAD END* 60 85 110 133 155 177 198 218 238 277 330 379 423 465 506*NOTE: IN-LINE VALVES AND TEES (BRANCH) SHALL BE RESTRAINED AS DEAD ENDS.DIAMETER4"6"8"10"12"14"16"18"20"24"30"36"42"48"REDUCERS - REQUIRED LENGTH OF RESTRAINED PIPE AT LARGE SIDE (FT)**4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"44 79 10846134 15981 113 141 16644 82 115 14445 84 11745 84**A MINIMUM OF 20 FEET OF PIPE SHALL BE RESTRAINED ON THE SMALL SIDE.1. THE ABOVE REQUIREMENTS WERE CALCULATED IN ACCORDANCE WITH "THRUSTRESTRAINT FOR DUCTILE IRON PIPE,"THIRD EDITION, 1992, PUBLISHEDBY DIPRA, WITH THE FOLLOWING ASSUMPTIONS:SOIL CONDITIONS: SAND/SILTLAYING CONDITION: 4MINIMUM COVER: 3 FTIF FIELD CONDITIONS DIFFER FROM THE ABOVE, CONTRACTOR SHALL NOTIFY ENGINEER.PIPE RESTRAINT, RESTRAINED JOINTPOLYETHYLENE WRAPPED DIP OR PVC PIPE, 150 PSI TEST PRESSURE17114711845 8419617514911844 8322620417915144 11983274254232207180115258 324207 281114345204 280 349110 201 2822. THE RESTRAINED JOINT LENGTHS CALCULATED ABOVE FOR BENDS WERE FOR BENDS INTHE HORIZONTAL DIRECTION OR VERTICAL UP DIRECTION. IF A BEND IS ORIENTED INTHE VERTICAL DOWN POSITION, THE RESTRAINED JOINT LENGTH CALCULATED ABOVE FORTHAT BEND SHALL BE MULTIPLIED BY 3.5.108 203112UNDISTURBEDEARTH5'NOTES:1'-6"RESTRAINEDLENGTHEXISTING WM MAINTHRUST COLLARSEE DETAILSTAINLESS STEEL TAPPING SLEEVE5'TAPPING VALVE& BOXLINE STOP & PLUGCAP OR PLUGEXISTING WM MAINTO BE ABANDONEDPROPOSED MAIN1. CONTRACTOR SHALL WRAP SLEEVE AND VALVE WITH POLYETHYLENEEXCAVATION DEPTHSHALL BE 1' BELOWBOTTOM OF MAIN2. FOR RESTRAINED LENGTHS, SEE THRUST COLLAR DETAIL 3, SHEET D-4.3D1043'MIN LIMITS OFEXCAVATIONWET TAP CONNECTION TO EXISTING MAIN - WATER OR RECLAIMED2'MINREPLACEMENT CONC W/6X6-6/6 WWF(MONOLITHIC POUR)EXISTINGCONCNOTES:1.2.3.4.5.6.4" MIN1'-6"2' MINTRENCH WALL(TYP)DUCTILE IRONUTILITY PIPE5' MIN3' MINCONCRETE RESTORATION8"MINASPHALT RESTORATION1 1/2" SURFACEREPLACEMENTEXISTINGBASEBASE COMPACTED TO98% MAX. DENSITYAASHTO T-180(2T OR 8 INCHES,WHICHEVER IS GREATER)(W = PIPE OD (ft) + 2')SUBGRADE COMPACTEDTO 98% MAX. DENSITYAASHTO T-180EXISTING SURFACE AND BASE CUTS SHALL BE MECHANICALLY SAWN.LONGITUDINAL CUTS REQUIRE OVERLAY/RESURFACING TO THE COMPLETE WIDTHOF THE ROAD.CUTS AT INTERSECTIONS REQUIRE COMPLETE OVERLAY/RESURFACING TO THEEND OF ALL RETURN RADII AND/OR 10 FT BEYOND CUT, WHICHEVER IS GREATER.CUTS THROUGH TURNOUTS AND CUL-DE-SACS REQUIRE COMPLETE OVERLAY/RESURFACING.ALL UTILITY PIPE INSTALLED UNDERNEATH ASPHALT OR CONCRETE ROADWAY SHALLBE DUCTILE IRON.2T(W)W/2 + 2'TRENCH WIDTHT1'-6"SURFACE JOINTEXISTING ASPHALTCONTRACTOR SHALL FILL OPEN CUT TO ALLOW TRAFFIC TO PASS FREELY ANDSAFELY PROMPTLY AFTER INSTALLATION. IF PERMANENT RESTORATION IS TO BEDEFERRED, THE CONTRACTOR SHALL MAINTAIN THE TEMPORARY CONDITION TO THERESIDENT INSPECTOR'S SATISFACTION.TRENCHING DETAIL - ROADWAY OPEN CUTEXISTINGWM OR FMTO REMAININ SERVICETHRUST COLLARSEE DETAIL 3SHEET C504EXISTING DRAINAGE STRUCTUREOR OTHER OBSTRUCTIONNEW WMOR FMTHRUST COLLARSEE DETAIL 3SHEET C504±20' CENTEREDON UTILITYEXISTING WM OR FMTO BE REMOVED12"MIN.EXISTING BURIEDUTILITY TO REMAINVERTICAL TRANSITION AT OBSTRUCTION±20' CENTEREDON UTILITY3' MIN.45° RJ BEND45° RJBENDNEW WM OR FMNEW WMOR FMHORIZONTAL TRANSITION AT OBSTRUCTIONUTILITY CONFLICTFINISHED GRADENEW WM OR FMEXISTINGWM OR FMTO REMAININ SERVICERESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)RESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)CITY OF DELTONAADETAIL 2SCALE: NTS-DETAIL 4SCALE: NTS-DETAIL 6SCALE: NTS-DETAIL 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC501Bar Measures 1 inch


12/6/2012 1:43:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C502.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FEARLY WARNING TAPE WITH METALLICDETECTOR STRIP AND/OR WIRE6" MIN.12" MAX.FINISHED GRADEGROUND LEVELMETER BOXMETALLIC OR VINYL CONTINUOUS IDENTIFICATION/WARNING TAPEWIRE TO BE PLACED INSIDE PIPE WITH A MIN. OF 12"OF EXCESS WIRE - COILED (TYP.)DOUBLE METER BOX(18" x 24" MIN.)FINISHED GRADE2" GATE VALVE W/2-INCH SQUARE NUT DRIVE2" QUICK DISCONNECTEDNOTES:6" MIN.12" MAX.FINISHEDGRADEPVC WATER MAINOR FORCE MAINEARLYWARNINGTAPETRACING WIRE10 GAUGEBRAIDED SOLIDCOPPER1. ALL MAINS INSTALLED BY OPEN CUT SHALL HAVE A "EARLY WARNING" PROTECTION TAPE AND/OR WIRE INSTALLEDCONTINUOUSLY ALONG THE ALIGNMENT. THE PROTECTION TAPE SHALL BE TERRA-TAPE OR EQUAL. TAPE SHALL BE INSTALLEDDURING BACKFILLING 6"-12" BELOW FINISHED GRADE DIRECTLY OVER THE PIPE AND SHALL BE CONTINUOUSLY MARKED FOR THETYPE OF PIPE (EXAMPLE: "CAUTION, WATER MAIN BURIED BELOW"). THE TAPE SHALL HAVE A METALLIC DETECTABLE STRIPINCLUDED AND COLOR CODED AS FOLLOWS:BLUE - POTABLE WATERGREEN - SANITARY FORCE MAINPURPLE - EFFLUENT REUSERED - DEDICATED FIRE LINE2. ALL PVC MAINS SHALL BE A SOLID COLOR OR WRAPPED WITH COLOR CODED BAGS. ALL LETTERING SHALL APPEAR ON THREE(3) SIDES OF THE PIPE AND SHALL RUN THE ENTIRE LENGTH OF THE PIPE AND SHALL BE A MINIMUM OF 3/4 INCH IN HEIGHT WITHTHE APPROPRIATE WORDING APPEARING ONE OR MORE TIMES EVERY 21 INCHES ALONG THE LENGTH OF PIPE. THE LETTERINGMUST BE PERMANENTLY STENCILED TO THE PIPE SURFACE. LETTERING SHALL READ AS IS ACCEPTABLE FOR THE INTENDEDUSE. ALL LETTERING SHALL BE APPLIED BY THE PIPE MANUFACTURER DURING PRODUCTION.3. ALL DUCTILE IRON MAINS SHALL BE WRAPPED WITH COLOR CODED BAGS.4. ALL PVC POTABLE WATER PIPE SHALL BEAR THE NATIONAL SANITATION FOUNDATION (NSF) SEAL OF APPROVAL.6"-12"6"TYPICAL UTILITY PIPE1/2" PVC PIPE (TYP.)VALVE BOXDEAD ENDALL PVC PIPE, OR OTHER APPROVED NONMETALLIC PIPE INSTALLED WITHIN DELTONAWATER'S WATER, SANITARY SEWER, OR REUSE WATER SYSTEMS, SHALL BE INSTALLEDWITH 10 GAUGE SOLID COPPER TRACING WIRE.THE TRACING WIRE MUST BE INSTALLED DIRECTLY BELOW THE PIPE AND BROUGHT TO THESURFACE AT 500' MINIMUM INTERVALS. WIRE SHALL EXTEND A MINIMUM OF 12" ABOVEGRADE AT EACH INTERVAL AND BE COILED AND PLACED IN A VALVE BOX, METER BOX,MANHOLE, CLEANOUT OR OTHER APPLICABLE STRUCTURE.TRACING WIRE BETWEEN INTERVALS SHALL BE INSTALLED SO AS TO PROVIDECONTINUOUS CURRENT WHEN LINE LOCATION EQUIPMENT IS CONNECTED TO THETRACING WIRE. WIRE BRANCHING FROM MAIN LINES SHALL BE LINKED BY A DELTONAWATER APPROVED CONNECTOR SUCH AS KING # 2011 SAFETY SEALED CONNECTORS ORAPPROVED EQUAL.COLOR CODING:POTABLE WATER SYSTEM: BLUEREUSE WATER SYSTEM: LAVENDERSANITARY SEWER FORCE AND LOW PRESSURE SEWER SYSTEMS: GREENUTILITY PIPE LOCATION MATERIALSDETAIL 1SCALE: NTS-GENERAL NOTES:1. FOR LOW PRESSURE SEWER, POTABLE WATER AND REUSE WATER SYSTEMS: WIRE SHALL BEINSTALLED BELOW ALL MAINS AND SERVICE LINES AND ATTACHED TO VALVES, HYDRANTS ANDFITTINGS. WIRE INSTALLED WITH SERVICE LINES SHALL CONNECT TO THE WIRE INSTALLED BELOWTHE MAIN AND EXTEND TO THE CURB STOP.2. FIRE SPRINKLER LINES: WIRE SHALL CONNECT TO THE WIRE INSTALLED BELOW THE MAIN ANDEXTEND TO THE RISER CONNECTION.3. SANITARY SEWER FORCE MAINS: WIRE SHALL BE INSTALLED BELOW THE FORCE MAIN ANDATTACHED TO ALL VALVES AND FITTINGS AND BROUGHT TO THE SURFACE AND PLACED IN A METAL,DELTONA WATER APPROVED, VALVE BOX.4. DEAD END MAINS: WIRE SHALL BE PLACED IN A PROPERLY IDENTIFIED METAL VALVE BOX AT THEEND OF THE RUN.5. WIRE SHALL NOT BE FASTENED OR COILED TO VALVE OPERATING NUT.6. UTILIZE SPLIT BOLTS TO JOIN WIRE SEGMENTS.2" 90° BENDWATER MAINTAPPED CAPNOTES:1. ALL 2" PIPE AND FITTINGS SHALL BE BRASS WITHTHREADED (NPT) JOINTS.2. TAPPED CAP SHALL BE RESTRAINED AS PER THERESTRAINED JOINT DETAIL (DEAD END).BLOWOFF VALVE DETAILDETAIL 3SCALE: NTS-2"6"6" BEDDING ROCKDATE ______________ANCHOR TEEAS REQUIREDCB6"-90° BENDANCHOR TEE6" RESILIENT SEAT GATEVALVEINSTALLATION PARALLEL TO MAIN6" RESILIENT SEATGATE VALVEFIRE HYDRANTFIRE HYDRANTMAIN LINE2'-0" SQ. x 4" MIN. COLLAR W/ 1#3 CONT. REINF.SET TOP 2"ABOVE FINISHGRADE INUNPAVED AREAADJUSTABLE TYPE C.I.VALVE BOXLENGTH VARIES, NO BENDS PREFERRED4 1/2" PUMPERNOZZLE (FACINGSTREET)2- 2 1/2" HOSENOZZLE6" RESILIENT SEAT GATEVALVECONCRETE REACTION BLOCKING3"CLEAR1'-6" MIN.2'-0" MAX.8 CU. FT. OF GRAVELOR CRUSHED STONEFOR DRAINAGE SUMPPROVIDE CONC.1.0 CU. FT.NOTES:ASPHALTSURFACESCREW ORSLIDE TYPEVALVE BOXPROVIDEEXTENSIONAS REQ'D.TYPE 1VALVECAST IRON STAY-PUT COVERW/RAISED LETTERS MARKED"WATER" OR "SEWER"WIRE TO BE PLACED INSIDE PIPEWITH A MIN. OF 12" OF EXCESSWIRE - COILED W/PVC INVERTEDTHREADED CAP (TYP.)12"(MAX.)1" SCHED 40PVC PIPE(TYP.)CONCRETERIBBON FORBOX SUPPORT(TYPICAL)TYPE 236" (MIN.)COVERTRACING WIRE12 THHN SOLIDCOPPER4" x 4" x 12" LG. PRECAST CONC. POSTW/3" Ø BRONZE DISC, AS SHOWN ONCONC. COLLAR DET.1. GATE VALVES SHALL BE DUCTILE IRON RESILIENT SEAT TYPE, RATED AT 200 P.S.I. AND SHALL COMPLY WITHANSI/AWWA C509.2. CONCRETE COLLAR AND VALVE COVER SHALL BE PAINTED FEDERAL SAFETY BLUE FOR POTABLE WATER.TYPE 1 (PAVED AREAS)SOIL CEMENT,LIMEROCK ORASPHALT BASESIZE OF VALVETYPE OF VALVESERVICEDIRECTION &NO. OF TURNSTO OPENFINISHEDGRADE# 3 CONT.1" SCHED 40 PVC PIPEFOR TRACER WIRE(TYP.)12"12"WATER12"G.V.WATERR-2024" SQ.4"4"4"4"2"3" Ø BRONZE DISCANCHORED TO CONC.PAD24" x 24" x 4" THICK CONC. PADAT EACH VALVE BOX W/1-#3CONT. REINF.1/8" LETTERS TO BE CAST W/ 3" ØBRONZE DISC AS MFD. BYSHELDON BRONZE CO.ANCHOR RECESSEDBRONZE INDENT. DISC.SEE DETAIL ABOVE2" (MIN.)CITY OF DELTONAAINSTALLATIONPERPENDICULAR TO MAINFIRE HYDRANT ASSEMBLY INSTALLATIONDETAIL 2SCALE: NTS-TOTAL ASSEMBLY TO BE RESTRAINEDFROM MAIN LINE TO FIRE HYDRANTNOTES:1. A TAPPING SLEEVE WITH VALVE AND BOX SHALL BEINSTALLED WHEN CONNECTING A PROPOSED FIREHYDRANT TO AN EXISTING MAIN, OR RELOCATING ANEXISTING FIRE HYDRANT.2. HYDRANTS SHALL HAVE BREAKAWAYSECTION OR REMOVABLE BARREL.GATE VALVE AND BOX DETAILDETAIL 4SCALE: NTS-TYPE 2 (NON-PAVED AREAS)Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC502Bar Measures 1 inch


12/6/2012 1:44:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C503.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FCARRIER PIPE MAIN6"6" 10'-0"10'-0"E6" 6"# 4 BARS (TYP)FULL ENCASEMENT3" MINSAND CUSHIONSANITARY SEWEROR WATER MAINDATE ______________NOTE: USE ENCASEMENT WHERE VERTICAL CLEARANCE BETWEEN WATER MAIN ANDSEWER IS LESS THAN 18". DUCTILE IRON PIPE MAY BE USED IN LIEU OF CONCRETEENCASEMENT AT SEWER LINE CROSSING WITH A LENGTH OF PIPE CENTERED AT THEPOINT OF CROSSING, SO AS TO LOCATE JOINTS AT A MAXIMUM DISTANCE FROMTHE SEWER LINE.DTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, URBANDAY OR NIGHT OPERATIONSDETAILS 1SCALE: NTS-UTILITY CROSSING - CONCRETE ENCASEMENTDETAILS 4SCALE: NTS-CPost (Options: 2" x 4"or 2 1/2" Min. Dia. Wood;Steel 1.33 Lbs/Ft. Min.)3' Or More12" Min.15"to18"8"6' Max.Optional Post PositionsFilter Fabric (InConformance WithSec. 985 FDOT Spec.)Vertical20`Principle Post Position(Canted 20 Toward Flow)Filter FabricSilt FlowSECTIONELEVATIONNote: Silt Fence to be paid for under the contract unit price for Staked Silt Fence (LF).TYPE III SILT FENCESilt FlowNote: Spacing for Type III Fence to be in accordance withFDOT Design Index No. 102, Chart I, Sheet 1 of 3 andditch installations at drainage structures Sheet 2 of 3.Type III Silt FenceBTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, RURALDAY OR NIGHT OPERATIONSSilt FlowType III Silt FenceType III Silt Fence ProtectionAround Ditch Bottom Inlets.Do not deploy in a manner that silt fences will act as a dam across permanent flowingwatercourses. Silt fences are to be used at upland locations and turbidity barriersused at permanent bodies of water.SILT FENCE APPLICATIONSEROSION CONTROL - SILT FENCECITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 3SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC503Bar Measures 1 inch


12/13/2012 11:49:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C504.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FGATE VALVE2" RPZ BACKFLOW PREVENTER(FEBCO 806YD OR EQUAL)#4 AT 8" EACH FACEEACH WAYDIAGONALS: LENGTHPIPE OD +12"THREADED NIPPLE (TYP)PRESSURE GAUGEWITH VALVE (TYP)GATE VALVE90° BEND(TYP)EDAWWA TYPECC THREADSSERVICESADDLE1.2.3.4.NOTES:30 - 45 DEG.WATER MAIN AND RAW WATER MAINALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.ALL SERVICE SADDLES SHALL BE SMITH-BLAIR SUITABLE FORUSE WITH HDPE OR DIP PIPE, AS REQUIRED OR EQUAL.EACH TEST SERVICE SHALL TERMINATE ABOVE GRADE WITH A CURBSTOP AND SMOOTH NOSED SAMPLING TAP.EACH TEST SERVICE SHALL BE PROPERLY SAFE GUARDED AGAINSTVANDALISM DURING TESTING. THE CONTRACTOR WILL BE REQUIRED TOREMOVE TEST SERVICE FOLLOWING SUCCESSFUL BACTERIOLOGICALTESTING.BACTERIOLOGICAL TEST CONNECTIONSCORPORATION STOP& FITTING(NORMALLY OPEN)DOUBLE METER BOXASSEMBLY3/4" POLYETHYLENESERVICE LINE18"4" x 4" x 1/2" STEELBEARING PLATE(TYP.)#4 BARSUNDISTURBEDEARTHMIN.ENCASE TIE RODS IN1-1/2" PVC SLEEVEREINFORCEMENT DETAIL18"BBNOTES:1. ADDITIONAL REINFORCEMENTS SHALLBE AS SPECIFIED BY THE ENGINEER.2. MINIMUM COMPRESSIVE STRENGTH FORCONCRETE SHALL BE 3000 PSI.3. BEDDING, BACKFILL, AND COMPACTIONSHALL BE AS SPECIFIED ELSEWHERE INTHE STANDARD DRAWINGS.4. ALL FORM BOARDS SHALL BE REMOVEDPRIOR TO BACKFILL.5. NO ALLOWANCE SHALL BE MADE FORFRICTION BETWEEN THE PIPE WALL ANDTHE THRUST COLLAR.6. DESIGN PRESSURE:______ 150 P.S.I.*TRENCHLIMITSC3" COVER#4 BARS ALL AROUND(MIN. 2" CLEARANCEAROUND PIPE.)9" MIN. (TYP.)TIE RODS INCLUDINGNUTS AND WASHERS(SEE SCHEDULE BELOW)MECHANICALJOINTSSEE TRENCH DETAILSFOR PIPE BEDDINGREQUIREMENTSSCHEDULE OF DIMENSIONS AND MATERIALSPIPE DIMENSIONS (FT.) TIE RODS REQ'DSIZE(INCHES) A B C D DIA. NO.4 2.0 2.0 1.0 3/4 26810121620242.02.53.55.06.08.09.02.02.53.03.04.05.06.01.01.01.01.01.51.51.53/43/43/43/43/43/43/42222468NOTE: THRUST COLLAR AREAS TO BE COMPUTEDON BASIS OF 2000 LBS. PER SQ. FT. SOILRESTRAINT BEARING.THRUST COLLAR DETAIL FOR WATER MAIN (150 psi)ARESTRAINED LENGTH DD=3XB OR MIN. 10'-0"NOTES:1.2. THIS DETAIL IS TO BE USED FOR FILLING ANY NEWWATER MAIN AND FOR FLUSHING OF NEWMAINS UP TO 8" DIAMETER (2.5 FPS MINIMUMVELOCITY), AND FOR BACTERIOLOGICAL SAMPLINGPOINTS AT THE ENDS OF THE PROPOSED MAINS.THE JUMPER CONNECTIONS SHALL BE MAINTAINEDUNTIL AFTER FILLING, FLUSHING, TESTING,AND DISINFECTION OF THE PROPOSED MAIN HAS BEENSUCCESSFULLY COMPLETED AND CLEARANCE FOR USEFROM THE FDEP HAS BEEN RECEIVED. THIS JUMPERCONNECTION SHALL ALSO BE USED TO MAINTAIN AMINIMUM PRESSURE OF 20 PSI IN THE PROPOSEDMAINS AFTER DISINFECTION AND UNTIL THE FDEPCLEARANCE LETTER IS OBTAINED.3.B.2" SCHED 80 PVCFINISHED GRADE2" CORPORATION STOPA TEMPORARY JUMPER CONNECTION IS REQUIRED ATALL CONNECTIONS BETWEEN EXISTING ACTIVE WATERMAINS AND PROPOSED WATER MAIN IMPROVEMENTS.FLUSHING OF THE 10" DIAMETER AND LARGER WATERMAIN MAY BE DONE THROUGH THE TIE-IN VALVEUNDER VERY CONTROLLED CONDITIONS, AS FOLLOWS:A. THE TIE-IN VALVES SHALL BE OPERATED ANDPRESSURE TESTED IN THE PRESENCE OF THE UTILITYCOMPANY AND ENGINEER TO VERIFY WATER TIGHTNESSPRIOR TO TIE-IN. VALVES WHICH ARE NOT WATERTIGHTSHALL BE REPLACED.THE TEMPORARY JUMPER CONNECTION SHALL BECONSTRUCTED AS DETAILED. THE JUMPER CONNECTIONSHALL BE USED TO FILL THE NEW MAIN AND FORBACTERIOLOGICAL SAMPLING OF THE NEW MAIN ASREQUIRED BY THE FDEP PERMIT.- FLUSHING SHALL NOT BE ATTEMPTED DURING PEAKDEMAND HOURS OF THE EXISTING WATER MAINS.- ALL DOWNSTREAM VALVES IN THE NEW SYSTEMMUST BE OPEN PRIOR TO OPENING THE TIE-IN VALVE.UNION(2 REQD)TEMPORARY JUMPER CONNECTION12" MIN16" MAXEXISTING MAIN AND TIE-IN VALVE(OR TAPPING SLEEVE AND VALVE)4.5.6.7.8.SAMPLINGTAPSERVICE SADDLE WITH2" CORPORATION STOPNEW WATER LINE- MONITOR THE PRESSURE AT THE TIE-IN POINT.THE PRESSURE IN THE EXISTING MAIN MUST NOTDROP BELOW 35 PSI.- TIE-IN VALVE SHALL BE OPENED A FEW TURNS ONLYENSURING A PRESSURE DROP ACROSS THE VALVE ISALWAYS GREATER THAN 10 PSI.C. THE TIE-IN VALVE SHALL BE LOCKED CLOSED BYTHE UTILITY UNTIL FLUSHING BEGINS.D. THE TIE-IN VALVE SHALL BE OPENED ONLY FORFLUSHING OF THE NEW MAIN. THE PROCEDURE SHALL BEDIRECTED BY THE UTILITY AND OBSERVED BY THEENGINEER.E.AFTER FLUSHING, THE TIE-IN VALVE SHALL BE CLOSEDAND LOCKED IN THE CLOSED POSITION BY THE UTILITY.THE CONTRACTOR SHALL PROVIDE DOCUMENTATIONDEMONSTRATING THAT THE DOUBLE CHECK VALVE BACKFLOWPREVENTION DEVICE HAS BEEN TESTED AND IS IN GOODWORKING ORDER AT THE TIME OF INSTALLATION.EXCEPT AS REQUIRED TO FLUSH LINES GREATER THAN8" IN DIAMETER, THE TIE-IN VALVE SHALL REMAIN LOCKEDCLOSED UNTIL THE NEW SYSTEM HAS BEEN CLEAREDFOR USE BY FDEP AND ALL OTHER PERTINENT AGENCIES.UPON RECEIPT OF CLEARANCE FOR USE FROM FDEP,THE CONTRACTOR SHALL REMOVE THE TEMPORARY JUMPERCONNECTION. STOPS ARE TO BE CLOSED AND PLUGGEDWITH 2" BRASS PLUGS.ALL INSTALLATION AND MAINTENANCE OF THE TEMPORARYJUMPER CONNECTION AND ASSOCIATED BACKFLOWPREVENTION DEVICE, FITTINGS, VALVE, ETC. SHALL BE THERESPONSIBILITY OF THE CONTRACTOR.$400 REFUNDABLE DEPOSIT FOR TEMPORARY JUMPER METER.CONTRACTOR SHALL PAY FOR WATER AT RATES PROVIDED BYTHE CITY AT PROJECT INITIATION.NOT USEDDATE ______________DETAILS 1SCALE: NTS-DETAILS 3SCALE: NTS-DETAILS 5SCALE: NTS-DETAILS 7SCALE: NTS-CBWATER MAIN1-1/4 SCH. 40 PVCENCASEMENTCORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)SINGLE METER BOXAND WATER METERSINGLE SERVICEAWWA TYPECC THREADSSADDLECURB STOP(SEE NOTE 3)ADD 1-1/2" SCH 40PVC CASINGWATER MAINMARK WITHWOOD PAINTEDBLUE & WITHLOT NUMBERS1-1/4 SCH. 40 PVCENCASEMENTWATER SERVICE CONNECTIONS1-1/4 SCH. 40 PVCENCASEMENTNOTES:1. ALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.2. NO SERVICE LINE SHALL TERMINATE UNDER A DRIVEWAY.3. EACH SERVICE SHALL TERMINATE AT A CURB STOP(S) WHICHSHALL BE BURIED APPROXIMATELY 3" BELOW FINAL GRADE ANDSHALL BE CLEARLY MARKED WITH A 2" X 2" X 18" STAKE WITHTHE TOP PAINTED BLUE AND MARKED WITH THE NUMBER OF THELOT(S) TO BE SERVED.4. EXISTING WELLS SHALL BE PHYSICALLY SEPERATED FROM THE EXISTINGPIPING AND A BACKFLOW PREVENTER SHALL BE INSTALLED AT THE METER.5. SERVICE TUBING SHALL BE BLUE POLYETHYLENE ENDOPURE OR APPROVED EQUAL.WATER MAINCORPORATION STOP& FITTING(NORMALLY OPEN)30 - 45 DEG.CORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)DOUBLE METER BOXAND WATER METERDOUBLE SERVICETO METER BOXASSEMBLYBLUEPOLYETHYLENETUBINGU-BRANCHFITTING(1" x 3/4"x 3/4")CURB STOP2 EA.PREMOLDEDPLASTICJOINT FILLER5" WALLS(MIN)2" TEE2" POLY PIPE1.2.3.4.CAST IRON FRAME ANDCOVER, WITH ACCESS LID(SEE NOTE 3)NOTES:4'X4' PRECASTCONCRETE VAULT36" SQ.17 1/4"ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE. ASSPECIFIED IN SPECIFICATION 15050. CHANGE PIPE AND FITTINGSACCORDINGLY. FOR OTHER VALVE SIZES AND TYPES. VALVE SIZESTO BE DETERMINED BY THE ENGINEER AND APPROVED BY THE CITYPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM TOP OF PIPE TO FINISHEDGRADE SHALL BE 4.0 FEET.LID TO BE LETTERED WITH THE APPROPRIATE WORD "WATER".8"EXTEND GSP BLOW-OFF TO 1'-3" ABOVE GRADE, SCREEN END W/ STSTEEL SCREEN.STAINLESS STEELSCREENGROUTAIR RELEASE VALVE - WATERSLOPE 1" PER 1'2" AIR RELEASEVALVE W/ONEWAY AIR VALVE1" CURB STOP2"X1" REDUCER& 1" SHORT NIPPLE2" GATE VALVEBRONZE DOUBLE STRAPSADDLE6"16"Ø WATERPLUSPOLYETHYLENE(BLUE)POLY PIPE8"x16" REINFORCED CONCRETE FOOTING6"4"Ø HOLE, GROUTAFTER INSTALLATION20"x20"x6" P.C.C. PAD,CLASS "C"ARV ENCLOSURE(BLUE FOR WATER)STAINLESSSTEELSCREEN36"x36"x6"P.C.C. PAD,CLASS "C"4"Ø HOLE,GROUT AFTERINSTALLATION6" MIN.#57 BEDDING ROCKPREMOLDEDPLASTICJOINT FILLER4" MAX.SLOPE 1" PER 1'5" WALL (MIN.)2" TEE2" THREADEDGALV. STEEL PIPE2" SQUARE NUTRESILIENT SEATGATE VALVEo2" 90 BENDFITTINGS ANDPIPE FORA.R.V. SHALLBE BRASS6" BEDDING ROCK1.2.3.4' x 4' PRECASTCONCRETE VAULT36" DIA.17-1/4"8"WATER MAINSERVICE SADDLEPER SPECIFICATIONSECTION 50.5.4NOTES:ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE.CHANGE PIPE AND FITTINGS ACCORDINGLYFOR OTHER VALVE SIZES AND TYPES. VALVE SIZES TO BEDETERMINED BY THE ENGINEER AND APPROVED BY DELTONA WATERPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM ELBOW INVERT TO FINISHEDGRADE SHALL BE 4.0 FEET.VALVE BOX SHALL BE IN COMPLIANCE WITH FIGURE 2-031.OFFSET AIR RELEASE VALVE - WATERCAST IRON FRAMEAND COVER WITHACCESS LID.GROUTFINISHED GRADE2" AIR RELEASEVALVE W/ONE WAYAIR VALVE1" CURB STOP2"X1" REDUCER &1" SHORT NIPPLESEE NOTE 3GROUT (TYP.)2" UNION2" BRASS PIPE2" SQUARE NUTRESILIENT SEATGATE VALVE8" x 16" REINFORCEDCONCRETE FOOTING.EXISTING /PROPOSEDPAVEMENTCAST IRONVALVE BOXTOP SECTIONEXTENSIONROD ASREQUIREDo2" 90 BEND2" NIPPLENOT USEDCITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 4SCALE: NTS-DETAILS 6SCALE: NTS-DETAILS 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC504Bar Measures 1 inch


ADDENDUM # 5CITY OF DELTONABID # PW 13-05February 27, 2013NORMANDY BOULEVARD – SECTION “B” ROADWAY IMPROVEMENTSThis addendum is to announce the extension of the bid due date of this solicitation.The bid due date has been changed. The bid due date is now Monday, March 4, 2013 at 2:00 p.m.This is to allow for an additional addendum to be posted identifying additional changes to thescope of work. It is anticipated that addendum # 6 will be posted within the next 24 hours.All prospective bidders are hereby instructed not to contact the Engineer of Record or anymember of the City of Deltona Commission, City Manager, or City of Deltona Staff members otherthan the noted contact person regarding this Invitation to Bid or their bid proposal at any timeduring the solicitation or award process. Any such contact shall be cause for rejection of your bidproposal.All inquiries are to be directed to the Purchasing Agent for the Public Works Division at the City ofDeltona. Contact for this solicitation is: Brian Boehs, Purchasing Agent. Email address isbboehs@deltonafl.gov. Phone is 386-878-8955.ALL OTHER SPECIFICATIONS AND CONDITIONS REMAIN UNCHANGED.RECEIPT OF THIS ADDENDUM IS HEREBY ACKNOWLEDGED____________________________________________________NAME OF BUSINESSBY: ________________________________________________SIGNATURE/DATE___________________________________________________NAME & TITLE, TYPED OR PRINTED___________________________________________________MAILING ADDRESS___________________________________________________CITY, STATE, ZIP CODEPage 1 of 1


ADDENDUM #6CITY OF DELTONABID #PW 13-05February 27, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATEQuestions / Responses:This addendum includes the following:Questions / Responses, Clarifications and Revised Drawings.Question:Response:Question:Response:Question:Response:Will the storm pipe require a video inspection per FDOT?Yes, a video inspection of the storm drainage system will be required.Will this inspection require laser profiling of installed pipe?No, laser profiling of the storm drainage system is not required.In Utility Bid Item No. 48, Testing and Laboratory Services (Allowance), is this allowance to bedetermined by the City? If so, what amount?The measurement and payment for Testing and Laboratory Services, bid item 48, is explainedunder measurement and payment item14 of the Tetra Tech Technical Specifications Section01025. The testing allowance is listed under Tetra Tech Technical Specifications Section01410 as $5,000.00 for density testing related to the water main installation.Clarifications:1. The contractor shall be responsible for obtaining a NPDES Stormwater Permit.Operators of construction activities must obtain coverage under an NPDES stormwater permit andimplement appropriate pollution prevention techniques to minimize erosion and sedimentation andproperly manage stormwater. The majority of construction activities requiring an NPDES stormwaterpermit will likely qualify for an NPDES permit for construction. A generic permit is a general permit issuedby DEP under the authority of Section 403.0885, Florida Statutes (F.S.), which is the provision authorizingthe State to implement the NPDES program.CGP Requirements:A CGP Notice of Intent (NOI) | Word (DEP Form 62-621.300(4)(b)) must be submittedonline using Interactive Notice of Intent (iNOI) or by paper copy to the NPDESStormwater Notices Center to obtain permit coverage.A stormwater pollution prevention plan (SWPPP) must be developed andimplemented to be in compliance with the permit.http://www.dep.state.fl.us/water/stormwater/npdes/construction3.htm2. “Water main specifications have been provided as part of the original bid package. The Water MainImprovements Normandy Boulevard Part B Construction Plans completed by Tetra Tech have beenprovided in Addendum #4. The Tetra Tech plans and specifications are part of the contract documents.Please note: there is additional water main work on side streets beyond the limits of the roadway project.The water main shown in the Normandy Boulevard Part B roadway plans is for clarity and coordinationwith the roadway work only.”Page 1 of 2


ADDENDUM #6CITY OF DELTONABID #PW 13-05February 27, 2013NORMANDY SECTION B ROAD WIDENING/UTILITY RELOCATERevised Drawings: Tetra Tech PlansTetra Tech Drawing G002 –Please insert the following notes:General Notes for Work Conducted within Volusia County R/W:1. Driving and/or Staging of construction vehicles is not permitted on any sidewalks in the Right-Of-Way.Any damage to sidewalks will be repaired and/or replaced in like kind by the Contractor.2. Any road, lane or sidewalk closure requires review and approval in advance and a seven (7) day minimumnotice to Volusia County Traffic Operations (386-239-6535).3. All existing sidewalks within County Rights of Way shall remain open or provision of a temporary walkwayshall be provided in accordance with version 2010 of Florida Department of Transportation Standard Index#660 “Mid Block Closure with Temporary Walkway” unless otherwise approved by the County TrafficEngineer. Please Note that Index #660 must be shown on the use permit plans.4. No trench or excavation shall be left open or unattached overnight, unless the excavations within the clearzone of the roadway meet the drop off criteria of the 2010 Florida Department of Transportation DesignStandards (Index 600) “Of Properly Barricaded and Secured Excavations”, including all equipment andmaterials.5. All disturbed areas within the County Right of Way shall be sodded. Seed and Mulch is not acceptable.Tetra Tech Drawing C503 –Detail 1 and Detail 2 have been revised.ALL OTHER SPECIFICATIONS AND CONDITIONS REMAIN UNCHANGEDRECEIPT OF THIS ADDENDUM IS HEREBY ACKNOWLEDGEDNAME OF BUSINESSBY SIGNATURE / DATENAME & TITLE, TYPED OR PRINTEDMAILING ADDRESSCITY, STATE, ZIP CODEPage 2 of 2


2/19/2013 5:02:40 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C503.DWG - DAVALOS, PAULAMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429www.tetratech.comDETAILS________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FCARRIER PIPE MAIN6"6" 10'-0"10'-0"E6" 6"# 4 BARS (TYP)FULL ENCASEMENT3" MINSAND CUSHIONSANITARY SEWEROR WATER MAINDATE ______________NOTE: USE ENCASEMENT WHERE VERTICAL CLEARANCE BETWEEN WATER MAIN ANDSEWER IS LESS THAN 18". DUCTILE IRON PIPE MAY BE USED IN LIEU OF CONCRETEENCASEMENT AT SEWER LINE CROSSING WITH A LENGTH OF PIPE CENTERED AT THEPOINT OF CROSSING, SO AS TO LOCATE JOINTS AT A MAXIMUM DISTANCE FROMTHE SEWER LINE.DTWO-LANE, TWO-WAY, WORK IN INTERSECTIONPER FDOT 2010 INDEX 604DETAILS 1SCALE: NTS-UTILITY CROSSING - CONCRETE ENCASEMENTDETAILS 4SCALE: NTS-CPost (Options: 2" x 4"or 2 1/2" Min. Dia. Wood;Steel 1.33 Lbs/Ft. Min.)3' Or More12" Min.15"to18"8"6' Max.Optional Post PositionsFilter Fabric (InConformance WithSec. 985 FDOT Spec.)Vertical20`Principle Post Position(Canted 20 Toward Flow)Filter FabricSilt FlowSECTIONELEVATIONNote: Silt Fence to be paid for under the contract unit price for Staked Silt Fence (LF).TYPE III SILT FENCESilt FlowNote: Spacing for Type III Fence to be in accordance withFDOT Design Index No. 102, Chart I, Sheet 1 of 3 andditch installations at drainage structures Sheet 2 of 3.Type III Silt FenceBTWO-LANE, TWO-WAY, WORK ON SHOULDERPER FDOT 2010 INDEX 602Silt FlowType III Silt FenceType III Silt Fence ProtectionAround Ditch Bottom Inlets.Do not deploy in a manner that silt fences will act as a dam across permanent flowingwatercourses. Silt fences are to be used at upland locations and turbidity barriersused at permanent bodies of water.SILT FENCE APPLICATIONSEROSION CONTROL - SILT FENCECITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 3SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC503Bar Measures 1 inch


NORMANDY BLVDPROVIDENCE BLVD.CITY OF DELTONAWATER MAIN IMPROVEMENTSNORMANDY BOULEVARD PART BSAXON BLVD201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955FAX: (407) 839-3790www.tetratech.comPROJECT LOCATION:DELTONA, FLORIDACLIENT INFORMATION:CITY OF DELTONA255 ENTERPRISE ROADDELTONA, FLORIDA 32725I-4Tt PROJECT No.:200-08534-13001CLIENT PROJECT No.:PROJECT DESCRIPTION / NOTES:DELTONA BLVDWATER MAIN REPLACEMENT ALONG:NORMANDY BOULEVARD, STARTS 400 FT SOUTHWEST OF SAXONBLVD AND ENDS 400 FEET SOUTHWEST OF FORT SMITH BOULEVARDISSUED:BID SETFT SMITH BLVDPROJECTLOCATIONVICINITY MAP:SAXON BLVDNORMANDY BLVDPROJECT LOCATIONFOR CITY OF DELTONAMAYORJOHN C. MASIARCZYK, SR.VICE MAYORZENAIDA DENIZACDISTRICT 1CITY MANAGERFAITH G. MILLERCOMMISSIONERSWEBSTER BARNABYDISTRICT 2HEIDI HERZBERGDISTRICT 3NANCY SCHLEICHERDISTRICT 4FRED LOWRYDISTRICT 5CHRIS NABICHTDISTRICT 6Michael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________DATE ______________


1/9/2013 9:24:05 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\G002 GENERAL NOTES.DWG - LOPEZ, HERNANNORMANDY BOULEVARDGENERAL NOTESAND DRAWING INDEXMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7GENERAL NOTESDRAWING INDEXFED1. ALL PIPING SHALL HAVE 3'-0" MINIMUM COVER.2. ALL EXISTING PAVING, STABILIZED EARTH, DRIVEWAYS, CURBS, SIDEWALKS, FENCES,GRASSED AREAS, LANDSCAPING, CULVERTS, FRENCH DRAINS, ETC. DISTURBED BYTHE CONTRACTOR'S OPERATIONS SHALL BE RESTORED TO EQUAL OR BETTERCONDITION. RESTORATION OF GRASSED AREAS SHALL BE DONE BY SODDING.SEED-AND-MULCH IS NOT ACCEPTABLE.3. FITTINGS MAY BE USED FOR PIPE ALIGNMENT CHANGES RATHER THAN DEFLECTINGAT THE CONTRACTOR'S OPTION AND WITH NO ADDITIONAL COMPENSATION.4. THE CONTRACTOR SHALL NOT PLACE ANY FILL MATERIAL WITHIN WETTED DITCH ORWETLAND AREAS. SILTATION FENCES SHALL BE INSTALLED BY THE CONTRACTORBETWEEN WORK AND SUCH AREAS. SEE SHEET C503 DETAIL 3.5. PRIOR TO BID PREPARATION, THE CONTRACTOR MUST FAMILIARIZE HIMSELF WITHTHE OVERALL SITE CONDITIONS AND PERFORM ADDITIONAL INVESTIGATIONS ASDETERMINED NECESSARY TO UNDERSTAND THE LIMIT AND DEPTH OF EXPECTEDORGANIC SILT PEAT AREAS, ADEQUACY OF EXISTING MATERIALS TO USE AS FILL,DEWATERING REQUIREMENTS, CLEAN FILL REQUIRED FROM OFFSITE, ANDMATERIALS TO BE DISPOSED OF OFFSITE, ALL OF WHICH WILL AFFECT HIS PRICING.ANY DELAY, INCONVENIENCE, OR EXPENSE CAUSED TO THE CONTRACTOR DUE TOINADEQUATE INVESTIGATION OF EXISTING CONDITIONS SHALL BE INCIDENTAL TOTHE CONTRACT, AND NO EXTRA COMPENSATION WILL BE ALLOWED. THEMATERIALS ANTICIPATED TO BE ENCOUNTERED DURING CONSTRUCTION MAYREQUIRE DRYING PRIOR TO USE AS BACKFILL, AND THE CONTRACTOR MAY HAVE TOBRING IN MATERIALS, AT NO EXTRA COST, FROM OFFSITE TO MEET THEREQUIREMENTS FOR COMPACTION AND PROPER FILL.6. ALL CULVERTS AND EXISTING FACILITIES DAMAGED BY THE CONTRACTOR'SOPERATIONS SHALL BE REPLACED WITH MATERIAL TO MATCH EXISTING.7. ALL DRAINAGE AREAS THAT ARE CROSSED BY PIPELINES SHALL BE LEFT OPEN ATALL TIMES EXCEPT FOR SHORT PERIODS AS MAY BE NECESSARY DURING ACTUALCONSTRUCTION HOURS.8. THE CONTRACTOR SHALL OBTAIN THE SERVICES OF A REGISTERED FLORIDAPROFESSIONAL LAND SURVEYOR FOR LAYOUT OF ALL WORK, FOR RESTORING ALLMONUMENTS AND PROPERTY CORNERS DISTURBED DURING CONSTRUCTION ANDFOR PREPARATION OF PROJECT AS-BUILT DRAWINGS AND FOR PREPARATION OFPROJECT AS-BUILT DRAWINGS. PROOF OF REGISTRATION SHALL BE SUBMITTED TOENGINEER.9. THE COORDINATES AND ELEVATIONS SHOWN HEREIN ARE BASED ON INFORMATIONPROVIDED BY BOYER SINGLETON & ASSOCIATES LOCATED IN THE DRAWINGS SETNAMED "NORMANDY BLVD. SAXON BLVD. TO FORT SMITH BLVD." BID PLANS DATEDDECEMBER 2012. BENCH MARKS ARE SHOWN ON SHEETS C-102, C-106 AND C-108.10. THE CONTRACTOR SHALL LOCATE ALL PIPELINES AT PROPOSED TIE-IN LOCATIONSTO VERIFY ACTUAL LOCATION, SIZE, ELEVATION, AND MATERIAL PRIOR TO ORDERINGNEW MATERIALS.DETERMINED NECESSARY FOR CONSTRUCTION. CONTRACTOR IS SOLEYRESPONSIBLE FOR ALL COSTS WHETHER OR NOT HOLDING UTILITY POLES ISDEPICTED IN THE PROJECT DRAWINGS.15. FLORIDA LAW (F.S. 553.851) REQUIRES THAT PERSONS MAKING EXCAVATIONS INPUBLIC AND PRIVATE STREETS, ALLEYS, RIGHT-OF-WAYS OR UTILITY EASEMENTSMUST FIRST OBTAIN INFORMATION ON LOCATION OF UNDERGROUND GAS PIPELINES.16. LOCATIONS AND ELEVATIONS OF EXISTING UTILITIES EXPOSED DURINGCONSTRUCTION SHALL BE ACCURATELY RECORDED ON THE CONSTRUCTIONDRAWINGS. THE ENGINEER SHALL BE IMMEDIATELY NOTIFIED OF ANY CONFLICTSWITH PROPOSED CONSTRUCTION. THE ENGINEER AND/OR OWNER MAY WITHHOLDPROGRESS PAYMENTS IF AS-BUILT DRAWINGS ARE NOT MAINTAINED DURINGCONSTRUCTION AND KEPT UP TO DATE WITH NEW AND EXISTING UTILITIESACCURATELY RECORDED.17. CONTRACTOR SHALL COORDINATE WITH ALL UTILITIES (EXISTING AND PROPOSED)TO VERIFY FINAL LOCATIONS, DEPTHS, QUANTITIES AND SIZE OF ALL UTILITIES PRIORTO THE START OF CONSTRUCTION FOR THIS PROJECT.18. THE INFORMATION SHOWN ON THESE DRAWINGS CONCERNING TYPE AND LOCATIONOF UNDERGROUND AND OTHER UTILITIES IS BASED ON AVAILABLE RECORDS ANDSURVEYS BUT IS NOT GUARANTEED TO BE ACCURATE OR ALL INCLUSIVE. THECONTRACTOR SHALL MAKE HIS OWN DETERMINATION AS TO THE TYPE ANDLOCATION OF UTILITIES AS MAY BE NECESSARY TO AVOID DAMAGE THERETO AND ISRESPONSIBLE FOR COORDINATING UTILITY RELOCATION WITH PROJECTCONSTRUCTION. CONTRACTOR IS SOLEY RESPONSIBLE FOR ALL COSTS AND FEESASSOCIATED WITH UTILITY RELOCATION AND/OR DAMAGE INCURRED DURINGCONSTRUCTION WHETHER OR NOT THE UTILITY IS DEPICTED IN THE PROJECTDRAWINGS. CONTRACTOR WILL NOT BE COMPENSATED FOR ANY COSTSASSOCIATED WITH LOST PRODUCTION DUE TO EXISTING UTILITIES WHETHER OR NOTTHE UTILITY IS DEPICTED IN THE PROJECT DRAWINGS.19. THE CONTRACTOR SHALL COORDINATE THE LOCATION OF ALL PROPOSED FIREHYDRANTS WITH THE CITY OF DELTONA.20. ALL EXISTING WATER SERVICES WILL BE REMOVED, REPLACED, AND RECONNECTEDTO EXISTING CUSTOMERS WATER SERVICES WITH NEW SERVICES INCLUDINGMETERS AND METER BOXES TO FINISHED GRADE. SERVICE METERS SHALL BENEPTUNE T-10. METER BOXES SHALL BE NDS-PRO SERIES, DOUBLE-D1500,SINGLE-D1200, MODEL 125BCDWB OR MODEL 121BCDMCIFB. EXISTING METERSLOCATED WITHIN SIDEWALKS OR DRIVEWAYS SHALL BE RELOCATED OUT OFSIDEWALKS AND DRIVEWAYS. EXISTING METER BOXES SHALL BE REMOVED ANDCONCRETE SHALL BE REPAIRED. (REPLACE 4'X4' SIDEWALK MINIMUM).21. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE (LONG OR SHORT & SINGLE OR DOUBLE) OF ALL EXISTING ANDPROPOSED WATER SERVICES PRIOR TO START OF CONSTRUCTION. CONTRACTORSHALL MEET WITH THE CITY TO DETERMINE QUANTITIES OF ALL EXISTING ANDPROPOSED WATER SERVICES.Sheet Number-- COVERG002G003G004SHEET LIST TABLESheet TitleGENERAL NOTES AND DRAWING INDEXLEGEND AND ABBREVIATIONSKEYPLANC101 PLAN AND PROFILE - STATION 9+00 TO 14+00C102 PLAN AND PROFILE - STATION 14+00 TO 18+00C103 PLAN AND PROFILE - STATION 18+00 TO 22+50C104 PLAN AND PROFILE - STATION 22+50 TO 27+00C105 PLAN AND PROFILE - STATION 27+00 TO 31+50C106 PLAN AND PROFILE - STATION 31+50 TO 36+00C107 PLAN AND PROFILE - STATION 36+00 TO 40+00C108 PLAN AND PROFILE - STATION 40+00 TO 44+00C109C501C502C503C504PACO CT. & ECHO CT. WATER MAINDETAILSDETAILSDETAILSDETAILSDATE ______________CB11. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE HORIZONTAL& VERTICAL LOCATION OF ANY EXISTING UTILITIES OR PIPELINES PRIOR TOCONSTRUCTION. DEPTH DEPICTED IN PROFILE VIEW ARE ASSUMED TO BE 3 FEET.12. HORIZONTAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARYOR STORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST THREE FEET BETWEEN THE OUTSIDE OFTHE WATER MAIN AND THE OUTSIDE OF ANY EXISTING OR PROPOSED STORMSEWER.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS SHALL BE LAID TO PROVIDEA HORIZONTAL DISTANCE OF AT LEAST SIX FEET AND PREFERABLY TEN FEET,BETWEEN THE OUTSIDE OF THE WATER MAIN AND THE OUTSIDE OF ANYEXISTING OR PROPOSED GRAVITY-TYPE SANITARY SEWER, WASTEWATERFORCE MAIN AND RECLAIMED WATER MAIN. THE MINIMUM HORIZONTALSEPARATION DISTANCE BETWEEN WATER MAINS AND GRAVITY-TYPE SANITARYSEWERS SHALL BE REDUCED TO THREE FEET WHERE THE BOTTOM OF THEWATER MAIN IS LAID AT LEAST SIX INCHES ABOVE THE TOP OF THE SEWER.12. VERTICAL SEPARATION BETWEEN UNDERGROUND WATER MAINS AND SANITARY ORSTORM SEWERS AND WASTEWATER FORCE MAINS.A) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED GRAVITY-TYPE SANITARY SEWER OR STORM SEWER SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID SO THE OUTSIDE OF THE WATER MAIN IS AT LEAST SIX INCHES, ANDPREFERABLY 12 INCHES, ABOVE OR AT LEAST 12 INCHES BELOW THE OUTSIDEOF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TO LAY THE WATERMAIN ABOVE THE OTHER PIPELINE.B) NEW OR RELOCATED, UNDERGROUND WATER MAINS CROSSING ANY EXISTINGOR PROPOSED WASTEWATER OR STORMWATER FORCE MAIN SHALL BE AMINIMUM OF ONE FULL LENGTH OF PIPE (20') BE CENTERED AT THE CROSSINGAND LAID TO THE OUTSIDE OF THE WATER MAIN AT LEAST 12 INCHES ABOVE ORBELOW THE OUTSIDE OF THE OTHER PIPELINE. HOWEVER, IT IS PREFERABLE TOLAY THE WATER MAIN ABOVE THE OTHER PIPELINE.C) AT THE UTILITY CROSSINGS DESCRIBED IN PARAGRAPHS (A) AND (B) ABOVE,ONE FULL LENGTH OF WATER MAIN PIPE SHALL BE CENTERED ABOVE OR BELOWTHE OTHER PIPELINE SO THE WATER MAIN JOINTS WILL BE AS FAR AS POSSIBLEFROM THE OTHER PIPELINE. ALTERNATIVELY, AT SUCH CROSSINGS, THE PIPESSHALL BE ARRANGED SO THAT ALL WATER MAIN JOINTS ARE AT LEAST THREEFEET FROM ALL JOINTS IN STORM SEWERS AND AT LEAST SIX FEET FORM ALLJOINTS IN GRAVITY-TYPE SANITARY SEWERS AND WASTEWATER FORCE MAINS.13. A MINIMUM OF ONE TRAFFIC LANE SHALL BE MAINTAINED AT ALL TIMES DURINGINSTALLATION OF PIPELINE ROADWAY CROSSINGS. CONTRACTOR SHALL BERESPONSIBLE FOR MAINTENANCE OF TRAFFIC DURING THE WORK AND FORCOORDINATION WITH THE OWNER, AS NECESSARY.14. CONTRACTOR SHALL BE RESPONSIBLE FOR CONTACTING OTHER UTILITYCOMPANIES AND ARRANGING TO HAVE UTILITY POLES HELD OR RELOCATED IF22. IF FIELD CONDITIONS REQUIRE, THE LOCATION OF PROPOSED MAINS CAN BEADJUSTED WITHIN THE RIGHT OF WAY WITH THE APPROVAL OF THE ENGINEER ANDOWNER. THE DISTANCE FROM THE OUTSIDE EDGE OF THE MAIN AND THE RIGHT OFWAY SHALL BE GREATER THAN OR EQUAL TO 4 FEET.23. IF FIELD CONDITIONS PERMIT, CONTRACTOR SHALL DEFLECT THE PROPOSED MAINSABOVE CROSS PIPE CONFLICTS, i.e. STORM DRAINS AND SEWER LATERALS, INSTEADOF BELOW, UNLESS AN INTERMEDIATE HIGH POINT IS CREATED.24. EACH BACTERIOLOGICAL SAMPLE POINT SHALL BE EQUIPPED WITH A CORPORATIONSTOP, DISCHARGE PIPE, AND ABOVE-GRADE VALVE. FOLLOWING PASSAGE OFBACTERIOLOGICAL TESTING, THE CONTRACTOR SHALL REMOVE THE CORPORATIONSTOP AND PLUG THE CONNECTION.25. CONTRACTOR WATER MAIN CLEARANCE PACKAGES SHALL CONTAIN AS-BUILTDRAWINGS SIGNED AND SEALED BY A LICENSED SURVEYOR, PASSINGBACTERIOLOGICAL TEST REPORTS, AND PRESSURE TEST FORMS SIGNED BY THECITY PROJECT INSPECTOR. SUBMITTALS SHALL INCLUDE FOUR (4) HARDCOPY SETSINCLUDING THE ORIGINAL PASSING BACTERIOLOGICAL SAMPLE REPORTS AND ONE(1) CD CONTAINING ELECTRONIC FILES OF AS-BUILT DRAWINGS IN AUTOCADFORMAT. AS-BUILT DRAWINGS SHALL DEPICT THE INFORMATION REQUIRED IN THECONTRACT DOCUMENTS ALONG WITH THE LOCATIONS OF THE BACTERIOLOGICALSAMPLES LABELED TO CORRESPOND TO THE BACTERIOLOGICAL SAMPLE REPORTS.FAILURE OF THE CONTRACTOR TO PROVIDE THE REQUIRED INFORMATION ORSUBMISSION OF POOR QUALITY AS-BUILT DRAWINGS WILL COUNT AS ANAPPLICATION REVIEW. POOR QUALITY AS-BUILT DRAWINGS WILL BE RETURNED WITHCOMMENTS ONE (1) TIME AND SUBSEQUENT REVIEWS OF POOR QUALITY AS-BUILTDRAWINGS SUBMITTED BY THE CONTRACTOR WILL BE COUNTED AS ONE (1)APPLICATION REVIEW PER INSTANCE AND THE CITY AND ENGINEER WILL DEDUCTREVIEW, HANDLING, AND DIRECT COSTS FROM THE CONTRACTOR'S PROGRESSPAYMENT APPLICATIONS AND/OR PROJECT RETAINAGE. THE PROJECT MANUALAND/OR THE DRAWINGS WILL SPECIFY THE CONTRACTOR'S RESPONSIBILITIES ANDESTIMATED COSTS. PARTIAL SUBMITTALS WILL NOT BE REVIEWED. PARTIALCLEARANCES SHALL BE FOR A STREET IN ITS ENTIRETY INCLUDING BRANCHINGSTREETS AT MINIMUM UNLESS APPROVED IN WRITING BY THE ENGINEER PRIOR TOSUBMITTAL.26. CONTRACTOR SHALL COORDINATE LIMITS OF REMOVAL AND REPLACEMENT OFASPHALT AND CONCRETE WITH CITY OF DELTONA AND THE ENGINEER.27. CONTRACTOR WILL BE REQUIRED TO INSTALL AIR RELEASE VALVES OR FIREHYDRANTS AT NO ADDITIONAL COST TO THE OWNER AT ALL HIGH POINTS CREATEDBY THE CONTRACTORS INSTALLATION AS DETERMINED BY THE ENGINEER AND THECITY OF DELTONA.28. IT IS THE RESPONSIBILITY OF THE CONTRACTOR TO FIELD VERIFY THE LOCATION,QUANTITY AND TYPE OF ALL EXISTING SEWER LATERALS/SERVICES AND RELOCATETHEM AS NECESSARY TO ACCOMMODATE THE PROPOSED PROJECT. RELOCATIONOF SEWER LATERALS/SERVICES 12" BELOW THE PROPOSED WATER MAIN ISPREFERRED.29. CONTRACTOR SHALL RESTRAIN ALL EXISTING UTILITIES AS NEEDED IN ACCORDANCEWITH DETAIL 2 DRAWING C501.30. ALL PROPOSED PIPE AND FITTINGS SHALL BE MECHANICAL JOINT UNLESSOTHERWISE NOTED.31. RESTRAINED JOINTS FOR PVC PIPE SHALL BE MANUFACTURED RESTRAINED JOINTS.MARKWMSERVICEMATERIALPOTABLE WATER PVC DR-18 N/A DI CEMENT DI 250 CEMENT DI CEMENTNOTES:BURIED PIPE BURIED FITTINGS BELOW ROADWAY PIPE BELOW ROADWAY FITTINGSCLASSPIPING MATERIAL SCHEDULELININGMATERIAL1. ALL PIPE LINING, INCLUDING ANY MATERIAL WHICH COMES INTO CONTACT WITH POTABLEWATER SHALL BE NSF (STANDARD 61) APPROVED FOR USE WITH POTABLE WATER.2. BELOW GROUND PIPE SHALL BE "BLUE", COLOR OR STRIPES AS SPECIFIED IN SECTION9905 FOR THE POTABLE WATER MAINS.3. DUCTILE IRON PIPE SHALL BE ENCASED IN POLYETHYLENE TWENTY-FIVE (25) FEET ONEACH SIDE OF ANY PERPENDICULAR CROSSING OF METALLIC GAS MAINS OR ANY OTHERCATHODICALLY PROTECTED PIPELINE AND FOR LOCATIONS PARALLEL TO AND WITHIN TENFEET OF METALLIC GAS MAINS OR OTHER CATHODICALLY PROTECTED PIPE AND THROUGHTHE AREA OF INFLUENCE OF CATHODIC PROTECTION ANODE BED.4. PIPE CLASS SHALL MEET SPECIFICATION 15050.LININGMATERIALCLASS48 HOURS BEFORE DIGGINGLININGMATERIALLININGCITY OF DELTONAA32. ASBESTOS CEMENT (AC), DUCTILE IRON, AND PVC WATERMAIN IN CONFLICT WITHPROPOSED DRAINAGE IMPROVEMENTS (STRUCTURES, PIPES, ETC)SHALL BEREMOVED IN ACCORDANCE WITH SPECIFICATIONS 01100, 02050 AND 02080.CALLTOLL FREE1-800-432-4770Project No.:Designed By:Drawn By:200-08534-13001MBSPDSUNSHINE STATE ONE CALL CENTERChecked By:MADG002Bar Measures 1 inch


1/9/2013 9:24:43 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\G003.DWG- LOPEZ, HERNANNORMANDY BOULEVARDLEGEND ANDABBREVIATIONSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7LIST OF STANDARD ABBREVIATIONSPIPING LEGENDFEDCBAAAAP ALARM ANNUNCIATOR PANELAARV AUTOMATIC AIR RELEASEVALVEAAV AUTOMATIC AIR VENTAB ANCHOR BOLTABAN ABANDON(ED)ABRSV ABRASIVEABS ACRYLONITRILE BUTADIENESTYRENEABV ABOVEAC ALTERNATING CURRENTACCMP ASPHALT-COATEDCORRUGATED METAL PIPEACP ASBESTOS CEMENT PIPEADDM ADDENDUMADH ADHESIVEAFF ABOVE FINISHED FLOORAFG ABOVE FINISHED GRADEAFS ABOVE FINISHED SLABAHD AHEADAL ALUMINUMALT ALTERNATEAMP AMPEREAMT AMOUNTAPRX APPROXIMATE(LY)ARCH ARCHITECT(URAL)ARV AIR RELEASE VALVEAS ALUM SOLUTIONASPH ASPHALTASSY ASSEMBLYAVE AVENUEA/C AIR CONDITIONINGA/VV AIR/VACUUM AIR VALVEBBAF BAFFLEBCV BALL CHECK VALVEBF BLIND FLANGEBFV BUTTERFLY VALVEBHP BRAKE HORSEPOWERBI BLACK IRONBITUM BITUMINOUS OR BITUMASTICB/L BASELINEBLDG BUILDINGBLK BLOCKBM BENCH MARKBOC BACK OF CURBBOT BOTTOMBP BASE PLATEBRG BEARINGBSP BLACK STEEL PIPEBV BALL VALVEBW BOTH WAYSBWW BACKWASH WATERCCAP CAPACITYCA COMPRESSED AIRCAV COMBINATION AIR VALVECB CATCH BASINCCC CHLORINE CONTACT CHAMBERCE CHLORINATED EFFLUENTCFM CUBIC FEET PER MINUTECFS CUBIC FEET PER SECONDCV CHECK VALVECI CAST IRONCIP CAST IRON PIPECISP CAST IRON SOIL PIPECJ CONSTRUCTION JOINTCKT CIRCUITC/L CENTER LINECL2 CHLORINE GASCLF CHAIN LINK FENCECLR CLEAR OR CLEARANCECLVT CULVERTCMP CORRUGATED METAL PIPECMPA CORRUGATED METAL PIPEARCHCMU CONCRETE MASONRY UNITCND CONDUITCNR CORNERCO CLEAN OUTCO2 CARBON DIOXIDECOAG COAGULANTCOL COLUMNCOM COMMONCONC CONCRETECONN CONNECTIONCONSTR CONSTRUCT(ION)CONT CONTINUOUSCONTR CONTRACT(OR)COORD COORDINATECO COMPANYCP CONCRETE PIPECPA CONCRETE PIPE ARCHCPLG COUPLINGCPVC CHLORINATED POLYVINYLCHLORIDECR CONCENTRIC REDUCERCS CHLORINE SOLUTIONCSG CASINGCTV CABLE TELEVISIONCY CUBIC YARDCYL CYLINDERC&G CURB AND GUTTERC/C CENTER TO CENTERDDAT DATUMDBL DOUBLEDC DIRECT CURRENTDEMO DEMOLITIONDEPT DEPARTMENTDESC DESCRIPTIONDET DETAILDF DIESEL FUELDI DUCTILE IRONDIA DIAMETERDIFF DIFFUSERDIM DIMENSIONDIP DUCTILE IRON PIPEDISCH DISCHARGEDIR DIRECTIONDMH DROP MANHOLEDN DOWNDR DRAINDV DIAPHRAGM VALVEDW DRIVEWAYDWG DRAWINGDWV DRAIN, WASTE, AND VENTEE EASTEA EACHECC ECCENTRICEF EACH FACEEFF EFFLUENTE/L EASEMENT LINEEL ELEVATIONELAST ELASTOMERICELEC ELECTRICALEMER EMERGENCYEMC ENCASE(MENT)ENGR ENGINEEREP EDGE OF PAVEMENTEPDM ETHYLENE PROPYLENE DIENEMONOMEREPRF EXPLOSION PROOFEQUIP EQUIPMENTER ECCENTRIC REDUCERESTM EASEMENTEST ESTIMATE(D)EW EACH WAYEXC EXCAVATEEXP EXPANSIONEXST EXISTINGEXST GR EXISTING GRADEEXT EXTERIOREXTN EXTENSIONFFAB FABRICATE(D)FCA FLANGED COUPLING ADAPTERFB FLAT BARFCV FLOW-CONTROL VALVEFD FLOOR DRAINFDN FOUNDATIONFE FILTER(ED) EFFLUENTFHY FIRE HYDRANTFIG FIGUREFIN FINISH(ED)FIN FLR FINISH FLOORFIN GR FINISH GRADEFL FLUORIDEFLG FLANGE(D)FLL FLOW LINEFLTR FILTERFM FORCE MAINFPM FEET PER MINUTEFPS FEET PER SECONDFRP FIBERGLASS REINFORCEDPLASTICFT FOOT OR FEETFUT FUTUREFV FOOT VALVEFW FINISHED WATERFWP FACTORY WIRED PANELF/F FACE TO FACEGGA GAUGEGAL GALLON(S)GALV GALVANIZEDGIP GALVANIZED IRON PIPEGJ GROOVE JOINTGND GROUNDGPD GALLONS PER DAYGPH GALLONS PER HOURGPM GALLONS PER MINUTEGPS GALLONS PER SECONDGR GRADEGRTG GRATINGGS GALVANIZED STEELGSP GALVANIZED STEEL PIPEGSR GROUND STORAGE RESERVOIRGST GROUND STORAGE TANKGT GROUTGV GAS VALVEHHB HOSE BIBBHD HEAVY-DUTYHDPE HIGH-DENSITY POLYETHYLENEHDR HYDRAULICHFA HYDROFLUOSILICIC ACIDHGR HANGERHGT HEIGHTHNDRL HAND RAILHOA HAND-OFF-AUTOHORIZ HORIZONTALHP HORSEPOWERHPA HIGH PRESSURE AIRHR HOURHVAC HEATING, VENTILATION, AND AIRCONDITIONINGHWL HIGH WATER LEVELHWY HIGHWAYHZ HERTZIID INSIDE DIAMETERIN INCH(ES)INF INFLUENTINT INTERSECTIONINTR INTERIORINV INVERTIP IRON PIPEIPS INTERNATIONAL PIPESTANDARDIR INTERNAL RECYCLEIW IRRIGATION WATERJJB JUNCTION BOXJT JOINTKK KIP (1,000 LB)KPL KICK PLATEKV KILOVOLTKVA KILOVOLT-AMPEREKW KILOWATTKWH KILOWATT-HOURLL LEFTLAB LABORATORYLAM LAMINATE OR LAMINATIONLATL LATERALLAVLENLBLFLPLSLSSLVRLWLMMMAINTMANMASMATLMAXMCCMEMECHMEGMFRMGMGDMHMIMINMISCMJMLMOMONMPHMPTMSMSPMTDMVMWMWLMWPNNNaOClNENICNONOMNPFNPTNPWNRSNTSNWN/AOO2OCODODPOFOHOHWOPPOPTOROSYO&MPPAPCPCMPEPGPIPLP/LPNVPOBPOJPOLPPPPDPPMPREFABPRESSPRVPRWPSFPSIPSIAPSIGPTPVPVCPVMTPWPWRQQQTYRRADRASRCRCBRCPRCPARDRDCRREBARREFREINFREMREQ'DRFRJRMRPBPLAVATORYLENGTHPOUND(S)LINEAR FEETLIGHT POLELIME SLURRYLIME STABILIZED SLUDGELOUVERLOW WATER LEVELMETERMAINTAIN OR MAINTENANCEMANUAL(LY)MASONRYMATERIALMAXIMUMMOTOR CONTROL CENTERMITERED ENDMECHANICALMATCH EXISTING GRADEMANUFACTURE(R)MILLION GALLONSMILLION GALLONS PER DAYMANHOLEMILE(S)MINIMUM, MINUTE(S)MISCELLANEOUSMECHANICAL JOINTMIXED LIQUORMASONRY OPENINGMONUMENTMILES PER HOURMALE PIPE THREADMOTOR STARTERMOTOR STARTER PANELMOUNTEDMOTORIZED VALVEMANWAYMEAN WATER LEVELMAXIMUM WORKING PRESSURENORTHSODIUM HYPOCHLORITENORTHEASTNOT IN CONTRACTNUMBERNOMINALNATIONAL PIPE THREADNATIONAL PIPE TAPER(THREAD)NON-POTABLE WATERNON-RISING SYSTEMNOT TO SCALENORTHWESTNOT APPLICABLEOXYGENON CENTEROUTSIDE DIAMETEROPEN DRIP PROOFOUTSIDE FACEOVER HEADOVER HEAD WIREOPPOSITEOPTIONALOFFICIAL RECORDSOUTSIDE SCREW AND YOKEOPERATION AND MAINTENANCEPROCESS AIRPOINT OF CURVEPERMANENT CONTROLMONUMENTPLAIN ENDPRESSURE GAGEPOINT OF INTERSECTIONPLATEPROPERTY LINEPINCH VALVEPOINT OF BEGINNINGPUSH-ON JOINTPOLYMERPOWER POLEPOUNDS PER DAYPARTS PER MILLIONPREFABRICATEDPRESSUREPRESSURE REDUCING VALVEPROCESS WATERPOUNDS PER SQUARE FOOTPOUNDS PER SQUARE INCHPOUNDS PER SQUARE INCHABSOLUTEPOUNDS PER SQUARE INCHGAGEPOINT OF TANGENCYPLUG VALVEPOLYVINYL CHLORIDEPAVEMENTPOTABLE WATERPOWERFLOWQUANTITYRADIUSRETURN ACTIVATED SLUDGEREINFORCED CONCRETEREINFORCED CONCRETE BOXREINFORCED CONCRETE PIPEREINFORCED CONCRETE PIPEARCHROADREDUCERREINFORCING STEELREFERENCEREINFORCE(D)(ING)(MENT)REMOVE(ABLE)REQUIREDRAISED FACERESTRAINED JOINTROOMREDUCED PRESSUREBACKFLOW PREVENTERRPMRRRTRVTRWRWWR/WSSSASANSCHEDSDSESECTSEFFSFSHTSIGSIMSLSLVSMSOLNSPSPECSPRTSQSSSSESSTSTSTASTDSTKSTLSTRSTRUCTSURFSVSVCESVWSWSWDSWSHSYMSYMMS/WTTANTBTBMTB-xxTDTDHTETEFCTELTENVTHDTHKTLMTOBTOCTOSTOTTPTSTVTYPT&BUUDUGULTUNUONUGEUTCUTILVVVACVARVCVCPVELVERTVFDVOLWWWASWCOWFWHWLWMWPWPRWSWSPWTWTPWWWWFWWMWWTPREVOLUTIONS PER MINUTERAILROADRIGHTRIVETEDRAW WATERRAW WASTEWATERRIGHT-OF-WAYSOUTHSAMPLE LINESANITARYSCHEDULESTORM DRAINSOUTHEASTSECTIONSECONDARY EFFLUENTSQUARE FOOT OR FEETSHEET(ED)(ING)SIGNALSIMILARSLUDGESLEEVESHEET METALSOLUTIONSOIL PIPE, SPACE(ING)SPECIFICATIONSUPPORTSQUARESANITARY SEWERSUBSTANDARD EFFLUENTSTAINLESS STEELSTREETSTATIONSTANDARDSTAKESTEELSTRAIGHTSTRUCTURALSURFACESOLENOID VALVESERVICESERVICE WATERSOUTHWESTSIDEWATER DEPTHSURFACE WASHSYMBOLSYMMETRICALSIDEWALKTANGENTTOP OF BEAMTEMPORARY BENCH MARKTEST BORING-xx (e.g. TB-1)TRENCH DRAINTOTAL DYNAMIC HEADTOTALLY ENCLOSEDTOTALLY ENCLOSED FANCOOLEDTELEPHONETOTALLY ENCLOSEDNON-VENTILATEDTHREAD(ED)THICK(NESS)TELEMETRYTOP OF BANKTOP OF CURBTOE OF SLOPETOTALTELEPHONE POLETHICKENED SLUDGETELEVISIONTYPICALTOP AND BOTTOMUNDERDRAINUNDERGROUNDULTIMATEUNIONUNLESS OTHERWISE NOTEDUNDERGROUND ELECTRICUNDERGROUND TELEPHONECABLEUTILITYVOLT(S)VACUUMVARIESVERTICAL CURVEVITRIFIED CLAY PIPEVELOCITYVERTICALVARIABLE FREQUENCY DRIVEVOLUMEWATT, WESTWASTE ACTIVATED SLUDGEWALL CLEAN OUTWIDE FLANGEWALL HYDRANTWATER LINEWATER MAINWATER PROOF(ING), WORKINGPOINTWORKING PRESSUREWATER SURFACEWELDED STEEL PIPEWEIGHTWATER TREATMENT PLANTWASH WATERWELDED WIRE FABRICWELDED WIRE MESHWASTEWATER TREATMENTPLANTW/ WITHW/O WITHOUTXXFERYYDYHYRTRANSFERYARD(S)YARD HYDRANTYEAR(S) YRFITTING/APPURTENANCEBENDTEEWYEREDUCERCAP/BLIND FLANGEPLUGBUTTERFLYVALVEBALL VALVECHECK VALVEGATE VALVEPLUG VALVEAUTOMATICCONTROL VALVECIVIL LEGENDa.b.c.d.PINCH VALVEBASELINEPROPERTY LINERIGHT OF WAYEASEMENT LINEBENCH MARKCONTROL ELEVATIONMONUMENTEXISTINGEXISTING SPOT ELEVATIONFINISH SPOT ELEVATIONEXISTING CONTOURFINISH CONTOUREMBANKMENTSURFACE DRAINAGEFENCEMISCELLANEOUS UTILITYWMFMSSSDe. GAS =f.ELPJURISDICTIONAL WETLANDBOUNDARY LINECTVPGPSINGLE-LINETEMPORARY CONSTRUCTION EASEMENTTOP OF BANKEDGE OF WATERSILT FENCINGBURIED TELEPHONEBURIED FIBER OPTICOVERHEAD ELECTRICTREESFH=====WATER MAINFORCE MAINSANITARY SEWERSTORM DRAINNATURAL GASCABLE TELEVISIONELECTRIC BOXFIRE HYDRANTPOWER POLEGUY POLELIGHT POLEMBTPROPOSEDFLANGEDEXISTINGDOUBLE-LINEPROPOSEDEXISTINGN/ASINGLE-LINEMECHANICAL JOINTPROPOSEDN/AEXISTINGN/AN/A N/A N/A N/AN/A N/A N/A N/A N/A N/A N/A N/Ag.h.i.UEC =UED =UTC=j. UTD =DECIDUOUSEVERGREENELXXELTOPLPBOTTOMSTA XXPALMR/WLEELELUNDERGROUND ELECTRIC CABLE OR CONDUITUNDERGROUND ELECTRIC DUCTUNDERGROUND TELEPHONE CABLE OR CONDUITUNDERGROUND TELEPHONE DUCTk. FOC = FIBER OPTIC CABLEGUY ANCHORMAIL BOXMANHOLESIGN/LOCATOR POLESPRINKLER HEADTELEPHONE RISERTWMTSGVELTCEXXl. UGT = UNDERGROUND TELEPHONETYPETOBEOWELTYPE TYPE TYPETYPECITRUSOAKTELEPHONE MANHOLEMONITOR WELLWATER METERWATER VALVEGAS VALVETRAFFIC SIGNAL CONTROL BOXN/AN/AN/AN/AN/AN/AN/AN/AN/AREFERENCE SYMBOLSXX-XXHATCHING LEGENDDOUBLE-LINEDENOTES SECTIONLETTER IDENTIFICATIONDENOTES DRAWING NOWHERE SECTION IS LOCATEDSECTION REFERENCEX_PROPOSEDN/AN/AN/AN/ADENOTES SECTIONLETTER IDENTIFICATIONSECTIONSCALE:DENOTES DRAWING NOWHERE SECTION IS LOCATEDSECTION TITLEEXISTINGSINGLE-LINEGROOVE JOINTPROPOSEDEXISTINGDOUBLE-LINEPROPOSEDN/A N/A N/A N/A N/A N/A N/A N/AASPHALT OR CONCRETE SURFACE(SIDEWALK OR ROADWAY)ROADWAY/SIDEWALKOPEN CUT RESURFACESODDED OR SEEDED ANDMULCHED AREAEARTHEXISTING PIPES, STRUCTURES,EQUIPMENT TO BE REMOVEDCAST-IN-PLACE CONCRETEDELINEATED WETLANDPRECASTCONCRETEGROUTCONCRETE UNITMASONRYSTEELALUMINUMGRATINGEXISTINGDENOTES DRAWING NOWHERE DETAIL IS LOCATEDX_DENOTES DRAWING NOWHERE DETAIL IS LOCATEDSINGLE-LINEXX-XXDETAIL REFERENCEDETAILSCALE:DETAIL TITLESOLVENT WELDPROPOSEDMECHANICAL/DRAFTING LEGENDVISIBLE LINEHIDDEN LINECENTER LINELONG BREAK LINESHORT BREAK LINEDIMENSION LINES AND LEADERSPHANTOM LINEEXISTINGDENOTES DETAIL NUMBERIDENTIFICATIONDENOTES DETAIL NUMBERIDENTIFICATIONEXISTINGDOUBLE-LINEPROPOSEDPROPOSEDCITY OF DELTONADATE ______________Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADG003Bar Measures 1 inch


1/9/2013 9:17:02 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\COVER & G004 KEYPLAN.DWG - LOPEZ, HERNANMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429www.tetratech.comKEYPLAN________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FNEC108FT. SMITH BLVD.DC109C107C106CC109C104 C105SAXON BLVD.C101 C102C103BNORMANDY BLVD.CITY OF DELTONADATE ______________AProject No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMADG004Bar Measures 1 inch


1/10/2013 10:12:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4' MIN.(TYP)3' MIN.(TYP)3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 9+00 TO 14+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDR/W4C502STA:13+52.67, 56.02'LDIRECT CONNECT TO6" GATE VALVE, 6" 45° BEND4 1C502 C504EXISTING 12" WMBACT. SAMPLE LOCATIONNOTE:C502 C504 (2) 12" 45° BENDSDROP INLET12" GATE VALVESTA:9+45.25, 37.61'LTOP 54.321. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR8 BACT. SAMPLE LOCATION6" TEE, (2) 6" 45° BENDS (DEFLECT PIPE UP)(2) 6" 45° BENDS (DEFLECT PIPE DOWN)STABILIZATION/BRACING OF EXISTING LIGHT POLE TO INSTALL WATER MAINSTA:13+48.73, 34.15'L4C5021C504R/W R/W6''W 6''W2C502STA:9+34.22, 31.32'LDIRECT CONNECT TOEXISTING 6" WM. (2) 6" 45°BENDS, 6" GATE VALVEBACT. SAMPLE LOCATION1C5049 + 0041WVDROP INLETTOP 55.13WV6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEPROPOSED 6" DIWATER MAIN TO BEINSTALLED AT DEPTHSUFFICIENT TO BEBELOW EXST 6" WMDROP INLETTOP 54.20SDR/WSD SDWATER545457DROP INLETTOP 53.68R/W R/W R/W R/W R/W R/W R/WSTA:9+44.14, 25.53'R16"x6" TEE, 16" CAP AND16" GATE VALVEFH ASSEMBLYBACT. SAMPLE LOCATIONSTA:9+60.09, 25.68'R(2) 16" 45° BENDSSTA:9+80.88, 55.76'LDIRECT CONNECT TO EXIST4" WM. 6"x4" REDUCER6''WEXISTING36" RCP16''WR/WR/W6''WWV30.00' EXISTINGDRAINAGE EASEMENT4''W 4''WQUINCY AVE.STA:9+74.32, 44.96'LFH ASSEMBLY6''WSTA:9+69.88, 37.79'L(2) 6" 45° BENDS(ROTATE AS REQUIRED)10 + 004" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE2C502PRC: 10+00.00STA:9+86.24, 25.41'R(2) 16" 45° BENDSR/WR/WINLET TYPE P-1TOP 55.09S INV. 50.5016''W 16''W2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2718" PIPER/W R/W11+00555516''W8''W56MITERED END SECTIONNS INV. 50.00PROPOSED 16"PVC WATER MAINSTA:10+79.65, 35.00'R(2) 16" 45° BENDS8" VALVE2-1/2' DEEP555555R/WWATERELECR/W R/W R/W8''W 8''WNORMANDY BLVD.16''WSTA:11+63.26, 33.97'R(2) 16" 45° BENDS2C5045C501PROPOSED SHORTWATER SERVICE (TYP)REMOVE AND REPLACEEXISTING DRIVEWAY(TYPICAL)EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W12 + 00PROPOSED LONGWATER SERVICE (TYP)16''W8''WR/W R/W R/WSTA:12+00.01, 33.97'R(2) 16" 45° BENDS2C5042C502R/WREMOVE AND REPLACEEXISTING SIDEWALK3C501STA:13+00.00, 34.01'RFH ASSEMBLY(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM4C502EXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/WR/W12''W12''WWATER12''WR/W8''W57SAXON BLVD.13+00 +PT: 13+04.03WV12''W 12''W16''W 16''WSTA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)1C504SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACESTA:13+50.76, 59.03'RDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONWVEXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACE12''WOPEN CUT6C50116''WWATERWATER5514 00STA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSS0MATCHLINE STA: 14+00.008''WR/WEXISTING 8" AC WM4' DEEP10 20 40TELNSCALE: 1" = 20'R/WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866647068666462CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)62B60585654525048464442FHASSEMBLY16" CAP, 16"GATE VALVE,FH ASSEMBLY16"X6"TEEEXIST. 36" RCPINV. 47.76QUINCY AVE.S-101FL 50.70(+) 0.309%12" MIN.(TYP)18" PIPE(FUTURE, SEE ROADWAYENGINEER PLANS) INV. ±50.40FL 50.50S-10418" PIPEFL 50.80(2) 16" 45°BENDSPROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(2) 16" 45°BENDS(2) 16" 45°BENDSEXISTING GRADEABOVE PROPOSED PIPE(+) 0.309% (-) 0.321%FHASSEMBLY16" 45° BENDS(ROTATE AS REQUIRED)16"x12"CROSSPROPOSED16" DI WMSAXON BLVD.EXISTING12" WM60585654525048464442CITY OF DELTONA40(2) 16" 45°BENDS(2) 16" 45° BENDS4038383636A34323432Project No.:Designed By:Drawn By:200-08534-13001MBSPD10 309+003010+00 11+00 12+00 13+00 14+00Checked By:MADC101Bar Measures 1 inch


1/9/2013 2:36:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN543' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 14+00 TO 18+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7R/W25R/WNFEDSTA:13+52.67, 56.02'LDIRECT CONNECT TOEXISTING 12" WM(2) 12" 45° BENDS12" GATE VALVEBACT. SAMPLE LOCATIONSTA:13+48.73, 34.15'L(2) 12" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM4' DEEPR/WR/WPROPOSED 12"DI WATER MAINR/W12''W12''WWATER13+00 +16''WPT: 13+04.03STA:13+35.73, 34.00'R16" 45° BEND(ROTATE AS REQUIRED)SEE NOTE 112" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEWV12''W 12''WR/W16''W12''WWV8''WSAXON BLVD.EXISTING 12" AC WM4' DEEP12" CAPBEGIN/END GROUT FILLEXISTING 12" WM TO BEGROUT FILLED ANDABANDON IN PLACEOPEN CUT6C501MATCHLINE STA: 14+00.00WATER55R/W8''W 8''WTELVERTICAL BENCHMARK 007CODN 1654429.94E 584739.67ELEV 55.39R/W R/W R/W14 00 +16''WSTA:13+48.73, 45.00'R16" 45° BEND(ROTATE AS REQUIRED)16"x12" CROSSR/WEXISTING 8" AC WM4' DEEPARVR/WPC: 14+54.035315 008''W 8''W16''W 16''W 16''WSTA:14+22.78, 35.00'RARV ASSEMBLY(2) 16" 45° BEND7C501UTILITYCONFLICTR/W R/W R/W4C504WV5252EXISTING 8" AC WM4-1/2' DEEPSTA:15+00.00, 35.00'R416" GATE VALVENOTE:R/W5151NORMANDY BLVD.16 + 00REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTC50216''W50R/W R/W R/W8''W 8''W 8''WR/W R/WPROPOSED 16" PVCWATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 274949484816''W 16''W17 + 00R/W R/W R/W R/W48R/W R/W R/W R/W R/WSTA:16+65.14, 35.00'RFH ASSEMBLYPROPOSED LONGWATER SERVICE (TYP)2C5022C50447464645458''W 8''W 8''WPRC: 17+58.0516''W 16''W18 + 00MATCHLINE STA: 18+00.00010 20 40SCALE: 1" = 20'494916''WDATE ______________R/WSTA:13+50.76, 59.03'RDIRECT CONNECT TO12''W70687068SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C66646266646260585654(-) 1.417%(2) 16" 45°BENDS(-) 2.697%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINE6058565452FOC5250FOC18" PIPES-20350B484644424038ARVPROPOSED16" DI WM16" GATEVALVEPROPOSED16" PVC WMS-201FL 44.30(-) 2.697%FOCFHASSEMBLY(+) 0.599%18" PIPE18" PIPEFL 43.4018" PIPE484644424038CITY OF DELTONA3634EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA3634A3232303014+00 15+00 16+00 17+00 18+00Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMADC102Bar Measures 1 inch


1/9/2013 2:43:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANWATER WATER3' MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 18+00 TO 22+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra TechFE481R/W R/W R/W R/W47464645458''W 8''W 8''WPRC: 17+58.0516''W18 + 00R/W R/W R/WMATCHLINE STA: 18+00.00492 3 4 5 6 74916''WWATER5050515216''W535324R/W R/W R/W8''W 8''W19 + 004949NOTE:R/W R/W R/W4949231. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2716''WPROPOSED LONGWATER SERVICE (TYP)16''W8''W2C50420 + 00R/W R/W R/WNORMANDY BLVD.R/W8''W 8''WREMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)WATER16''W 16''WINLET TYPE P-1TOP 49.75NE INV. 42.4021+00R/W R/W R/W16''W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE50R/W8''W24" PIPE2C502EXISTING 4" AC WM3-1/2' DEEP51525354R/W16''W4''W22+00WV4748PACO CT.MANHOLE P-7TOP 50.03SW INV. 42.204950FOUND ND LB1221R/W R/W R/W51TEL5253STA:22+69.50, 40.95'LFOUND IR 1/2 LB5383ARV ASSEMBLYBACT. SAMPLE LOCATION54R/W8''W 8''W16''W6''WARV6''WPROPOSED 6"PVC WATER MAINSEE SHT. C109 FOR PACO CT. WATER MAINSTA:22+00.00, 34.66'RFH ASSEMBLY0MATCHLINE STA: 22+50.00NSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM10 20 40SCALE: 1" = 20'WVPROPOSED 6"DI WATER MAIN16''WOPEN CUTR/WWATERWATER23+00WATERSTA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEDATE ______________D2C504PROPOSED SHORTWATER SERVICE (TYP)STA:21+69.13, 34.55'R(2) 16" 45° BENDSSTA:21+93.30, 34.55'R(2) 16" 45° BENDSSCALE:HORIZ. 1"= 20'VERT. 1" = 5'C706866646260706866646260B585654525048464442403818" PIPEFL 43.10S-20518" PIPEFL 44.40FL 42.60PROPOSED GRADEAT ROAD CENTERLINEPROPOSED GRADE ATPIPE CENTERLINES-20718" PIPEFL 45.4024" PIPE 24" PIPEPROPOSED16" PVC WMFL 42.40EXISTING GRADEABOVE PROPOSED PIPE(4) 16" 45°BENDSFHASSEMBLYPACO CT.(+) 0.599% (-) 1.000%S-209A50.495856545250484644424038CITY OF DELTONAA363432EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA363432Project No.:Designed By:Drawn By:200-08534-13001MBSPD3018+00 19+00 20+00 21+00 22+0030Checked By:MADC103Bar Measures 1 inch


1/10/2013 10:24:18 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN4''W6''W3' MIN.(TYP)4646MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 22+50 TO 27+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 74545F4''W42434445456''WWATERWATERBlock 381NOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 272C504STA:26+04.54, 130.00'LARV ASSEMBLYBACT. SAMPLE LOCATION1C504PROPOSED LONG DOUBLEWATER SERVICE (TYP)4C504R/WWMARVWV STUBPROPOSED LONG DOUBLEWATER SERVICE (TYP)2C5044748R/WWMWATER0N10 20 40SCALE: 1" = 20'4''W 4''WR/W R/W46462C504PROPOSED SHORT SINGLEWATER SERVICE (TYP)EXISTING 4" AC WM3-1/2' DEEPR/WEDCSEE SHT. C109 FOR PACO CT. WATER MAINEXISTING 4" AC WM3-1/2' DEEP22 + 00R/W4''WWV51525016''W5316''W54PACO CT.R/W R/W R/W494847TEL6''WWATERR/W12R/W R/W8''W 8''W 8''W 8''W6''WWVARV23 + 00R/W R/W5049494545464724 + 004848WATER11R/W R/W R/W R/WNORMANDY BLVD.8''W 8''W 8''WMANHOLE P-7TOP 50.03PROPOSED 6"SW INV. 42.20 DI WATER MAININLET TYPE P-1TOP 46.996OPEN CUTNE INV. 41.80MATCHLINE STA: 22+50.00STA:22+71.08, 35.00'R16"x6" TEE6" GATE VALVEPROPOSED 6"PVC WATER MAINSTA:22+69.50, 40.95'LARV ASSEMBLYBACT. SAMPLE LOCATIONSTA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMC50116''W4C5041C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACT16''W16''WPT: 24+39.5416''W48R/W R/W R/W R/W R/W R/W R/W R/W R/W2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PROPOSED 16"PVC WATER MAINSTA:25+12.75, 28.65'R16" 11.25° BENDPROPOSED SHORTWATER SERVICE (TYP)PROPOSED 4"PVC WATER MAINSTA:25+94.69, 39.63'L(2) 4" 45° BENDS(ROTATE AS REQUIRED)STA:25+94.46, 22.47'L(2) 4" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 8" AC WM3-1/2' DEEPR/W4''W4''W 4''W478''W 8''W 8''W25 + 00 26 + 00 +16''W 16''WSTA:25+70.36, 35.00'R16" 11.25° BENDSTA:25+97.01, 32.69'R16"x4" TEE16" GATE VALVE4" GATE VALVEWVWV16''WWVOPEN CUTPROPOSED 4"DI WATER MAINSTA:26+35.49, 29.35'R16" 11.25° BEND6C5014" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.16''W24" PIPESTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501TELTELMATCHLINE STA: 27+00.0027 0016''W47R/W4747504846464949R/W16''WDATE ______________64626462SCALE:HORIZ. 1"= 20'VERT. 1" = 5'606058585656B5452504846444224" PIPE24" PIPES-20918" PIPEFL 44.60PROPOSED GRADEAT ROAD CENTERLINE24" PIPE(-) 1.000%EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINES-21118" PIPECLAY CT.54525048464442CITY OF DELTONAA4038363432FL 42.2016"X6" TEE6" GATE VALVEFL 42.10PROPOSED 16"PVC WATER MAINEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA16" 11.25°BEND(-) 0.600%16" 11.25°BENDFL 41.8016"X4" TEE16" GATE VALVE4" GATE VALVEFL 42.6016" 11.25°BENDFHASSEMBLY4038363432Project No.:Designed By:Drawn By:Checked By:200-08534-13001MBSPDMAD303023+00 24+00 25+00 26+00 27+00C104Bar Measures 1 inch


1/10/2013 10:32:54 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 27+00 TO 31+50www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FED16''WBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACECLAY CT.24" PIPEFOUND ND BLACKBURNLB1221TEL TEL47R/WR/W4747504646484949WATERWATERR/W R/W R/W R/W R/W R/W8''W 8''W 8''W 8''W 8''W 8''W47474646R/W R/W R/W R/W R/W R/W R/W R/W R/WSTA:26+50.00, 30.95'RFH ASSEMBLYUTILITYCROSSING2C5027C501MATCHLINE STA: 27+00.0027 + 00 28 + 00 +16''WNOTE:REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTPROPOSED 16"PVC WATER MAIN4545NORMANDY BLVD.16''W 16''W 16''W 16''W 16''WSTA:28+58.90, 35.00'R(2) 16" 45° BENDS7C5012C502UTILITYCROSSING1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 2724" PIPESTA:28+95.00, 35.00'RFH ASSEMBLYSTA:28+81.00, 35.00'R(2) 16" 45° BENDSINLET TYPE P-1TOP 44.64SW INV. 39.904444WATER29 00 +STA:29+64.54, 35.00'R16" 11.25° BEND2C504EXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)PC: 29+64.54PROPOSED SHORTWATER SERVICE (TYP)WATERWATERWATER WATERGAS43R/W R/W R/W8''W 8''W 8''W30 00PROPOSED LONGWATER SERVICE (TYP)16''W2C504STA:29+90.57, 30.02'R16" 11.25° BEND16''WGASR/W R/W R/WSTA:30+62.93, 35.00'R16" 11.25° BEND4C5021C5044231+00EXISTING 6" AC WM3' DEEP8" CAPBEGIN/END GROUT FILLEXISTING 8" WM TO BEGROUT FILLED ANDABANDON IN PLACER/W41WATERR/W R/W8''WWV8''W16''W 16''WSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMPROPOSED8" PVC WMSTA:31+36.94, 57.73'RDIRECT CONNECT TOEXISTING 8" WM(2) 8" 45° BENDS(ROTATE AS REQUIRED)8" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 16"DI WATER MAIN8''W0MATCHLINE STA: 31+50.00E. LEHIGHDR.N10 20 40SCALE: 1" = 20'OPENCUT6C50116''WR/W32+00R/W4141NOTE:DATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'6060C585856565452504846(-) 0.600%FHASSEMBLY(-) 1.499%S-21318" PIPEPROPOSED GRADE ATPIPE CENTERLINEPROPOSED GRADEAT ROAD CENTERLINEEXISTING GRADEABOVE PROPOSED PIPE5452504846444224" PIPE18" PIPEFL 40.30S-213S-21518" PIPEE. LEHIGHDR.4442B40383634323028FL 39.90FL 39.00FL 40.30FL 39.00(4) 16" 45°BENDS24" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED 16"PVC WATER MAIN16" 11.25°BEND16" 11.25°BENDFL 37.2016" 11.25°BENDFL 37.60FL 34.00(2) 16" 45°BENDS16"X8"TEE12" MIN.(TYP)30" PIPE40383634323028CITY OF DELTONA26PROPOSED16" DI WM26A24222422Project No.:Designed By:Drawn By:200-08534-13001MBSPD2027+00 28+00 29+00 30+00 31+002018Checked By:MADC105Bar Measures 1 inch


1/9/2013 3:06:43 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.(TYP)12" MIN.COVER12" MIN.(TYP)MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 31+50 TO 36+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FOUND NDR/W R/W R/W31+00R/WR/WWV8''W8''W16''W41E. LEHIGHDR.8''WR/WWATERR/W16''W414132 + 00R/W R/W R/W406''W 6''W 6''W3916''W 16''WR/W R/W R/W3933 + 00R/WBENCHMARK IR #2N 1655767.23E 586032.23ELEV 36.793816''WR/WWATER37WATERWATERWATERWATERR/W R/W6''W363634 + 00353534R/W R/W R/W R/W6''W 6''WNORMANDY BLVD.16''W 16''WR/W R/W R/W33333335+00R/W R/W R/WR/W6''W16''W 16''WPRC: 35+46.80326''W16''W36+0033R/WR/W16''WWV6''W 6''W6" PVC WMNFEDSTA:31+30.88, 35.49'R16"x8" TEE(2) 16" 45° BENDSTO DEFLECT UNDEREXISTING 8" WMEXISTING 6" AC WM3' DEEPMATCHLINE STA: 31+50.00OPENCUTNOTE:6C501STA:31+81.68, 38.44'R16" 11.25° BENDPROPOSED 16"DI WATER MAIN2C502STA:32+87.57, 35.00'RFH ASSEMBLY1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAINPROPOSED 16"PVC WATER MAIN2. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27STA:33+57.10, 34.95'R(2) 16" 45° BENDSPROPOSED LONGWATER SERVICE (TYP)2C504PROPOSED SHORTWATER SERVICE (TYP)2C504REMOVE AND REPLACE EXISTINGDRIVEWAY (TYPICAL) IN ACCORDANCEWITH ROADWAY CONTRACTEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)CONTRACTOR TO RESTABLISHSLOPES AND RIPRAP TO ORIGINALCONDITIONS OR BETTERENDWALLW INV. 27.5053"x34" ERCPSTA:35+43.11, 31.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)ENDWALLE INV. 28.60MITERED END SECTIONW INV. 22.50INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.1030" PIPESTA:35+99.05, 38.08'R16" 22.5° BENDSEENOTE 118" PIPESTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDER0 10 20 40EXISTING 6" WMBACT. SAMPLESCALE: LOCATION 1" = 20'MATCHLINE STA: 36+00.001C50418" PIPEWVR/WSTA:36+11.35, 34.88'R16" 22.5° BENDDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'52525050C48CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 2 THIS SHEET)484644EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADE ATPIPE CENTERLINE464442E. LEHIGHDR.S-217APROPOSED GRADEAT ROAD CENTERLINE4240S-21740(-) 1.499%(-) 3.552%(-) 3.552% (+) 3.350%B383634323028262422FL 33.90PROPOSED16" DI WM16" 11.25°BEND30" PIPEFL 32.0039.33PROPOSED16" PVC WM38.9438.4737.93FH ASSEMBLY18" PIPEFL 32.10FL 31.2037.31FL 29.5016" 45°BENDS30" PIPEEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA30" PIPEFL 27.90S-21934" X 53" PIPEFL 24.20FL 28.0530" PIPE(2) 16" 45° BENDS(ROTATE AS REQUIRED)S-221S-220FL 28.2012" MIN.(TYP)30" PIPEFL 24.10 , S-220FL 24.00, S-221383634323028262422CITY OF DELTONA2018PROPOSED16" PVC WM30" PIPEINV. ±23.6016" 22.5°BEND2018A16161414121210109+00 32+00 33+00 34+00 35+00 36+00Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC106Bar Measures 1 inch


1/10/2013 10:38:20 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNAN3' MIN.6''WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 36+00 TO 40+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEDPRC: 35+46.8016''WR/W R/W6''W 6''W32INLET TYPE P-2TOP 32.48N INV. 28.20E INV. 24.10SEENOTE 16" PVC WMR/W R/W36+0016''W336''W 6''WFOUND ND35ECHO CT.FOUND IP 1SEE SHT. C109 FOR ECHO CT. WATER MAINSTA:36+44.00, 40.61'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 6" WMBACT. SAMPLELOCATION30" PIPE1C504MATCHLINE STA: 36+00.0018" PIPE3418" PIPER/WWV16''W3434WV4''WWVPROPOSED 6"DI WATER MAINOPENCUT6C501FOUND ND LB1221R/WSTA:36+11.35, 34.88'R16" 22.5° BENDR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE6''WEXISTING 4" AC WM44" DEEP4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACE3537+0016''WR/WR/WR/W3636INLET TYPE P-2TOP 34.75S INV. 30.406''W16''WR/WNOTE:1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALLINTERMEDIATE HIGH POINTS ARE THE CONTRACTORS RESPONSIBILITY TO INSTALLARV. SEE SHEET G002 GENERAL NOTE 273738 + 0016''WR/WR/W38R/W39R/WNORMANDY BLVD.PROPOSED 16"PVC WATER MAINEXISTING WM NOT SURVEYED(LOCATION TO BE FIELDVERIFIED BY CONTRACTOR)16''W6''W4040R/WR/WPROPOSED LONGWATER SERVICE (TYP)39 + 0016''W2C502EXISTING SURVEYEDWATER MAIN2C50441R/W6''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY4C504WATER4216''WR/WSTA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYR/W44ARV4343R/W40 + 0016''WR/WMATCHLINE STA: 40+00.00R/W4PT: 40+41.4216''WR/WR/W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACEUTILITYCROSSINGR/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDS0EXISTING 6" AC WM3-1/2' DEEPSEE NOTE 1N10 20 40SCALE: 1" = 20'7C50116''WMARYSVILLE DR.4241 + 00WATERDATE ______________STA:35+99.05, 38.08'R16" 22.5° BENDSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C605856546058565452CONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)525048EXISTING GRADEABOVE PROPOSED PIPE50484644PROPOSED GRADE ATPIPE CENTERLINE4644BA424038363432302826242216" 22.5°BEND16" 22.5°BEND18" PIPECLAY CT.16"X6" TEE16" GATE VALVE6" GATE VALVES-22418" PIPEFL 30.40PROPOSED GRADEAT ROAD CENTERLINEPROPOSED16" PVC WM(+) 3.350%EXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSA202036+00 37+00 38+00 39+00 40+001818FHASSEMBLYARV4240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC107Bar Measures 1 inch


1/9/2013 3:21:12 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C101-C108.DWG - LOPEZ, HERNANR/WPT: 40+41.423' MIN.16''WSEE *3' MIN.MARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PLAN AND PROFILESTATION 40+00 TO 44+00www.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7FEXISTING SURVEYEDWATER MAINR/WR/WR/WR/WMARYSVILLE DR.EXISTING 6" AC WM3-1/2' DEEP6''WWVR/W16''WR/WSTA:40+90.12, 47.09'LDIRECT CONNECT TO4EXISTING 6" WM6" 45° BENDC5026" GATE VALVEBACT. SAMPLE LOCATIONPROPOSED 6" PVCWATER MAIN1C50412C504PROPOSED 16"PVC WATER MAINWATERWATER28STA:42+98.38, 36.80'LCONNECT TOEXISTING 12" WM16"x12" REDUCER12" GATE VALVEBAC. SAMPLE LOCATIONR/W R/W R/W R/W WV R/W16''W 16''W 16''W4C5021C504PROPOSED SHORTWATER SERVICE (TYP)2C504FHR/WR/WWATER4''WMONTEREYDR.N0 10 20 40SCALE: 1" = 20'WATERED16''WR/WSTA:39+60.03, 34.78'RFH ASSEMBLY STA:40+00, 35.00'RARV ASSEMBLYCONTRACTOR TO MATCHPROPOSED GRADE FORTOP OF ASSEMBLYC50443MATCHLINE STA: 40+00.0040+0044ARV43R/W16''W6" CAPBEGIN/END GROUT FILLEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE16''WUTILITYCROSSINGSEE NOTE 1424141NORMANDY BLVD.OPENCUTWATERWATERR/W R/W R/W R/W R/W R/W R/WSTA:40+37.94, 34.99'R(2) 16" 45° BENDSSTA:40+89.92, 29.00'R(2) 16" 45° BENDS(ROTATE AS REQUIRED)7C501NOTE:STA:41+00.56, 34.64'L16"x6" TEE(2) 16" 45° BENDS(ROTATE AS REQUIRED)6" CAPEXISTING SURVEYEDBEGIN/END GROUT FILLWATER MAINEXISTING 6" WM TO BEGROUT FILLED ANDABANDON IN PLACE41+00 42 + 00 43 + 00 44 +6C501PROPOSED 16"DI WATER MAINPROPOSED LONGWATER SERVICE (TYP)1. CONTRACTOR TO COORDINATE WITH THE LOCAL POWER COMPANY FOR STABILIZATION/BRACING OFEXISTING LIGHT POLE TO INSTALL WATER MAIN2. DUCTILE IRON UNDER ROAD DOES NOT SHOW IN PROFILE FOR CLARITY3. CONTRACTOR TO MAINTAIN UPWARD GRADIENT AS SHOWN ON PROFILE. ALL INTERMEDIATE HIGHPOINTS ARE THE CONTRACTOR'S RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 272C504R/WBENCHMARK 0084"x4" C.M.D. "CITY OF DELTONA BM-008"STA. 44+11.43, 38.05' RTEL 32.443 CHAIN CL NORMANDY BLVD.N 1,656,585.832, E 586,604.273R/W4''W 4''W 4''WDATE ______________SCALE:HORIZ. 1"= 20'VERT. 1" = 5'C60585654526058565452504846EXISTING GRADEABOVE PROPOSED PIPEPROPOSED GRADEAT ROAD CENTERLINECONTRACTOR TO MAINTAIN PIPE PIPE SLOPE (SEE NOTE 1 THIS SHEET)50484644PROPOSED GRADE ATPIPE CENTERLINE44BA4240383634323028262422(2) 16" 45°BENDSPROPOSED16" PVC WMEXIST6" WM(4) 16" 45°BENDSEXISTING SEASONAL HIGHGROUNDWATER PROFILEPER BSAPROPOSED16" PVC WM(-) 4.298%PROPOSED PROFILE OFWM PIPE AT NORTH-WESTSIDE OF NORMANDY BLVD.* DEPTH SUFFICIENT TO DEFLECT BELOW EXISTING WATER MAIN16"X12" REDUCER & 12"GATE VALVE. CONNECT TOEXISTING WATER MAIN LINE202040+00 41+00 42+00 43+00 44+0018184240383634323028262422CITY OF DELTONAProject No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC108Bar Measures 1 inch


1/9/2013 3:33:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C109.DWG - LOPEZ, HERNANR/WR/WMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FLNORMANDY BOULEVARD201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429PACO CT. & ECHO CT.WATER MAINwww.tetratech.com________________________201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-3970Copyright: Tetra Tech12 3 4 5 6 7PT: 24+39.54FEDCBA0SCALE: 1" = 20'NOTE:2C504PROPOSED LONGWATER SERVICE (TYP)36R/W1C504R/W35FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655000.58E 585192.85WMFOUND ND LS2494WMWM3C502FOUND IP 11. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THECONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.0N10 20 40SCALE: 1" = 20'N10 20 40FOUND IRR/WR/WWMR/W34R/WR/W3535R/W6''W6''WFOUND IR 1/2 LS2564366''WPROPOSED SHORTWATER SERVICE (TYP)6" 11.25° BENDN 1654986.51E 585228.214''W 4''W 4''W 4''WR/WFOUND NDFOUND IRR/W2C50436FOUND ND6''W 6''W37PROPOSED LONGWATER SERVICE (TYP)R/W R/W6" 11.25° BENDN 1655992.24E 585755.89FH ASSEMBLYBACT. SAMPLE LOCATIONN 1655954.48E 585741.693C502ECHO CT.38EXISTING 4" AC WM3-1/2' DEEPR/W374''WR/W R/W1C5046" 11.25° BENDN 1656018.88E 585773.632C504STA:22+70.29, 36.10'L(4) 6" 45° BENDSTO DEFLECT UNDEREXISTING 8" WM6" 22.5° BENDSTA:22+69.50, 40.95'LN 1654970.39ARV ASSEMBLYE 585315.63BACT. SAMPLE LOCATION4 1PROPOSED 6"C504 C504PVC WATER MAINFOUND IR 1/2 LB5383TEL6" DI WMMANHOLE P-7FOUND ND LB1221WVTOP 50.03SW INV. 42.204" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEARV ASSEMBLYFOUND IRCONTRACTOR TO LOCATE ARV ATACTUAL HIGH POINT OF WATER MAIN(WATER MAIN TO BE 4-FT DEEP AT ARV)N 1656092.97E 585897.50 4WMWATERC5046" 22.5° BENDN 1656095.10E 585890.01WM6" 22.5° BENDEXISTING 4" AC WMN 1656089.0944" DEEPE 585850.49WM WMFOUND IRREMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEINCLUDED IN PAY ITEM #5C501(WATERMAIN IMPROVEMENTS)PROPOSED 6"PROPOSED SHORT 2PVC WATER MAINWATER SERVICE (TYP)C504REMOVE AND REPLACEEXISTING DRIVEWAY TO BE 5INCLUDED IN PAY ITEM #5 C501(WATERMAIN IMPROVEMENTS)REMOVE AND REPLACE5 EXISTING DRIVEWAY TO BEC501 INCLUDED IN PAY ITEM #5(WATERMAIN IMPROVEMENTS)NOTE:STA:36+44.00, 40.61'L1. CONTRACTOR TO MAINTAIN UPWARD GRADIENT. ALL INTERMEDIATE HIGH POINTS ARE THE1 (4) 6" 45° BENDSCONTRACTORS RESPONSIBILITY TO INSTALL ARV. SEE SHEET G002 GENERAL NOTE 27.C504 TO DEFLECT UNDEREXISTING 8" WMBACT. SAMPLE LOCATION39R/WR/W40R/W4''W41414''W42R/WR/WR/W436''W38444''W4''WR/W4545R/WR/WARVR/W46466''W47R/WR/WPACO CT.2. DRIVEWAYS SHOWN AS REMOVE AND REPLACE AND ANY RESTORATION (DRIVEWAYS, SIDEWALK,PAVEMENT, LANDSCAPING, TREE TRIMMING, AND ALL OTHER ASSOCIATED WORK REQUIRED TOINSTALL THE WATERMAIN) THAT ARE OUTSIDE THE LIMITS OF ROADWAY CONTRACT SHALL BEINCLUDED IN PAY ITEM #5 OF WATERMAIN IMPROVEMENTS.4''W48496''W3722 + 0037ARV50R/W6''W5152544545R/W R/W23 + 00OPENCUT46WV47NORMANDY BLVD.16''W5316''WWATERWATER8''W 8''W 8''W 8''WR/W R/W R/W4''W 4''W 4''W386''W 6''W 6''W 6''WR/W R/W R/W363635FOUND NDR/W6C50124 + 00REMOVE AND REPLACEEXISTING DRIVEWAYR/W R/W R/W4" CAPBEGIN/END GROUT FILLEXISTING 4" WM TO BEGROUT FILLED ANDABANDON IN PLACEECHO CT.ECHO CT.6''W34FOUND IP 136 + 0049495016''W 16''WSTA:22+71.08, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE33R/W6''WWV3434OPENCUT16''WR/W R/W R/WR/WR/W35WVWVR/W6''W37 + 006C5016" DI WMFOUND ND LB122116''W18" PIPER/W3616''WR/WSTA:36+43.27, 35.00'R16"x6" TEE16" GATE VALVE6" GATE VALVE37R/W16''W38 + 00NORMANDY BLVD.INLET TYPE P-2TOP 34.75S INV. 30.4038CITY OF DELTONADATE ______________Project No.: 200-08534-13001Designed By:Drawn By:Checked By:C109Bar Measures 1 inch


12/13/2012 12:22:36 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C501.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FBACKFILLBd(SEE NOTE 1)BcANGLE TO MEET THEREQUIREMENTS OF THEFLORIDA TRENCH SAFETYACT.1/2" EXP JOINTFULL DEPTH OF WALKMAX 15'-0" SPACINGNOTES FOR REPLACEMENT URBAN FLARED TURNOUTS1. DRIVEWAY 6" CONCRETE PAVEMENT AND DROP CURB SHALL MEET THE MATERIAL ANDCONSTRUCTION REQUIREMENTS OF SECTIONS 522 AND 520 RESPECTIVELY OF THE FDOTSTANDARD SPECIFICATIONS. THE DRIVEWAY FOUNDATION SHALL MEET THE REQUIREMENT OFSUBARTICLE 522-4.SPRINGLINE OF PIPE12"COMMON FILLCOVER MATERIAL5'-0" MAX5'-0" MAX5'-0" MAX2. DRIVEWAYS AND DRIVEWAY APRONS SHALL BE 6" INCHES THICK, CLASS B CONCRETE, WITH6X6-10/10 WWM.EDNOTES:VERTICAL TRENCH WALLS(TYPICAL)PIPE BELLFOUNDATION,IF REQUIRED(SEE NOTE 2)SUBGRADEUNDERCUT TRENCHTYPICAL DETAIL-OPEN CUTNON-UNDERCUT TRENCHTRENCHING, PIPE BEDDING, BACKFILLING & COMPACTING1. DIMENSION Bc = PIPE O.D.DIMENSION Bd = TRENCH WIDTH AT TOP OF PIPEMAXIMUM Bd = Bc + 30"MINIMUM BdSUBGRADE= MAXIMUM DIMENSION OF BELL + 8" (UNSHEETED TRENCH)= MINIMUM DIMENSION OF BELL + 12" (SHEETED TRENCH){PIPE BEDDING & TRENCHING DETAIL}SELECT COMMON FILLHAUNCHING(Bc x 0.50)6" SELECT COMMONFILL BEDDING(SEE NOTE 8)2. REMOVE UNSUITABLE OR UNSTABLE MATERIAL, AS DETERMINED BY CITY OF DELTONA STAFF ORENGINEER, ENCOUNTERED BELOW THE TRENCH BOTTOM, AS REQUIRED TO PRODUCE A SUITABLEFOUNDATION OF BEDDING ROCK. FURNISH, PLACE AND COMPACT FOUNDATION AS SPECIFIED.3. FURNISH, PLACE AND COMPACT BEDDING, HAUNCHING, COVER MATERIAL AND BACKFILL AS SPECIFIED.4. PIPE BEDDING: SELECT COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PER AASHTO T-80.5. TRENCH BACKFILL (NON-ROADWAY): COMMON FILL COMPACTED TO 95% OF MAXIMUM DENSITY AS PERAASHTO T-180.6. USE OF SELECT COMMON FILL BEDDING TO BE DETERMINED IN FIELD BY CITY OF DELTONA STAFF ORENGINEER.7. REFER TO SPECIFICATIONS, SECTION 02221, AND CITY OF DELTONA FOR DESCRIPTION OF SELECTCOMMON FILL, COMMON FILL, AND BEDDING ROCK MATERIAL.8. WHEN UNSUITABLE MATERIAL IS ENCOUNTERED THE CONTRACTOR TO REMOVE, CARRY EXCAVATIONDEEPER AND REPLACE EXCAVATED MATERIAL WITH BEDDING ROCK TO AN ELEVATION EQUIVALENT TO6" BELOW PIPE BEDDING ELEVATION.3"1'-0"2"TOP SOILWWF SUPPORTSPLANAS SHOWN ON PLANS (TO MATCH EXISTING)4" (6" FOR 2"8'-0" WIDE WALKS)WELL TAMPED ORUNDISTURBEDEARTHNOTE: 2,500 PSI CONC (MIN)SECTIONSIDEWALK, CONCRETE3/16" X 1" TOOLEDOR CUT JOINTS3/4" RADIUSFIN GR6" X 6" X 6/6 WWF(2 LAYERS FOR8'-0" WALKS) WWFSHALL BE SUPPLIEDIN FLATS. ROLLSARE NOT ACCEPTABLE3. DRIVEWAY SHALL CONFORM WITH FDOT STANDARD INDEX NO. 515.4.1 2 " JOINTS SHALL BE CONSTRUCTED WITH PREFORMED JOINT FILLER MATERIAL.REFER TO FDOTINDEX NO. 310(WHEREAPPLICABLE)FLARE SHAPE TOMATCH EXISTINGPROPOSED PIPEVARIES4" CONC.SIDEWALK(WHEREAPPLICABLE)EXIST CONCDRIVEWAYMATCHEXISTMATCH EXIST CURB ANDGUTTER (REF FDOT INDEX NO300)MATCH EXIST EDGE OFASPHALT PAVEMENT5' - 6" CONC.SIDEWALK(WHEREAPPLICABLE)MATCH EXISTING WIDTH1 2 " JT (NOTE4)6%(MAX)2%(MAX)MATCH EXISTING WIDTHRELPACEMENT DRIVEWAY TURNOUT - FDOT INDEX 515REPLACEDRIVEWAYTO FIRSTCONST JTOR 5' WHICHEVER ISGREATERREPLACEDRIVEWAYTOASPHALTPAVEMENT6" CONC. DRIVEWAYAND SIDEWALK(WHEREAPPLICABLE)FIN GR3'-0"CONSTRUCT UNIFORM PIPE DEFLECTION - NOT TOEXCEED 75% OF MANUFACTURER RECOMMENDEDMAXIMUM DEFLECTION PER PIPE JOINTTYPICAL UTILITY±20'-0" CENTERON UTILITY±120'-0"VARIES20'O.D.12"ALLOWABLE JOINT DEFLECTIONFOR 16" PIPEDEFLECTION TYPE UTILITY CROSSING3'-0"PROPOSED UTILITY15"3°-35' (R 320)DATE ______________DETAIL 1SCALE: NTS-DETAIL 3SCALE: NTS-DETAIL 5SCALE: NTS-DETAIL 7SCALE: NTS-CBBENDSTANDARD FITTINGS/APPURTENANCESREQUIRED LENGTH OF RESTRAINED PIPE EACH WAY (FT)PIPE DIAMETER4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"11-1/4°22-1/2°45°90°1818182118181830181818361818184418182051181822601818266418182766181831751818368818194097182245109182450121182654132182859142DEAD END* 60 85 110 133 155 177 198 218 238 277 330 379 423 465 506*NOTE: IN-LINE VALVES AND TEES (BRANCH) SHALL BE RESTRAINED AS DEAD ENDS.DIAMETER4"6"8"10"12"14"16"18"20"24"30"36"42"48"REDUCERS - REQUIRED LENGTH OF RESTRAINED PIPE AT LARGE SIDE (FT)**4" 6" 8" 10" 12" 14" 16" 18" 20" 24" 30" 36" 42" 48" 54"44 79 10846134 15981 113 141 16644 82 115 14445 84 11745 84**A MINIMUM OF 20 FEET OF PIPE SHALL BE RESTRAINED ON THE SMALL SIDE.1. THE ABOVE REQUIREMENTS WERE CALCULATED IN ACCORDANCE WITH "THRUSTRESTRAINT FOR DUCTILE IRON PIPE,"THIRD EDITION, 1992, PUBLISHEDBY DIPRA, WITH THE FOLLOWING ASSUMPTIONS:SOIL CONDITIONS: SAND/SILTLAYING CONDITION: 4MINIMUM COVER: 3 FTIF FIELD CONDITIONS DIFFER FROM THE ABOVE, CONTRACTOR SHALL NOTIFY ENGINEER.PIPE RESTRAINT, RESTRAINED JOINTPOLYETHYLENE WRAPPED DIP OR PVC PIPE, 150 PSI TEST PRESSURE17114711845 8419617514911844 8322620417915144 11983274254232207180115258 324207 281114345204 280 349110 201 2822. THE RESTRAINED JOINT LENGTHS CALCULATED ABOVE FOR BENDS WERE FOR BENDS INTHE HORIZONTAL DIRECTION OR VERTICAL UP DIRECTION. IF A BEND IS ORIENTED INTHE VERTICAL DOWN POSITION, THE RESTRAINED JOINT LENGTH CALCULATED ABOVE FORTHAT BEND SHALL BE MULTIPLIED BY 3.5.108 203112UNDISTURBEDEARTH5'NOTES:1'-6"RESTRAINEDLENGTHEXISTING WM MAINTHRUST COLLARSEE DETAILSTAINLESS STEEL TAPPING SLEEVE5'TAPPING VALVE& BOXLINE STOP & PLUGCAP OR PLUGEXISTING WM MAINTO BE ABANDONEDPROPOSED MAIN1. CONTRACTOR SHALL WRAP SLEEVE AND VALVE WITH POLYETHYLENEEXCAVATION DEPTHSHALL BE 1' BELOWBOTTOM OF MAIN2. FOR RESTRAINED LENGTHS, SEE THRUST COLLAR DETAIL 3, SHEET D-4.3D1043'MIN LIMITS OFEXCAVATIONWET TAP CONNECTION TO EXISTING MAIN - WATER OR RECLAIMED2'MINREPLACEMENT CONC W/6X6-6/6 WWF(MONOLITHIC POUR)EXISTINGCONCNOTES:1.2.3.4.5.6.4" MIN1'-6"2' MINTRENCH WALL(TYP)DUCTILE IRONUTILITY PIPE5' MIN3' MINCONCRETE RESTORATION8"MINASPHALT RESTORATION1 1/2" SURFACEREPLACEMENTEXISTINGBASEBASE COMPACTED TO98% MAX. DENSITYAASHTO T-180(2T OR 8 INCHES,WHICHEVER IS GREATER)(W = PIPE OD (ft) + 2')SUBGRADE COMPACTEDTO 98% MAX. DENSITYAASHTO T-180EXISTING SURFACE AND BASE CUTS SHALL BE MECHANICALLY SAWN.LONGITUDINAL CUTS REQUIRE OVERLAY/RESURFACING TO THE COMPLETE WIDTHOF THE ROAD.CUTS AT INTERSECTIONS REQUIRE COMPLETE OVERLAY/RESURFACING TO THEEND OF ALL RETURN RADII AND/OR 10 FT BEYOND CUT, WHICHEVER IS GREATER.CUTS THROUGH TURNOUTS AND CUL-DE-SACS REQUIRE COMPLETE OVERLAY/RESURFACING.ALL UTILITY PIPE INSTALLED UNDERNEATH ASPHALT OR CONCRETE ROADWAY SHALLBE DUCTILE IRON.2T(W)W/2 + 2'TRENCH WIDTHT1'-6"SURFACE JOINTEXISTING ASPHALTCONTRACTOR SHALL FILL OPEN CUT TO ALLOW TRAFFIC TO PASS FREELY ANDSAFELY PROMPTLY AFTER INSTALLATION. IF PERMANENT RESTORATION IS TO BEDEFERRED, THE CONTRACTOR SHALL MAINTAIN THE TEMPORARY CONDITION TO THERESIDENT INSPECTOR'S SATISFACTION.TRENCHING DETAIL - ROADWAY OPEN CUTEXISTINGWM OR FMTO REMAININ SERVICETHRUST COLLARSEE DETAIL 3SHEET C504EXISTING DRAINAGE STRUCTUREOR OTHER OBSTRUCTIONNEW WMOR FMTHRUST COLLARSEE DETAIL 3SHEET C504±20' CENTEREDON UTILITYEXISTING WM OR FMTO BE REMOVED12"MIN.EXISTING BURIEDUTILITY TO REMAINVERTICAL TRANSITION AT OBSTRUCTION±20' CENTEREDON UTILITY3' MIN.45° RJ BEND45° RJBENDNEW WM OR FMNEW WMOR FMHORIZONTAL TRANSITION AT OBSTRUCTIONUTILITY CONFLICTFINISHED GRADENEW WM OR FMEXISTINGWM OR FMTO REMAININ SERVICERESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)RESTRAINEDLENGTHSEE DETAILRESTRAINED JOINT (TYP.)CITY OF DELTONAADETAIL 2SCALE: NTS-DETAIL 4SCALE: NTS-DETAIL 6SCALE: NTS-DETAIL 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC501Bar Measures 1 inch


12/6/2012 1:43:15 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C502.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FEARLY WARNING TAPE WITH METALLICDETECTOR STRIP AND/OR WIRE6" MIN.12" MAX.FINISHED GRADEGROUND LEVELMETER BOXMETALLIC OR VINYL CONTINUOUS IDENTIFICATION/WARNING TAPEWIRE TO BE PLACED INSIDE PIPE WITH A MIN. OF 12"OF EXCESS WIRE - COILED (TYP.)DOUBLE METER BOX(18" x 24" MIN.)FINISHED GRADE2" GATE VALVE W/2-INCH SQUARE NUT DRIVE2" QUICK DISCONNECTEDNOTES:6" MIN.12" MAX.FINISHEDGRADEPVC WATER MAINOR FORCE MAINEARLYWARNINGTAPETRACING WIRE10 GAUGEBRAIDED SOLIDCOPPER1. ALL MAINS INSTALLED BY OPEN CUT SHALL HAVE A "EARLY WARNING" PROTECTION TAPE AND/OR WIRE INSTALLEDCONTINUOUSLY ALONG THE ALIGNMENT. THE PROTECTION TAPE SHALL BE TERRA-TAPE OR EQUAL. TAPE SHALL BE INSTALLEDDURING BACKFILLING 6"-12" BELOW FINISHED GRADE DIRECTLY OVER THE PIPE AND SHALL BE CONTINUOUSLY MARKED FOR THETYPE OF PIPE (EXAMPLE: "CAUTION, WATER MAIN BURIED BELOW"). THE TAPE SHALL HAVE A METALLIC DETECTABLE STRIPINCLUDED AND COLOR CODED AS FOLLOWS:BLUE - POTABLE WATERGREEN - SANITARY FORCE MAINPURPLE - EFFLUENT REUSERED - DEDICATED FIRE LINE2. ALL PVC MAINS SHALL BE A SOLID COLOR OR WRAPPED WITH COLOR CODED BAGS. ALL LETTERING SHALL APPEAR ON THREE(3) SIDES OF THE PIPE AND SHALL RUN THE ENTIRE LENGTH OF THE PIPE AND SHALL BE A MINIMUM OF 3/4 INCH IN HEIGHT WITHTHE APPROPRIATE WORDING APPEARING ONE OR MORE TIMES EVERY 21 INCHES ALONG THE LENGTH OF PIPE. THE LETTERINGMUST BE PERMANENTLY STENCILED TO THE PIPE SURFACE. LETTERING SHALL READ AS IS ACCEPTABLE FOR THE INTENDEDUSE. ALL LETTERING SHALL BE APPLIED BY THE PIPE MANUFACTURER DURING PRODUCTION.3. ALL DUCTILE IRON MAINS SHALL BE WRAPPED WITH COLOR CODED BAGS.4. ALL PVC POTABLE WATER PIPE SHALL BEAR THE NATIONAL SANITATION FOUNDATION (NSF) SEAL OF APPROVAL.6"-12"6"TYPICAL UTILITY PIPE1/2" PVC PIPE (TYP.)VALVE BOXDEAD ENDALL PVC PIPE, OR OTHER APPROVED NONMETALLIC PIPE INSTALLED WITHIN DELTONAWATER'S WATER, SANITARY SEWER, OR REUSE WATER SYSTEMS, SHALL BE INSTALLEDWITH 10 GAUGE SOLID COPPER TRACING WIRE.THE TRACING WIRE MUST BE INSTALLED DIRECTLY BELOW THE PIPE AND BROUGHT TO THESURFACE AT 500' MINIMUM INTERVALS. WIRE SHALL EXTEND A MINIMUM OF 12" ABOVEGRADE AT EACH INTERVAL AND BE COILED AND PLACED IN A VALVE BOX, METER BOX,MANHOLE, CLEANOUT OR OTHER APPLICABLE STRUCTURE.TRACING WIRE BETWEEN INTERVALS SHALL BE INSTALLED SO AS TO PROVIDECONTINUOUS CURRENT WHEN LINE LOCATION EQUIPMENT IS CONNECTED TO THETRACING WIRE. WIRE BRANCHING FROM MAIN LINES SHALL BE LINKED BY A DELTONAWATER APPROVED CONNECTOR SUCH AS KING # 2011 SAFETY SEALED CONNECTORS ORAPPROVED EQUAL.COLOR CODING:POTABLE WATER SYSTEM: BLUEREUSE WATER SYSTEM: LAVENDERSANITARY SEWER FORCE AND LOW PRESSURE SEWER SYSTEMS: GREENUTILITY PIPE LOCATION MATERIALSDETAIL 1SCALE: NTS-GENERAL NOTES:1. FOR LOW PRESSURE SEWER, POTABLE WATER AND REUSE WATER SYSTEMS: WIRE SHALL BEINSTALLED BELOW ALL MAINS AND SERVICE LINES AND ATTACHED TO VALVES, HYDRANTS ANDFITTINGS. WIRE INSTALLED WITH SERVICE LINES SHALL CONNECT TO THE WIRE INSTALLED BELOWTHE MAIN AND EXTEND TO THE CURB STOP.2. FIRE SPRINKLER LINES: WIRE SHALL CONNECT TO THE WIRE INSTALLED BELOW THE MAIN ANDEXTEND TO THE RISER CONNECTION.3. SANITARY SEWER FORCE MAINS: WIRE SHALL BE INSTALLED BELOW THE FORCE MAIN ANDATTACHED TO ALL VALVES AND FITTINGS AND BROUGHT TO THE SURFACE AND PLACED IN A METAL,DELTONA WATER APPROVED, VALVE BOX.4. DEAD END MAINS: WIRE SHALL BE PLACED IN A PROPERLY IDENTIFIED METAL VALVE BOX AT THEEND OF THE RUN.5. WIRE SHALL NOT BE FASTENED OR COILED TO VALVE OPERATING NUT.6. UTILIZE SPLIT BOLTS TO JOIN WIRE SEGMENTS.2" 90° BENDWATER MAINTAPPED CAPNOTES:1. ALL 2" PIPE AND FITTINGS SHALL BE BRASS WITHTHREADED (NPT) JOINTS.2. TAPPED CAP SHALL BE RESTRAINED AS PER THERESTRAINED JOINT DETAIL (DEAD END).BLOWOFF VALVE DETAILDETAIL 3SCALE: NTS-2"6"6" BEDDING ROCKDATE ______________ANCHOR TEEAS REQUIREDCB6"-90° BENDANCHOR TEE6" RESILIENT SEAT GATEVALVEINSTALLATION PARALLEL TO MAIN6" RESILIENT SEATGATE VALVEFIRE HYDRANTFIRE HYDRANTMAIN LINE2'-0" SQ. x 4" MIN. COLLAR W/ 1#3 CONT. REINF.SET TOP 2"ABOVE FINISHGRADE INUNPAVED AREAADJUSTABLE TYPE C.I.VALVE BOXLENGTH VARIES, NO BENDS PREFERRED4 1/2" PUMPERNOZZLE (FACINGSTREET)2- 2 1/2" HOSENOZZLE6" RESILIENT SEAT GATEVALVECONCRETE REACTION BLOCKING3"CLEAR1'-6" MIN.2'-0" MAX.8 CU. FT. OF GRAVELOR CRUSHED STONEFOR DRAINAGE SUMPPROVIDE CONC.1.0 CU. FT.NOTES:ASPHALTSURFACESCREW ORSLIDE TYPEVALVE BOXPROVIDEEXTENSIONAS REQ'D.TYPE 1VALVECAST IRON STAY-PUT COVERW/RAISED LETTERS MARKED"WATER" OR "SEWER"WIRE TO BE PLACED INSIDE PIPEWITH A MIN. OF 12" OF EXCESSWIRE - COILED W/PVC INVERTEDTHREADED CAP (TYP.)12"(MAX.)1" SCHED 40PVC PIPE(TYP.)CONCRETERIBBON FORBOX SUPPORT(TYPICAL)TYPE 236" (MIN.)COVERTRACING WIRE12 THHN SOLIDCOPPER4" x 4" x 12" LG. PRECAST CONC. POSTW/3" Ø BRONZE DISC, AS SHOWN ONCONC. COLLAR DET.1. GATE VALVES SHALL BE DUCTILE IRON RESILIENT SEAT TYPE, RATED AT 200 P.S.I. AND SHALL COMPLY WITHANSI/AWWA C509.2. CONCRETE COLLAR AND VALVE COVER SHALL BE PAINTED FEDERAL SAFETY BLUE FOR POTABLE WATER.TYPE 1 (PAVED AREAS)SOIL CEMENT,LIMEROCK ORASPHALT BASESIZE OF VALVETYPE OF VALVESERVICEDIRECTION &NO. OF TURNSTO OPENFINISHEDGRADE# 3 CONT.1" SCHED 40 PVC PIPEFOR TRACER WIRE(TYP.)12"12"WATER12"G.V.WATERR-2024" SQ.4"4"4"4"2"3" Ø BRONZE DISCANCHORED TO CONC.PAD24" x 24" x 4" THICK CONC. PADAT EACH VALVE BOX W/1-#3CONT. REINF.1/8" LETTERS TO BE CAST W/ 3" ØBRONZE DISC AS MFD. BYSHELDON BRONZE CO.ANCHOR RECESSEDBRONZE INDENT. DISC.SEE DETAIL ABOVE2" (MIN.)CITY OF DELTONAAINSTALLATIONPERPENDICULAR TO MAINFIRE HYDRANT ASSEMBLY INSTALLATIONDETAIL 2SCALE: NTS-TOTAL ASSEMBLY TO BE RESTRAINEDFROM MAIN LINE TO FIRE HYDRANTNOTES:1. A TAPPING SLEEVE WITH VALVE AND BOX SHALL BEINSTALLED WHEN CONNECTING A PROPOSED FIREHYDRANT TO AN EXISTING MAIN, OR RELOCATING ANEXISTING FIRE HYDRANT.2. HYDRANTS SHALL HAVE BREAKAWAYSECTION OR REMOVABLE BARREL.GATE VALVE AND BOX DETAILDETAIL 4SCALE: NTS-TYPE 2 (NON-PAVED AREAS)Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC502Bar Measures 1 inch


12/6/2012 1:44:20 PM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C503.DWG - LOPEZ, HERNANNORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FCARRIER PIPE MAIN6"6" 10'-0"10'-0"E6" 6"# 4 BARS (TYP)FULL ENCASEMENT3" MINSAND CUSHIONSANITARY SEWEROR WATER MAINDATE ______________NOTE: USE ENCASEMENT WHERE VERTICAL CLEARANCE BETWEEN WATER MAIN ANDSEWER IS LESS THAN 18". DUCTILE IRON PIPE MAY BE USED IN LIEU OF CONCRETEENCASEMENT AT SEWER LINE CROSSING WITH A LENGTH OF PIPE CENTERED AT THEPOINT OF CROSSING, SO AS TO LOCATE JOINTS AT A MAXIMUM DISTANCE FROMTHE SEWER LINE.DTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, URBANDAY OR NIGHT OPERATIONSDETAILS 1SCALE: NTS-UTILITY CROSSING - CONCRETE ENCASEMENTDETAILS 4SCALE: NTS-CPost (Options: 2" x 4"or 2 1/2" Min. Dia. Wood;Steel 1.33 Lbs/Ft. Min.)3' Or More12" Min.15"to18"8"6' Max.Optional Post PositionsFilter Fabric (InConformance WithSec. 985 FDOT Spec.)Vertical20`Principle Post Position(Canted 20 Toward Flow)Filter FabricSilt FlowSECTIONELEVATIONNote: Silt Fence to be paid for under the contract unit price for Staked Silt Fence (LF).TYPE III SILT FENCESilt FlowNote: Spacing for Type III Fence to be in accordance withFDOT Design Index No. 102, Chart I, Sheet 1 of 3 andditch installations at drainage structures Sheet 2 of 3.Type III Silt FenceBTRAFFIC CONTROL THROUGH WORK ZONESTWO-LANE, TWO-WAY, RURALDAY OR NIGHT OPERATIONSSilt FlowType III Silt FenceType III Silt Fence ProtectionAround Ditch Bottom Inlets.Do not deploy in a manner that silt fences will act as a dam across permanent flowingwatercourses. Silt fences are to be used at upland locations and turbidity barriersused at permanent bodies of water.SILT FENCE APPLICATIONSEROSION CONTROL - SILT FENCECITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 3SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC503Bar Measures 1 inch


12/13/2012 11:49:53 AM- P:\IER\08534\200-08534-13001\CAD\SHEETFILES\C504.DWG - DAVALOS, PAULANORMANDY BOULEVARDDETAILSMARK DATE DESCRIPTION BYMichael B. Saxton, P.E.P.E. No. 71506, FL201 East Pine Street, Suite 1000Orlando, Florida 32801Engineering Business No. 2429________________________www.tetratech.com201 EAST PINE STREET, SUITE 1000ORLANDO, FLORIDA 32801PHONE: (407) 839-3955 FAX: (407) 839-397012 3 4 5 6 7FGATE VALVE2" RPZ BACKFLOW PREVENTER(FEBCO 806YD OR EQUAL)#4 AT 8" EACH FACEEACH WAYDIAGONALS: LENGTHPIPE OD +12"THREADED NIPPLE (TYP)PRESSURE GAUGEWITH VALVE (TYP)GATE VALVE90° BEND(TYP)EDAWWA TYPECC THREADSSERVICESADDLE1.2.3.4.NOTES:30 - 45 DEG.WATER MAIN AND RAW WATER MAINALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.ALL SERVICE SADDLES SHALL BE SMITH-BLAIR SUITABLE FORUSE WITH HDPE OR DIP PIPE, AS REQUIRED OR EQUAL.EACH TEST SERVICE SHALL TERMINATE ABOVE GRADE WITH A CURBSTOP AND SMOOTH NOSED SAMPLING TAP.EACH TEST SERVICE SHALL BE PROPERLY SAFE GUARDED AGAINSTVANDALISM DURING TESTING. THE CONTRACTOR WILL BE REQUIRED TOREMOVE TEST SERVICE FOLLOWING SUCCESSFUL BACTERIOLOGICALTESTING.BACTERIOLOGICAL TEST CONNECTIONSCORPORATION STOP& FITTING(NORMALLY OPEN)DOUBLE METER BOXASSEMBLY3/4" POLYETHYLENESERVICE LINE18"4" x 4" x 1/2" STEELBEARING PLATE(TYP.)#4 BARSUNDISTURBEDEARTHMIN.ENCASE TIE RODS IN1-1/2" PVC SLEEVEREINFORCEMENT DETAIL18"BBNOTES:1. ADDITIONAL REINFORCEMENTS SHALLBE AS SPECIFIED BY THE ENGINEER.2. MINIMUM COMPRESSIVE STRENGTH FORCONCRETE SHALL BE 3000 PSI.3. BEDDING, BACKFILL, AND COMPACTIONSHALL BE AS SPECIFIED ELSEWHERE INTHE STANDARD DRAWINGS.4. ALL FORM BOARDS SHALL BE REMOVEDPRIOR TO BACKFILL.5. NO ALLOWANCE SHALL BE MADE FORFRICTION BETWEEN THE PIPE WALL ANDTHE THRUST COLLAR.6. DESIGN PRESSURE:______ 150 P.S.I.*TRENCHLIMITSC3" COVER#4 BARS ALL AROUND(MIN. 2" CLEARANCEAROUND PIPE.)9" MIN. (TYP.)TIE RODS INCLUDINGNUTS AND WASHERS(SEE SCHEDULE BELOW)MECHANICALJOINTSSEE TRENCH DETAILSFOR PIPE BEDDINGREQUIREMENTSSCHEDULE OF DIMENSIONS AND MATERIALSPIPE DIMENSIONS (FT.) TIE RODS REQ'DSIZE(INCHES) A B C D DIA. NO.4 2.0 2.0 1.0 3/4 26810121620242.02.53.55.06.08.09.02.02.53.03.04.05.06.01.01.01.01.01.51.51.53/43/43/43/43/43/43/42222468NOTE: THRUST COLLAR AREAS TO BE COMPUTEDON BASIS OF 2000 LBS. PER SQ. FT. SOILRESTRAINT BEARING.THRUST COLLAR DETAIL FOR WATER MAIN (150 psi)ARESTRAINED LENGTH DD=3XB OR MIN. 10'-0"NOTES:1.2. THIS DETAIL IS TO BE USED FOR FILLING ANY NEWWATER MAIN AND FOR FLUSHING OF NEWMAINS UP TO 8" DIAMETER (2.5 FPS MINIMUMVELOCITY), AND FOR BACTERIOLOGICAL SAMPLINGPOINTS AT THE ENDS OF THE PROPOSED MAINS.THE JUMPER CONNECTIONS SHALL BE MAINTAINEDUNTIL AFTER FILLING, FLUSHING, TESTING,AND DISINFECTION OF THE PROPOSED MAIN HAS BEENSUCCESSFULLY COMPLETED AND CLEARANCE FOR USEFROM THE FDEP HAS BEEN RECEIVED. THIS JUMPERCONNECTION SHALL ALSO BE USED TO MAINTAIN AMINIMUM PRESSURE OF 20 PSI IN THE PROPOSEDMAINS AFTER DISINFECTION AND UNTIL THE FDEPCLEARANCE LETTER IS OBTAINED.3.B.2" SCHED 80 PVCFINISHED GRADE2" CORPORATION STOPA TEMPORARY JUMPER CONNECTION IS REQUIRED ATALL CONNECTIONS BETWEEN EXISTING ACTIVE WATERMAINS AND PROPOSED WATER MAIN IMPROVEMENTS.FLUSHING OF THE 10" DIAMETER AND LARGER WATERMAIN MAY BE DONE THROUGH THE TIE-IN VALVEUNDER VERY CONTROLLED CONDITIONS, AS FOLLOWS:A. THE TIE-IN VALVES SHALL BE OPERATED ANDPRESSURE TESTED IN THE PRESENCE OF THE UTILITYCOMPANY AND ENGINEER TO VERIFY WATER TIGHTNESSPRIOR TO TIE-IN. VALVES WHICH ARE NOT WATERTIGHTSHALL BE REPLACED.THE TEMPORARY JUMPER CONNECTION SHALL BECONSTRUCTED AS DETAILED. THE JUMPER CONNECTIONSHALL BE USED TO FILL THE NEW MAIN AND FORBACTERIOLOGICAL SAMPLING OF THE NEW MAIN ASREQUIRED BY THE FDEP PERMIT.- FLUSHING SHALL NOT BE ATTEMPTED DURING PEAKDEMAND HOURS OF THE EXISTING WATER MAINS.- ALL DOWNSTREAM VALVES IN THE NEW SYSTEMMUST BE OPEN PRIOR TO OPENING THE TIE-IN VALVE.UNION(2 REQD)TEMPORARY JUMPER CONNECTION12" MIN16" MAXEXISTING MAIN AND TIE-IN VALVE(OR TAPPING SLEEVE AND VALVE)4.5.6.7.8.SAMPLINGTAPSERVICE SADDLE WITH2" CORPORATION STOPNEW WATER LINE- MONITOR THE PRESSURE AT THE TIE-IN POINT.THE PRESSURE IN THE EXISTING MAIN MUST NOTDROP BELOW 35 PSI.- TIE-IN VALVE SHALL BE OPENED A FEW TURNS ONLYENSURING A PRESSURE DROP ACROSS THE VALVE ISALWAYS GREATER THAN 10 PSI.C. THE TIE-IN VALVE SHALL BE LOCKED CLOSED BYTHE UTILITY UNTIL FLUSHING BEGINS.D. THE TIE-IN VALVE SHALL BE OPENED ONLY FORFLUSHING OF THE NEW MAIN. THE PROCEDURE SHALL BEDIRECTED BY THE UTILITY AND OBSERVED BY THEENGINEER.E.AFTER FLUSHING, THE TIE-IN VALVE SHALL BE CLOSEDAND LOCKED IN THE CLOSED POSITION BY THE UTILITY.THE CONTRACTOR SHALL PROVIDE DOCUMENTATIONDEMONSTRATING THAT THE DOUBLE CHECK VALVE BACKFLOWPREVENTION DEVICE HAS BEEN TESTED AND IS IN GOODWORKING ORDER AT THE TIME OF INSTALLATION.EXCEPT AS REQUIRED TO FLUSH LINES GREATER THAN8" IN DIAMETER, THE TIE-IN VALVE SHALL REMAIN LOCKEDCLOSED UNTIL THE NEW SYSTEM HAS BEEN CLEAREDFOR USE BY FDEP AND ALL OTHER PERTINENT AGENCIES.UPON RECEIPT OF CLEARANCE FOR USE FROM FDEP,THE CONTRACTOR SHALL REMOVE THE TEMPORARY JUMPERCONNECTION. STOPS ARE TO BE CLOSED AND PLUGGEDWITH 2" BRASS PLUGS.ALL INSTALLATION AND MAINTENANCE OF THE TEMPORARYJUMPER CONNECTION AND ASSOCIATED BACKFLOWPREVENTION DEVICE, FITTINGS, VALVE, ETC. SHALL BE THERESPONSIBILITY OF THE CONTRACTOR.$400 REFUNDABLE DEPOSIT FOR TEMPORARY JUMPER METER.CONTRACTOR SHALL PAY FOR WATER AT RATES PROVIDED BYTHE CITY AT PROJECT INITIATION.NOT USEDDATE ______________DETAILS 1SCALE: NTS-DETAILS 3SCALE: NTS-DETAILS 5SCALE: NTS-DETAILS 7SCALE: NTS-CBWATER MAIN1-1/4 SCH. 40 PVCENCASEMENTCORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)SINGLE METER BOXAND WATER METERSINGLE SERVICEAWWA TYPECC THREADSSADDLECURB STOP(SEE NOTE 3)ADD 1-1/2" SCH 40PVC CASINGWATER MAINMARK WITHWOOD PAINTEDBLUE & WITHLOT NUMBERS1-1/4 SCH. 40 PVCENCASEMENTWATER SERVICE CONNECTIONS1-1/4 SCH. 40 PVCENCASEMENTNOTES:1. ALL FITTINGS SHALL BE BRASS WITH COMPRESSION/PACK JOINTTYPE CONNECTIONS.2. NO SERVICE LINE SHALL TERMINATE UNDER A DRIVEWAY.3. EACH SERVICE SHALL TERMINATE AT A CURB STOP(S) WHICHSHALL BE BURIED APPROXIMATELY 3" BELOW FINAL GRADE ANDSHALL BE CLEARLY MARKED WITH A 2" X 2" X 18" STAKE WITHTHE TOP PAINTED BLUE AND MARKED WITH THE NUMBER OF THELOT(S) TO BE SERVED.4. EXISTING WELLS SHALL BE PHYSICALLY SEPERATED FROM THE EXISTINGPIPING AND A BACKFLOW PREVENTER SHALL BE INSTALLED AT THE METER.5. SERVICE TUBING SHALL BE BLUE POLYETHYLENE ENDOPURE OR APPROVED EQUAL.WATER MAINCORPORATION STOP& FITTING(NORMALLY OPEN)30 - 45 DEG.CORPORATIONSTOP (1" MIN.)POLYETHYLENETUBING (1" MIN.)DOUBLE METER BOXAND WATER METERDOUBLE SERVICETO METER BOXASSEMBLYBLUEPOLYETHYLENETUBINGU-BRANCHFITTING(1" x 3/4"x 3/4")CURB STOP2 EA.PREMOLDEDPLASTICJOINT FILLER5" WALLS(MIN)2" TEE2" POLY PIPE1.2.3.4.CAST IRON FRAME ANDCOVER, WITH ACCESS LID(SEE NOTE 3)NOTES:4'X4' PRECASTCONCRETE VAULT36" SQ.17 1/4"ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE. ASSPECIFIED IN SPECIFICATION 15050. CHANGE PIPE AND FITTINGSACCORDINGLY. FOR OTHER VALVE SIZES AND TYPES. VALVE SIZESTO BE DETERMINED BY THE ENGINEER AND APPROVED BY THE CITYPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM TOP OF PIPE TO FINISHEDGRADE SHALL BE 4.0 FEET.LID TO BE LETTERED WITH THE APPROPRIATE WORD "WATER".8"EXTEND GSP BLOW-OFF TO 1'-3" ABOVE GRADE, SCREEN END W/ STSTEEL SCREEN.STAINLESS STEELSCREENGROUTAIR RELEASE VALVE - WATERSLOPE 1" PER 1'2" AIR RELEASEVALVE W/ONEWAY AIR VALVE1" CURB STOP2"X1" REDUCER& 1" SHORT NIPPLE2" GATE VALVEBRONZE DOUBLE STRAPSADDLE6"16"Ø WATERPLUSPOLYETHYLENE(BLUE)POLY PIPE8"x16" REINFORCED CONCRETE FOOTING6"4"Ø HOLE, GROUTAFTER INSTALLATION20"x20"x6" P.C.C. PAD,CLASS "C"ARV ENCLOSURE(BLUE FOR WATER)STAINLESSSTEELSCREEN36"x36"x6"P.C.C. PAD,CLASS "C"4"Ø HOLE,GROUT AFTERINSTALLATION6" MIN.#57 BEDDING ROCKPREMOLDEDPLASTICJOINT FILLER4" MAX.SLOPE 1" PER 1'5" WALL (MIN.)2" TEE2" THREADEDGALV. STEEL PIPE2" SQUARE NUTRESILIENT SEATGATE VALVEo2" 90 BENDFITTINGS ANDPIPE FORA.R.V. SHALLBE BRASS6" BEDDING ROCK1.2.3.4' x 4' PRECASTCONCRETE VAULT36" DIA.17-1/4"8"WATER MAINSERVICE SADDLEPER SPECIFICATIONSECTION 50.5.4NOTES:ABOVE DETAIL IS BASED ON 2" AIR RELEASE VALVE.CHANGE PIPE AND FITTINGS ACCORDINGLYFOR OTHER VALVE SIZES AND TYPES. VALVE SIZES TO BEDETERMINED BY THE ENGINEER AND APPROVED BY DELTONA WATERPRIOR TO INSTALLATION.THE MINIMUM DIMENSION FROM ELBOW INVERT TO FINISHEDGRADE SHALL BE 4.0 FEET.VALVE BOX SHALL BE IN COMPLIANCE WITH FIGURE 2-031.OFFSET AIR RELEASE VALVE - WATERCAST IRON FRAMEAND COVER WITHACCESS LID.GROUTFINISHED GRADE2" AIR RELEASEVALVE W/ONE WAYAIR VALVE1" CURB STOP2"X1" REDUCER &1" SHORT NIPPLESEE NOTE 3GROUT (TYP.)2" UNION2" BRASS PIPE2" SQUARE NUTRESILIENT SEATGATE VALVE8" x 16" REINFORCEDCONCRETE FOOTING.EXISTING /PROPOSEDPAVEMENTCAST IRONVALVE BOXTOP SECTIONEXTENSIONROD ASREQUIREDo2" 90 BEND2" NIPPLENOT USEDCITY OF DELTONAADETAILS 2SCALE: NTS-DETAILS 4SCALE: NTS-DETAILS 6SCALE: NTS-DETAILS 8SCALE: NTS-Project No.:Designed By:200-08534-13001MBSDrawn By:PDChecked By:MADC504Bar Measures 1 inch


PROJECT MANUALCITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD– SECTION “B”SAXON BOULEVARDTOFORT SMITH BOULEVARDBID NO.: ITB # PW 13-05Prepared for:CITY OF DELTONA2345 PROVIDENCE BOULEVARDDELTONA, FLORIDA 32725Prepared by:BOWYER-SINGLETON & ASSOCIATES, INC.520 SOUTH MAGNOLIA AVENUEORLANDO, FLORIDA 32801January 2013BSA Project No. CD1-J9


City of DeltonaRoadway ImprovementsNormandy Boulevard – Section “B”Saxon Boulevard to Fort Smith BoulevardTABLE OF CONTENTSDIVISION 0 – BIDDING AND CONTRACT REQUIREMENTSSection Title00020 Announcement and Bid Documents00100 General Terms, Conditions, Information and Instructions to Bidders00300 Bid Response Form00301 Bidder’s Contact and Information Form00301-A References00301-B Questionnaire00301-C Sub-Contractors and Affiliates Form00301-D Drug-Free Work Place Form00301-E Hold Harmless and Indemnity Agreement00301-F Statement of No Bid00410 Bid Bond00420 Corporate Resolution00470 Sworn Statement re: Public Entity Crimes00480 Non-Collusion Affidavit Form00490 Trench Safety Affidavit00500 Agreement00650 Certificate of Insurance00700 General Conditions00800 Supplemental Conditions00841 Notice of Award Form00842 Notice to Proceed Form00843 Change Order Form00844 Application and Certification for Payment Form00845 Schedule of Values00846 Materials Stored On Site Form00847 Shop Drawing Submittal Form00848 Certificate of Substantial Completion00849 Contractor’s Final Release of Lien00850 Field Order00851 Contractor Request For Information00853 Pressure Test Form00861 Work Directive Form00863 Change Proposal Summary Form00864 Request for Proposal for Proposed Change Form- 1 -


City of DeltonaRoadway ImprovementsNormandy Boulevard – Section “B”Saxon Boulevard to Fort Smith BoulevardTABLE OF CONTENTSDIVISION 1 – GENERAL REQUIREMENTSSection Title01000 Project Requirements01010 Summary of Work01025 Measurement and Payment01027 Application for Payment01041 Project Coordination01050 Field Engineering01-65 Permits and Fees01-070 Abbreviations and Symbols01-200 Project Meetings01-310 Construction Progress Schedules01-340 Shop Drawings, Working Drawings, and Samples01-370 Schedule of Values01-390 Color Audio-Video Pre-Construction Record01-410 Testing and Testing Laboratory Services01-500 Construction Facilities and Temporary Controls01-505 Mobilization01-568 Temporary Erosion and Sedimentation Control01-600 Material and Equipment01-700 Contract Closeout01-710 Cleaning01-720 Project Record Documents01-740 Warranties and Bonds01-800 Miscellaneous Work and CleanupDIVISION 2 – SITEWORKSection Title02-101 Mobilization02-102 Maintenance of Traffic02-104 Erosion Control02-110 Clearing and Grubbing02-120 Excavation, Embankment and Grading02-160 Stabilized Subgrade02-331 Type S Asphaltic Concrete Pavement02-337 Type FC-3 Asphaltic Concrete (Friction Course)02-425 Inlets, Manholes and Junction Boxes02-430 Pipe Culverts and Storm Sewers- 2 -


City of DeltonaRoadway ImprovementsNormandy Boulevard – Section “B”Saxon Boulevard to Fort Smith BoulevardTABLE OF CONTENTSDivision 2 (Continued)Section Title02-515 Pipe Handrail02-520 Concrete Gutter and Curb Elements02-522 Concrete Sidewalks02-524 Concrete Ditch and Slope Pavement02-530 Rip-Rap02-570 Performance Turf02-603 Signalization02-700 Traffic Control Signage02-706 Raised Reflective Pavement Markers and Bituminous Adhesive02-711 Thermoplastic Traffic Stripes and MarkingsTechnical SpecificationsCity of DeltonaNormandy Boulevard - Section “B”Utility Relocation and ImprovementsBid No. ITB # PW 13-05Prepared byTetra Tech201 E. Pine Street, Suite 1000Orlando, Florida 32801- 3 -


City of DeltonaRoadway ImprovementsNormandy Boulevard – Section “B”Saxon Boulevard to Fort Smith BoulevardTABLE OF CONTENTSCONSTRUCTION PLANSRoadway Plans – Bowyer-Singleton & Associates, Inc.1 Key Sheet2 Drainage Map3 Typical Sections4 Project Layout5 General Notes6-12 Roadway Plan & Profile Sheets13 Driveway Details14 Drainage Structures15 Drainage Details16-17 Pond Details18 Soil Survey19-33 Roadway Cross Sections34 Stormwater Pollution Prevention Plan34AErosion Control Plan35 Traffic Control Plan36-42 Utility AdjustmentsSigning & Pavement Marking Plans – Bowyer-Singleton & Associates, Inc.S-1 Key SheetS-2 General NotesS-3 – S-9 Signing & Pavement Marking Plan SheetsSignalization Plans – Bowyer-Singleton & Associates, Inc.T-1 Key SheetT-2 General and Pay Item NotesT-3 Signalization Plan SheetsT-4 Internally Illuminated Sign DetailsT-5 Strain Pole ScheduleT-6 Utility Plan SheetWater Main Construction Plans – Tetra Tech, Inc.G-002 General Notes and Drawing IndexG-003 Legend and AbbreviationsG-004 Key MapC-001 to C-008 Plan & ProfilesC-501 to C-504 Detail Sheets- 4 -


Section 00020Announcement and Bid DocumentsForTHE CITY OF DELTONAPUBLIC WORKS DIVISIONITB # PW 13-05Normandy Boulevard (Sec. B)Saxon Boulevard to Fort Smith BlvdNOTICE IS HEREBY GIVEN: That sealed bids will be received by the City of Deltona, Public Works Division, at 255 Enterprise Road,Deltona, Florida 32725; until Tuesday, February 26, 2013 at 2:00 p.m.Any bids received after the above time will not be accepted under any circumstances. Bids will not be accepted at any other locationwithin the City except for the address above. Bids will not be accepted at City Hall. Any uncertainty regarding the time a bid isreceived will be resolved against the Bidder.Bid opening will be promptly at 2:00 p.m. on Tuesday, February 26, 2013 at the Deltona Water Administration 2 nd floor ConferenceRoom, 255 Enterprise Road, Deltona, Florida 32725, at which time all bids received will be publicly opened and read aloud.MANDATORY PRE-BID CONFERENCE: A pre-bid conference will be held at the City of Deltona Water Department located at 255Enterprise Road, Deltona, Florida 32725, 2 nd floor training room on Monday, February 11, 2013 at 10:00 a.m. Representatives of theCity will be present to discuss the Project. Bidders must attend the conference for your bid to be considered. City will transmit to allprospective Bidders of record such Addenda as City considers necessary in response to questions arising at the conference. Oralstatements made by the City may not be relied upon and will not be binding or legally effective.DESCRIPTION OF WORK: All work for the Project shall be constructed in accordance with the Drawings and Specifications preparedby Bowyer-Singleton & Associates, Inc. and the proposed improvements will be awarded and constructed, if award is made, under oneContract. Bids shall be submitted for furnishing, delivering and installing all materials, equipment and services, including labor, for theWork, which generally involves:Reconstruct approx. 0.60 miles of 2 lane rural section roadway on Normandy Blvd. to a 3 lane urban section with bike lanes.Construct 2 drainage retention ponds.Construct approx. 2,912’ of 18” to 30” storm drainage pipe and approx. 35 storm drainage structures.Construct approx. 2,000 linear feet of 8-inch PVC gravity sanitary sewer main, approx. 262 linear feet of 10-inch PVC gravitysanitary sewer main, approx. 13 sanitary sewer manholes, approx. 52 laterals and approx. 3 tie-ins to existing mains ormanholes.Construct approx. 3,555 linear feet of 16-inch PVC/DIP water main, approx. 120 linear feet of 12-inch PVC/DIP water main,approx. 30 linear feet of 8-inch PVC/DIP water main, approx. 1,025 linear feet of 6-inch PVC/DIP water main and approx. 80linear feet of 4-inch PVC/DIP water main, approx. 338 services, approx. 10 tie-ins to existing mains, and various valves,fittings, fire hydrants and appurtenances.Demolition, clearing and grubbing of existing concrete, asphalt and vegetation and restoration of concrete, asphalt, andsodding along water main routes outside the limits of the roadway reconstruction.Grouting and abandonment or removal of existing water main.Striping, signage, pavement markings, temp. traffic control devices and signalization.To obtain a copy of the Bidding Documents, requestors shall contact in writing:Tom CinefroPurchasing Agent for the City of Deltona, Public Works Division255 Enterprise Road, Deltona, Florida 32725Email at tcinefro@deltonafl.govPhone number: 386-878-8955Section 00020 00020- 1


Vendors who receive the bidding documents from the Purchasing Agent directly, shall be added as a planholder on Demandstar andshall receive all corresponding documents through the Demandstar website.Bids shall be prepared from complete Bidding Documents. Addendum will be sent via DemandStar to all holders of completesolicitation Bidding Documents up to forty eight (48) hours before bid time. Brief addendums may be issued between forty eight (48)hours and twenty-four (24) hours before bid time by facsimile to all holders of complete Bidding Documents.The City reserves the right to reject any or all proposals, to waive informalities in the proposals and to re-advertise for proposals. TheCity also reserves the right to separately accept or reject any item or items of a proposal and to award and/or negotiate a contract inthe best interest of the City.All questions are to be directed, IN WRITING, to Brian Boehs at tcinefro@deltonafl.gov or faxed to (386) 878-8971 seven calendardays prior to due date in order to issue an addenda.CONTACT:All prospective proposers are hereby instructed not to contact any member of the City of DeltonaCommission, City Manager, City of Deltona Staff members or Engineers contracted by the City forthis project, other than the noted contact person OR a member of the Purchasing staff regardingthis Item to Bid or their response at any time during the Bid process. Any such contact shall because for rejection of your submittal.• Questions regarding this bid are to be addressed in writing to:Tom CinefroPublic Works Purchasing Agent255 Enterprise RoadDeltona, FL 32725E-Mail Address: tcinefro@deltonafl.govOr Fax: (386) 878-8971END OF SECTIONSection 00020 00020- 2


SECTION 00100GENERAL TERMS, CONDITIONS, INFORMATION AND INSTRUCTIONS TOBIDDERSTABLE OF CONTENTSArticle Title1 - Defined Terms2 - Contact3 - Copies of Bidding Documents4 - Delays5 - Qualifications of Bidders6 - Examination of Bidding Documents and Site7 - Addenda and Interpretations8 - Bid Security9 - Contract Time10 - Liquidated Damages and Indemnity11 - Substitute Material and Equipment12 - Subcontractors, etc.13 - Bid Form14 - Submission of Bids15 - Modification and Withdrawal of Bids16 - Acceptance/Rejection17 - Opening of Bids18 - Bids to Remain Open19 - Certificates, Discounts, Mistakes20 - Discounts21 - Mistakes22 - Award of Contract23 - Additional Terms and Conditions24 - Qualifications Submittals25 - Bonds and Insurance26 - Signing of Agreement27 - Availability of Land for Work28 - Taxes and Fees29 - Related Work Under Separate Contracts30 - Organization of Drawings and Project Manual31 - Required Disclosure32 - Compliance with Occupation Safety and Health Act (O.S.H.A.)33 - Protests34 - Conflict of Interest35 - Legal Requirements36 - Drug-Free Workplace37 - EEO Statement38 - Governmental Restrictions39 - Advertising40 - Assignment41 - Adjustments/Changes/Deviations42 - Purchasing Agreements with other Government AgenciesSection 00100 00100- 1


43 - Certificates, Licenses, Registrations44 - References45 - Submittals46 - Unusual Circumstances47 - Invoicing and Payment48 - Posting of Bid Award49 - Permits, Licenses, Fees50 - Assignment51 - Facilities52 - Bid Preparation Costs53 - Additional Terms and ConditionsSection 00100 00100- 2


SECTION 00300BID RESPONSE FORMBID NO. ITB # PW 13-05Normandy Boulevard (Sec. B)Saxon Blvd to Fort Smith BlvdDATE SUBMITTED: ______________________________________________________________________PROJECT IDENTIFICATION:City of DeltonaITB # PW 13-05Normandy Blvd (Sec. B), Saxon Blvd to Fort Smith BlvdNAME OF BIDDER: ______________________________________________________________________BUSINESS ADDRESS: ___________________________________________________________________TELEPHONE NUMBER: __________________________________________________________________CONTRACTOR’S FLORIDA LICENSE NO.: ___________________________________________________THIS BID IS SUBMITTED TO:City of DeltonaPublic Works Division255 Enterprise RoadDeltona, Florida 327251. In accordance with the foregoing terms, conditions and specifications, the undersigned bidder, having become familiarized with theconditions affecting the cost of the work and with all requirements of the proposed Bid Documents, and duly issued Addenda tosaid documents, as acknowledged herein, proposes to furnish and perform all things required in labor, material, necessary tools,expendable equipment, and all services necessary to perform and complete in a workmanlike manner all work required by saiddocuments and Addenda.2. Bidder accepts all of the terms and conditions of the Advertisement or Invitation to Bid and Instructions to Bidders. This Bid willremain subject to acceptance for ninety (90) days after the day of Bid opening. Bidder will sign and deliver the required number ofcounterparts of the Agreement with the Bonds and other documents required by the Bidding Requirements within ten (10) daysafter the date of Owner’s Notice of Award.3. In submitting this bid, Bidder makes all representations required by the Instructions to Bidders and further warrants and representsthat:a. Bidder has examined and carefully studied the Bidding Documents and the following Addendum receipt of which is herebyacknowledged:No.____________ Dated______________ No.____________ Dated______________No.____________ Dated______________ No.____________ Dated______________No.____________ Dated______________ No.____________ Dated______________No.____________ Dated______________ No.____________ Dated______________b. Bidder is aware of the general nature of Work to be performed by Owner and others at the site that relates to Work for whichthis Bid is submitted as indicated in the Bid Documents, and Addendum.Section 00300 00300-1


c. All Bid items shall include all materials, equipment, labor, permit fees, taxes, tests, miscellaneous costs of all types, overheadand profit for the item to be complete, in place, and ready for operation in the manner contemplated by the Bid Documentsand addendum.d. Bidder declares their bid submittal is genuine and not made in the interest of or on behalf of any undisclosed person, firm orcorporation and is not submitted in conformity with any agreement or rules of any group, association, organization orcorporation; Bidder has not directly or indirectly induced or solicited any other Bidder to submit a false or sham Bid; Bidderhas not solicited or induced any person, firm or corporation to refrain from bidding; and Bidder has not sought by collusion toobtain for itself any advantage over any other Bidder or over Owner.4. Bidder submits the following unit prices to perform all the work as required by the Bid documents and Specifications for theCity of Deltona, Normandy Blvd (Sec. B), Saxon Blvd to Fort Smith Blvd.All bid items shall include all materials, equipment, labor, permit fees, taxes, tests, miscellaneous costs of all types, overhead and profitfor the item to be complete, in place and ready for operation in the manner contemplated by the Bid documents and addendum.Section 00300 00300-2


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Pay Item Description Unit Quantity Unit Cost Total Cost101-1 Mobilization LS 1102-1 Maintenance of Traffic LS 1102-3 Commercial Material for Driveway Maintenance CY 500104-100 Erosion Control Measures LS 1110-1-1 Clearing & Grubbing AC 9110-7-1 Mailbox, F&I, Single EA 23120-1 Regular Excavation CY 16,000120-6 Embankment CY 1,500160-4 Stabilization, Type B SY 17,000285-70-9 Optional Base Group 9 SY 12,050334-1-12 Type SP Structural Course (Traffic Level B) TN 1,326334-7-30 Friction Course (FC-9.5) (Rubber) TN 663400-1-2 Conc. Class I, Endwalls CY 9400-1-11 Conc. Class I, Retaining Walls CY 0425-1-311 Inlets(Curb)(Type P-1)(


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Pay Item Description Unit Quantity Unit Cost Total Cost650-51-313 Traffic Signal (F&I) (3-Section)(1-Way)(Polycarbonate/LED) AS 8653-191 Signal Pedestrian (F&I) (LED Countdown)(1- Way) AS 4653-192 Signal Pedestrian (F&I) (LED Countdown)(2- Way) AS 1659-101 Signal Head Auxuillaries (F&I)(Backplates 3 Section) EA 5659-106 Signal Head Auxuillaries (F&I)(Tunnel Visor) EA 20660-1-103 Loop Detector, Inductive (F&I)(Type 3, 1CH, SS, S) EA 4660-1-104 Loop Detector, Inductive (F&I)(Type 4, 1CH, SS, S) EA 1660-2-106 Loop Assembly (F&I)(Type F) AS 5665-13 Detector, Pedestrian (F&I)(Detector w/ Sign) EA 4670-5-410 Traffic Control Assembly (Modify)(NEMA) AS 1690-10 Traffic Signal Head Assembly, Remove EA 8690-20 Pedestrian Signal Assembly, Remove EA 4690-34-1 Complete Pole removal (Deep) Direct Burial) EA 2690-80 Span Wire Assembly (Remove) EA 1690-90 Remove Cabling and Conduit Pl 1690-100 Signal Equipment, Miscellaneous, Remove Pl 1699-1-1 Internally Illuminated Sign (F&I)(Street Name) EA 4700-20-11 Sign, Single Post (< 12 SF) AS 8700-20-40 Sign, Existing (Relocate) (Single Post) AS 3700-20-60 Sign, Existing (Remove) (Single Post) AS 10700-46-21 Sign, Existing (Relocate) (Single Post) AS 14700-48-48 Sign Panel (Relocate)(15 or less SF) EA 6706-3 Retro-Reflective Pavement Marker EA 291711-11-111 Thermoplastic, Standard, White, Solid, 6" NM 1,139711-11-123 Thermoplastic, Standard, White, Solid, 12" LF 463711-11-125 Thermoplastic, Standard, White, Solid, 24" LF 532711-11-151 Thermoplastic, Standard, DOT Guide, 6" LF 530711-11-160 Thermoplastic, Standard, White, Message EA 15711-11-170 Thermoplastic, Standard, White, Arrow EA 43711-11-211 Thermoplastic, Standard, Yellow, Solid, 6" NM 1,190711-11-224 Thermoplastic, Standard, Yellow, Solid, 18" LF 105711-11-231 Thermoplastic, Standard, Yellow, Skip, 6" GM 0.770711-11-251 Thermoplastic, Standard, Yellow, DOT/Guide, 6" LF 985999-25 Initial Contingency LS 0SUBTOTAL ROADWAY BASE BID $Section 00300 00300-4


City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05ItemNo.Description Quantity Unit Unit Cost Total Cost1 Mobilization/Demobilization 1 LS $20,000.00 $20,000.002 General Requirements, Bonds and Insurance (3%) 1 LS $8,500.00 $8,500.003 Locate Utilities in Advance of Construction 1 LS $3,000.00 $3,000.004 Survey Layout and As-Builts 1 LS $6,000.00 $6,000.005 Furnish and install 4-inch DIP water main (restrained joint) 80 LF $25.00 $2,000.006 Furnish and install 6-inch PVC water main (restrained joint) 710 LF $20.00 $14,200.007 Furnish and install 6-inch PVC water main (push) 115 LF $18.00 $2,070.008 Furnish and install 6-inch DIP water main (restrained joint) 200 LF $35.00 $7,000.009 Furnish and install 8-inch PVC water main (restrained joint) 30 LF $40.00 $1,200.0010 Furnish and install 8-inch PVC water main (push) 0 LF $20.00 $0.0011 Furnish and install 12-inch DIP water main (restrained joint) 120 LF $65.00 $7,800.0012 Furnish and install 16-inch PVC water main (restrained joint) 2340 LF $56.00 $131,040.0013 Furnish and install 16-inch PVC water main (push) 1030 LF $45.00 $46,350.0014 Furnish and install 16-inch DIP water main (restrained joint) 185 LF $80.00 $14,800.0015 Abandon and grout fill existing water main 4920 LF $4.00 $19,680.0016 Removal and disposal existing water main 2100 LF $15.00 $31,500.0017 4-inch Cap 4 EA $100.00 $400.0018 6-inch Cap 2 EA $150.00 $300.0019 8-inch Cap 1 EA $200.00 $200.0020 12-inch Cap 2 EA $300.00 $600.0021 16-inch Cap 1 EA $350.00 $350.0022 4-inch 45 Degree Bend 4 EA $140.00 $560.0023 6-inch 45 Degree Bend 16 EA $170.00 $2,7420.0024 6-inch 22.5 Degree Bend 2 EA $130.00 $260.0025 6-inch 11.25 Degree Bend 3 EA $120.00 $360.0026 8-inch 45 Degree Bend 2 EA $200.00 $400.0027 12-inch 45 Degree Bend 4 EA $400.00 $1,600.0028 16-inch 11.25 Degree Bend 7 EA $850.00 $5,950.0029 16-inch 22.5 Degree Bend 1 EA $850.00 $850.0030 16-inch 45 Degree Bend 34 EA $850.00 $28,900.0031 6-inch Tee 1 EA $225.00 $225.0032 16 x 4-inch Tee 1 EA $750.00 $750.0033 16 x 6-inch Tee 4 EA $850.00 $3,400.0034 16 x 8-inch Tee 1 EA $900.00 $900.0035 16 x 12-inch Cross 1 EA $1,800.00 $1,800.0036 6 x 4-inch Reducer 2 EA $125.00 $250.0037 16 x 12-inch Reducer 1 EA $450.00 $450.0038 4-inch Gate Valve 1 EA $700.00 $700.0039 6-inch Gate Valve 5 EA $800.00 $4,000.00Section 00300 00300-5


ItemNo.City of DeltonaNormandy Boulevard (Section B)Saxon Boulevard To Fort Smith BlvdBid No. ITB # PW 13-05Description Quantity Unit Unit Cost Total Cost40 8-inch Gate Valve 1 EA $1,200.00 $1,200.0041 12-inch Gate Valve 3 EA $2,000.00 $6,000.0042 16-inch Gate Valve 4 EA $4,000.00 $16,000.0043 Air Release Valve 6 EA $4,000.00 $24,000.0044 Fire Hydrant 11 EA $3,500.00 $38,500.0045 1-inch Single Service - Short 13 EA $500.00 $6,500.0046 1-inch Single Service - Long 5 EA $550.00 $2,750.0047 1-inch Double Service - Short 5 EA $700.00 $3,500.0048 1-inch Double Service - Long 14 EA $750.00 $10,500.0049 4-inch Direct Connect & Fitting Assembly – Potable 4 EA $2,000.00 $8,000.0050 6-inch Direct Connect & Fitting Assembly – Potable 2 EA $3,000.00 $6,000.0051 8-inch Direct Connect & Fitting Assembly – Potable 1 EA $4,500.00 $4,500.0052 12-inch Direct Connect & Fitting Assembly – Potable 3 EA $6,500.00 $19,500.0053 Bacterial Sample Location 8 EA $350.00 $2,800.0054 Remove and Replace Concrete Sidewalk SY $10.00 $0.0055 Remove and Replace Concrete Driveway 167 SY $35.00 $5,833.3356 Remove and Replace Concrete Roadway SY $35.00 $0.0057 Testing and Laboratory Services (Allowance) 1 LS $5,000.00 $5,000.00SUBTOTAL UTILITY BASE BID $531,648.33SUBTOTAL UTILITY BASE BID:FIVE HUNDRED THIRTY-ONE THOUSAND SIX HUNDRED FORTY - $531,648.33EIGHT DOLLARS AND THIRTY-THREE CENTS(IN FIGURES)(IN WORDS)SUBTOTAL ROADWAY BASE BID:(IN WORDS)$(IN FIGURES)TOTAL ROADWAY & UTILITY BASE BID:(IN WORDS)$(IN FIGURES)Section 00300 00300-6


1. The following documents are attached to and made a condition of this Bid:1. Bid Response Forms (Bidding Documents, entire Section 00300).2. Bidders Contact and Information Form (Section 00301).3. References (Section 00301-A).4. Questionnaire Form (Section00301-B)5. Sub-Contractors and Affiliates Form (Section 00301-C)6. Bid Bond or security (surety bond or cashier's check). (Section 00410).7. Power of Attorney (for surety bond only).8. Corporate Resolution (any corporate employee other than president or vice-president, Section 00420).9 Sworn Statement Pursuant to Section 287.133(3)(a), Florida Statutes on Public Entity Crimes (Section 00470)10. Non-collusion Affidavit (Section 00480).11. Trench Safety Affidavit (Section 00490).END OF SECTIONSection 00300 00300-7


SECTION 00301BIDDERS CONTACT AND INFORMATION FORMBidder (Company) Name:F. E. I. N. or SS Number:Mailing Address:Street Address:City, State, Zip:City, State, Zip:Type of Entity: (Circle one)Corporation Partnership ProprietorshipJoint VentureI hereby certify that this bid is made without priorunderstanding, agreement, or connection with anycorporation, firm, or person submitting a bid for thesame materials, supplies or equipment, and is in allrespects fair and without collusion or fraud. I agree toabide by all conditions of this bid and certify that I amauthorized to sign this bid for the Bidder.Incorporated in the State of: Year: Typed or Printed Name:X____________________________________________Authorized Signature (Manual)Telephone Number: ( ) Title:Fax Number: ( )Email contact info:This Form Must Be Completed and Returned with your SubmittalSection 00301 00301- 1


SECTION 00301-AReferencesReferences who are located in foreign countries are not acceptable.The Reference Form Must Be Completed and Returned with your Submittal.1. Project Name: __________________________________________________________________________Project Value: __________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: _________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________2. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________3. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________4. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________Section 00301-A 00301-A- 1


5. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________6. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________7. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________8. Project Name: ___________________________________________________________________________Project Value: ___________________________________________________________________________Project Description: _____________________________________________________________________Project Owner: __________________________________________________________________________Project Owner’s contact info: ______________________________________________________________Project Location: ________________________________________________________________________Project Start and End Dates: ______________________________________________________________Section 00301-A 00301-A- 2


SECTION 00301-BQUESTIONNAIRE FORMDATE:PROJECT IDENTIFICATIONCITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”NAME OF BIDDER:_BUSINESS ADDRESS:TELEPHONE NO.:CONTRACTOR’S FLORIDA LICENSE NO.:The undersigned warrants the truth and accuracy of all statements and answers hereincontained. Include additional sheets if necessary.1. How many years has your organization been in business as a GeneralContractor?2. List similar roadway projects that you have undertaken in the most recent threeyear period. Identify the Owner and a Contact Person:Project Municipality / Owner Contact Name/Number3. Have you ever failed to complete work awarded to you? If so, where and why?4. Name three (3) municipalities for which you have performed similar roadwayprojects and to which you refer:Section 00301-B00301-B-1


5. Have you personally inspected the site of the proposed Work? Describe anyanticipated problems with the site and your proposed solutions.6. Will you Subcontract any part of this Work? If so, describe which portion(s).7. What equipment do you own that is available for the Work?8. What equipment will you purchase for the Work?9. What equipment will you rent for the Work?10. The following is given as a summary of the Financial Statement of theundersigned: (List Assets and Liabilities and use insert sheet if necessary.)11. State the true and exact, correct, and complete name under which you dobusiness.Bidder is:END OF SECTIONSection 00301-B00301-B-2


SECTION 00301-CSub Contractors and Affiliates FormThe following are a list of Sub Contractors or Affiliates that will be utilized in this project. Use additionalsheets if necessary.FIRM NAMETRADETELEPHONEAND FAXNUMBER( )( )( )( )( )( )( )( )( )( )( )( )( )( )In the event our firm is awarded this bid, the City of Deltona will be notified of any changes made tothis Sub Contractors list before and during any and all work performed during this project.The Sub-Contractor listing Form Must Be Completed and Returned with your Submittal.Section 00301-C00301-C-1


SECTION 00301-DDRUG-FREE WORK PLACE FORMThe undersigned Bidder in accordance with Florida Statute 287.087, hereby certifies that____________________________________ does:(Name of Business)1. Publish a statement notifying employees that the unlawful manufacture, distribution, dispensing, possession,or use of a controlled substance is prohibited in the workplace and specifying the actions that will be takenagainst employees for violations of such prohibition.2. Inform employees about the dangers of drug abuse in the workplace, the business's policy of maintaining adrug-free workplace, any available drug counseling, rehabilitation, and employee assistance programs, andthe penalties that may be imposed upon employees for drug abuse violations.3. Give each employee engaged in providing the commodities or contractual services that are proposed a copyof the statement specified in subsection (1).4. In the statement specified in subsection (1), notify the employees that, as a condition of working on thecommodities or contractual services that are under bid, the employee will abide by the terms of thestatement and will notify the employer of any conviction of, or plea of guilty or nolo contendere to, anyviolation of Chapter 893 or of any controlled substance law of the United States or any state, for a violationoccurring in the workplace no later than five (5) days after such conviction.5. Impose a sanction on, or require the satisfactory participation in a drug abuse assistance or rehabilitationprogram if such is available in the employee's community, by any employee who is so convicted.6. Make a good faith effort to continue to maintain a drug-free workplace through implementation of thissection.As the person authorized to sign the statement, I certify that this firm complies fully with the above requirements.XBidder's SignatureDateThis Form Must Be Completed and Returned with your Submittal, if applicableSection 00301-D 00301-D -1


SECTION 00301-EHOLD HARMLESS AND INDEMNITY AGREEMENT____________________________, agrees through the signing of this document by an authorized party or agent thatit shall defend, indemnify and hold harmless the City of Deltona, and its agents, employees, and public officials fromand against all suits, losses, claims, demands, judgments of every name and description arising out of or incidental tothe performance of this contract or work performed thereunder, whether or not due to or caused by the negligence ofthe City of Deltona, its agents, employees, and public officials excluding only the sole negligence of the City ofDeltona, its agents, employees, and Public Officials.This provision shall also pertain to any claims brought against the City of Deltona, its agents, employees, and publicofficials by an employee of the named Contractor, any Sub-contractor, or anyone directly or indirectly employed byany of them.The Contractor’s obligation to indemnify the City of Deltona, its agents, employees and public officials under thisprovision shall be limited to $1,000,000 per occurrence which the parties agree bears a reasonable commercialrelationship to the contract.The Contractor agrees to accept, and acknowledges as adequate remunerations, the consideration of $10, which ispart of the agreed bid price, the promises contained herein, and other good and valuable consideration, the receipt ofwhich is hereby acknowledged, for agreement to enter into this Hold Harmless and Indemnity Agreement.________________________________CONTRACTOR_______________________________DATEThis Form Must Be Completed and Returned with your Submittal.Section 00301-E00301-E-1


SECTION 00301-FStatement of No BidBid No.: ITB # PW 13-05 Normandy Blvd (Sec B) Saxon Blvd. to Fort Smith BlvdIf your company does not intend to bid on this Procurement, please complete and return this form prior to the dateshown for receipt of bids to: PUBLIS WORKS DIVISION, CITY OF DELTONA, Purchasing Agent, 255 EnterpriseRoad, Deltona, FL 32725.We, the undersigned, have declined to bid on the above referenced Invitation to Bid for the following reason(s):Specifications are too "restrictive." (Please explain below)Unable to meet specificationsSpecifications were unclear. (Please explain below)Insufficient time to respondWe do not offer this type of product or equivalentOur production schedule would not permit us to performUnable to meet bond requirementsOther (please explain below)REMARKS:XCompany NameSignatureTelephoneFaxTitleTyped or Printed NameAddress City State ZipSection 00301-F00301-F-1


SECTION 00410BID BONDKNOW ALL MEN BY THESE PRESENTS, that we, the undersigned,__________________________ as Principal, and __________________________ asSurety , are hereby held and firmly bound unto the City of Deltona, Florida as Owner inthe penal sum of, (five percent 5%) of the Contract Bid)________________________________ for the payment of which, well and truly to bemade, we hereby and severally bind ourselves, successors and assigns to pay Ownerupon default of Bidder the penal sum set forth on the face of this Bond.Signed, this day of , 20__.The condition of the above obligation is such that whereas the Principal has submittedto City of Deltona, Florida a certain Bid, attached hereto and hereby made a part hereof,to enter into a contract in writing, for Roadway Improvements.NOW THEREFORE,1. Default of Bidder shall occur upon the failure of Bidder to deliver within the timerequired by the Bidding Documents the executed Agreement required by theBidding Documents and any performance and payment bonds required by theBidding Documents and Contract Documents.2. This obligation shall be null and void if:2.1 Owner accepts Bidder’s bid and Bidder delivers within the timerequired by the Bidding Documents (or an extension thereof agreedto in writing by Owner) the executed Agreement required by theBidding Documents and any performance and payment bondsrequired by the Bidding Documents and Contract Documents, or2.2 All bids are rejected by Owner, or2.3 Owner fails to issue a notice of award to Bidder within the timespecified in the Bidding Documents (or any extension thereof agreedto in writing by Bidder and, if applicable, consented to by Suretywhen required by paragraph 5 hereof).3. Payment under this Bond will be due and payable upon default of Bidder andwithin thirty (30) calendar days after receipt of Bidder and Surety of written noticeof default from Owner which notice will be given with reasonable promptness,identifying this Bond and the Project and including a statement of the amountdue.Section 00410-1 00410-1


4. Surety waives notice of any and all defenses based on or arising out of any timeextension to issue notice of award agreed to in writing by Owner and Bidder,providing that the time for issuing notice of award including extensions shall notin the aggregate exceed one hundred twenty (120) days from Bid Due withoutSurety’s written consent.5. No suite or action shall be commenced under this Bond prior to thirty (30)calendar days after the notice of default required in paragraph 3 above isreceived by Bidder and Surety, and in no case later than one year after Bid DueDate.6. Any suite or action under this Bond shall be commenced only in a court ofcompetent jurisdiction located in the state in which the Project is located.7. Notice required hereunder shall be in writing and sent to Bidder and Surety attheir respective addresses shown on the face of this Bond. Such notices may besent by personal delivery, commercial courier or by United States Registered orCertified Mail, return receipt requested, postage pre-paid, and shall be deemedto be effective upon receipt by the part concerned.8. Surety shall cause to be attached to this Bond a current and effective Power ofAttorney evidencing the authority of the officer, agent or representative whoexecuted this Bond on behalf of Surety to execute, seal and deliver such Bondand bind the Surety thereby.9. This bond is intended to conform to all applicable statutory requirements. Anyapplicable requirement of any applicable statute that has been omitted from thisBond shall be deemed to be included herein as if set forth at length. If anyprovision of the Bond conflicts with any applicable provision of any applicablestatue, then the provision of said statute shall govern and the remainder of theBond that is not in conflict therewith shall continue in full force and effect.10. The term “bid” as used herein includes a bid, offer or proposal as applicable.Section 00410-1 00410-2


IN WITNESS WHEREOF, the Principal and the Surety have hereunto set their handsand seals, and such of them as are corporations have caused their corporate seals tobe hereto affixed and these presents to be signed by their proper officers, the day andyear first set forth above.Principal (Print Full Name):Surety (Print Full Name):(Seal)Surety’s Name and Corporate SealBy:Title:(LS) By:Signature (attach power of attorney)Title:Attest:Signature and TitleAttest:Signature and Title(Date)IMPORTANT – Surety companies executing bonds must appear on the TreasuryDepartment’s most current list (Circular 570 as amended) and be authorized to transactbusiness in the State of Florida. See Article 5 of the General Conditions as amended bySupplementary Conditions.END OF SECTIONSection 00410-1 00410-3


SECTION 00420CORPORATE RESOLUTIONI, , Secretary of, a corporation organized and existing under the laws of the state of, hereby certify that at a meeting of the Board of Directors of the Corporation dulycalled and held on _______________, 20__ at which a quorum was present and actingthroughout, the following resolutions were adopted and are now in full force and effect:RESOLVED that the following individuals of this corporation are authorized to executeon behalf of this corporation a Bid and Agreement tofor the constructionof Roadway improvements on Fort Smith Boulevard (Section 2).I further certify that the names of the officers of this corporation and any other personsauthorized to act under this resolution and their official signatures are as follows:NAME OFFICE OFFICIAL SIGNATUREIN WITNESS THEREOF, I have hereunto subscribed my name as Secretary and affixedthe seal of the corporation this day of , 20 __.END OF SECTIONSection 00420 00420-1


SECTION 00470SWORN STATEMENT UNDER SECTION 287.133(3)(A), FLORIDA STATUTES, ON PUBLIC ENTITY CRIMESTHIS FORM MUST BE SIGNED IN THE PRESENCE OF A NOTARY PUBLIC OR OTHER OFFICER AUTHORIZEDTO ADMINISTER OATHS.This sworn statement is submitted to the City of Deltona by _____________________________________________(Individual’s name and title)For_____________________________________________________________________________________________________________(Name of entity submitting sworn statement)Whose business address is_____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________And (if applicable) its Federal Employer Identification Number (FEIN) is ____________________________________(if the entity has no FEIN, include the Social Security Number of the individual signing this sworn statement)1. I understand that a “public entity crime” as defined in Section 287.133(1)(g), Florida Statutes, means aviolation of any State or Federal law by a person with respect to and directly related to the transaction ofbusiness with any public entity or with an agency or political subdivision of any other state or with the UnitedStates, including, but not limited to, any bid or contract for goods or services to be provided to any publicentity or an agency or political subdivision of any other state or a of the United States and involving antitrust,fraud, theft, bribery, collusion, racketeering, conspiracy, or material misrepresentation.1. I understand that “convicted” or “conviction” as defined in Paragraph 287.133(1)(b), Florida Statutes, meansa finding of guilt or a conviction of a public entity crimes, with or without an adjudication of guilt, in anyFederal or State trial court of record relating to charges brought by indictment or information after July 1,1989, as a result of a jury verdict, non-jury trial, or entry of a plea of guilty or nolo contendere.2. I understand that an “affiliate’ as defined in Section 287.133(1)(a), Florida Statutes, means:A predecessor or successor of a person convicted of a public entity crime: or an entity under the control ofany natural person who is active in the management of the entity and how has been convicted of a publicentity crime. The term “affiliate” includes those officers, directors, executives, partners, shareholders,employees, members, and agents who are active in the management of an affiliate. The ownership by one(1) person of shares constituting a controlling interest in another person, or a pooling of equipment orincome among persons when not for fair market value under an arm’s length agreement, shall be a primafacie case that one person controls another person. A person who knowingly enters into a joint venture witha person who has been convicted of a public entity crime in Florida during the preceding thirty-six (36)months shall be considered an affiliate.3. I understand that a “person” as defined in Section 287.133(1)(e), Florida Statutes, means any naturalperson or entity organized under the laws of any state or of the United States with the legal power to enterinto a binding contract and which bids or applies to bid on contracts for the provision of goods or services letby a public entity, or which otherwise transacts or applies to transact business with a public entity. The term“person” includes those officers, directors, executives, partners, shareholders employees, members, andagents who are active in management of an entity.Section 00470 00470- 1


4. Based on information and belief, the statement which I have marked below is true in relation to the entitysubmitting this sworn statement. (You must indicate which statement applies.)__________ Neither the entity submitting this sworn statement, nor any officers, directors, executives, partners,shareholders, employees, members, or agent who is active in management of the entity, nor the affiliate of the entityhas been charged with and convicted of a public entity crime subsequent to July 1, 1989.__________ The entity submitting this sworn statement, or one or more of the officers, directors, executives,partners, shareholders, employees, members or agent who are active in management of the entity, or an affiliate ofthe entity, has been charged with and convicted of a public entity crime subsequent to July 1, 1989.__________ The entity submitting this sworn statement, or one or more of the officers, directors, executives,partners, shareholders, employees, members or agents who are active in management of the entity, or an affiliate ofthe entity, has been charged with and convicted of a public entity crime subsequent to July 1, 1989. However, therehas been a subsequent proceeding before an Administrative Law Jury of the State of Florida, Division ofAdministrative Hearings and the Final Order entered by the Administrative Law Jury determined that it was not inthe public interest to place the entity submitting this sworn statement on the convicted vendor list. (You must attacha copy of the final order).I UNDERSTAND THAT THE SUBMISSION OF THIS FORM TO THE CITY OF DELTONA IS FOR THE CITY ONLYAND, THAT THIS FORM IS VALID THROUGH DECEMBER 31, OF THE CALENDAR YEAR IN WHICH IT ISFILED. I ALSO UNDERSTAND THAT I AM REQUIRED TO INFORM THE CITY PRIOR TO ENTERING IN TO ACONTRACT IN EXCESS OF THE THRESHOLD AMOUNT PROVIDED IN SECTION 287.017, FLORIDASTATUTES, FOR CATEGORY TWO OF ANY CHANGE IN THE INFORMATION CONTAINED IN THIS FORM.____________________________________________________________SIGNATURE____________________________________________________________DATEState of ________________________________County of ______________________________Personally appeared before me, the undersigned authority, _____________________________(name of individualsigning) who, after first being sworn by me, affixed his/her signature in the space provided above on the ____ day of_______________, 20 ___.____________________________________________________________NOTARY PUBLICMy commission expires:This Form Must Be Completed and Returned with your SubmittalSection 00470 00470- 2


SECTION 00480NON COLLUSION AFFIDAVIT FORMSTATE OF FLORIDACOUNTY OF VOLUSIA_________________________________________, being first duly sworn deposes and says that:1. He (it) is the __________________________________________________________________, of_______________________________, the Bidder that has submitted the attached Bid;2. He is fully informed respecting the preparation and contents of the attached Bid and of all pertinentcircumstances respecting such Bid;3. Such Bid is genuine and is not a collusive or sham Bid;4. Neither the said Bidder nor any of its officers, partners, owners, agents, representatives, employees, orparties in interest, including this affidavit, have in any way, colluded, conspired, connived or agreed, directlyor indirectly, with any other Bidder, firm or person to submit a collusive or sham Bid in connection with theContract for which the attached Bid has been submitted; or to refrain from bidding in connection with suchContract; or have in any manner, directly or indirectly, sought by agreement or collusion,, or communication,or conference with any Bidder, firm, or person to fix the price or prices in the attached Bid or of any otherBidder, or to fix any overhead, profit, or cost elements of the Bid price or the Bid price of any other Bidder, orto secure through any collusion, conspiracy, connivance, or unlawful agreement any advantage against(Recipient), or any person interested in the proposed Contract;5. The price or prices quoted in the attached Bid are fair and proper and are not tainted by any collusion,conspiracy, connivance, or unlawful agreement on the part of the Bidder or any other of its agents,representatives, owners, employees or parties in interest, including this affidavit.By _____________________________Sworn and subscribed to before me this _____ day of ____________________, 20____, in the State of_____________________, County of ___________________.________________________________ Notary PublicMy Commission expires:This Form Must Be Completed and Returned with your SubmittalSection 00480 00480- 1


SECTION 00490TRENCH SAFETY AFFIDAVITTrench excavations on this Project are expected to be in excess of 5 feet deep. TheOccupational Safety and Health Administration excavation safety standards, 29 CFR1926.650 Subpart P Trench Safety Standards will be in effect during the period ofconstruction of the Project.Bidder acknowledges that included in the Bid Price are costs for complying with theFlorida Trench Safety Act (90-096, Laws of Florida) effective October 1, 1990, andhereby gives assurance that, if awarded the Contract, the Contractor or Subcontractorperforming trench excavation work on the Project will comply with the applicable trenchsafety standards. The Bidder further identified the costs as follows:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION BTrench Safety Item (description)Unit Cost(Cost in Words)Total: $FAILURE TO COMPLETE THE ABOVE SHALL RESULT IN THE BID BEINGDECLARED NON-RESPONSIVE.COMPANY NAME:DATE:BY:END OF SECTIONSection 00490 00490- 1


Section 00500SAMPLE ONLY (FOR INFORMATION PURPOSES ONLY)AGREEMENT BETWEEN CITY OF DELTONA AND{CONTRACTOR}PER ITB # PW 13-05THIS AGREEMENT is made and entered into this day of _____________, 201_ by and between theCITY OF DELTONA, a municipality of the State of Florida, whose address is 2345 Providence Boulevard, Deltona,Florida 32725, hereinafter called the "City” and {NAME OF COMPANY}, duly authorized to conduct business inthe State of Florida, whose principal address is {ADDRESS}, hereinafter called the "Contractor".WHEREAS, the City desires to obtain services related to NORMANDY BOULEVARD- SECTION Bper ITB No. PW 13-05. The work generally involves all work as described in the ITB documents, specifications,drawings and any addendum issued for this project.SAMPLEWHEREAS, Contractor is competent and qualified to furnish said services to the City and desires to provideWHEREAS, the City requested and received expressions of interest from several companies to provide theseservices; andits services for this project,ONLYWHEREAS, the Commission of the City of Deltona has approved award of this agreement on {DATE}.NOW, THEREFORE, IN CONSIDERATION of the mutual terms, understandings, conditions,premises, covenants and payment hereinafter set forth, and intending to be legally bound, the parties hereby agreeas follows:Article 1. RecitalsThe foregoing recitals are true and correct and incorporated herein by reference.Article 2. Scope of Services2.1 Pursuant to the terms and conditions set forth in this Agreement, City hereby engages Contractor toperform services related to NORMANDY BOULEVARD – SECTION B per ITB No. PW 13-05, attached heretoand incorporated herein by reference, and Contractor’s Proposal dated {DATE}.2.2 The services, as described in ITB No. PW- 13-05, to be rendered by the Contractor, shall commence uponissuance of a Notice to Proceed and be completed as needed by the City.2.3 The services to be rendered by the Contractor shall include all labor, materials, equipment and incidentalsnecessary to perform all work indicated and specified in the ITB documents.Section 00500 00500- 1


2.4 Contractor has familiarized itself with the nature and extent of the contract documents, work, site, locality,and all local conditions and laws and regulations that in any manner may affect cost, progress, performance orfurnishing of the work.2.5 Contractor has obtained and carefully studied (or assumes responsibility for obtaining and carefullystudying) all examinations, investigations, explorations, tests, reports and studies which pertain to the subsurfaceor physical conditions at or contiguous to the site or otherwise may affect the cost, progress, performance orfurnishing of the work as Contractor considers necessary for the performance or furnishing of the work at thecontract price, within the contract time and in accordance with the other terms and conditions of the contractdocuments and no additional examinations, investigations, explorations, tests, reports, studies or similarinformation or data are or will be required by Contractor for such purposes.2.6 Contractor acknowledges that nothing herein shall be deemed to preclude the City from retaining theservices of other persons or entities undertaking the same or similar services as those undertaken by theContractor or from independently developing or acquiring materials or programs that are similar to or competitiveSAMPLEwith, the services provided under this Agreement.2.7 Contractor shall be responsible for obtaining all required federal, state or local permits required tocomplete the scope of work under this agreement.ONLY2.8 Contractor shall be responsible for the quality of work performed. Contractor shall, without additionalcompensation, correct or revise any errors or deficiencies in his services.2.9 Contractor agrees to provide a one year maintenance period to correct any defective work that may befound within the one year period from the time of completion.Article 3. Payment3.1 The City agrees to compensate Contractor for work performed, completed and accepted by the City’srepresentative for services provided for this project at a total cost not to exceed the amounts submitted by theContractor within ITB # PW 13-05. Fees for any additional work needed will be agreed upon in writing prior toany service being completed.3.2 Invoices shall be submitted in duplicate to the City of Deltona, Accounts Payable, 2345 Providence Blvd.,Deltona, FL 32725. Each invoice shall contain the purchase order number and a detailed description of servicesand fees.3.3 The City shall make payment on all invoices in accordance with the Florida Prompt Payment Act, sections218.70 through 218.79, Florida Statutes.3.4 The City shall make all payments on the basis of the work completed and accepted by the City.Section 00500 00500- 2


3.5 The Contractor shall not be entitled to payment for any other expenses, fees, or other costs it may incur atany time and in any connection with its performance hereunder. The Contractor hereby agrees that the total costis inclusive of all overhead and administrative expenses.3.6 In the event a specific project is to be funded by state or federal monies, the Contractor hereby agrees tocomply with all requirements of the state or federal government applicable to the use of the monies, includingreceiving no payment until all required forms are completed, submitted, and approved by the City.Article 4. Special Terms and Conditions4.1 Qualifications. Firms or individuals shall be registered with the State of Florida and have obtained at leastthe minimum thresholds of education and professional experience required by Florida Statutes to perform theservices contained herein.4.2 Termination. This Agreement may be terminated by the City upon thirty (30) days advance written noticeto the Contractor; but if any work is in progress but not completed as of the date of termination, then thisAgreement may be extended upon written approval of the City until said work is completed by the Contractor andaccepted by the City.SAMPLEA. Upon notification to the Contractor of termination by the City, Contractor will immediatelydiscontinue all services affected unless the notice directs otherwise.B. Termination for Convenience. In the event this Agreement is terminated or cancelled upon therequest and for the convenience of City, City shall reimburse Contractor for actual worksatisfactorily completed.ONLYC. Termination for Cause. If the termination of this Agreement is due to the failure of the Contractorto fulfill his contractual obligations, City shall reimburse Contractor for actual work satisfactorilycompleted, and City may take over the work and prosecute the same to completion by Agreementor otherwise.D. In the event of termination of this Agreement, all work, reports, and other work product producedby Contractor in connection with the Agreement shall be returned to the City and become andremain the property of the City.4.3 Assignment. This Agreement may not be assigned or transferred in any manner by Contractor and anysuch assignment is expressly prohibited. Any attempt to assign this Agreement shall render this Agreement nulland void.4.4 Insurance and Bond. The City of Deltona will purchase Builders’ Risk Insurance. Contractor shallprovide and maintain, during the entire term of this Agreement, without cost to the City, insurance in thefollowing types and limits with a company or companies authorized to do business in the State of Florida andrated “Class A” or better by A. M. Best or some other form of assurance approved by the City’s Risk Manager.Section 00500 00500- 3


Contractor shall not commence work under the Agreement until City has received an acceptable certificate orcertificates of insurance evidencing the required insurance, which is as follows:(A)General Liability insurance on forms no more restrictive than the latest edition of the CommercialGeneral Liability policy (CG 00 01 or CG 00 02) of the Insurance Services Office or equivalent withoutrestrictive endorsements, with the following minimum limits and coverage:(B)(C)General LiabilityEach Occurrence/General Aggregate $1,000,000Products-Completed Operations $1,000,000Premises Operation $1,000,000Personal & Adv. Injury $1,000,000Professional Liability $1,000,000Blanket Contractual Liability $1,000,000Fire Damage $50,000Automobile liabilitySAMPLEinsurance, including owned, non-owned and hired autos with the followingminimum limits and coverage:Combined Single Limit $1,000,000OrBodily Injury (per person) $1,000,000Bodily Injury (per accident) $1,000,000Property Damage $100,000ONLYWorkers' compensation insurance in accordance with Florida Statute, Chapter 440, and/or anyother applicable law requiring workers' compensation (Federal, maritime, etc).Additional Requirements:(1) City of Deltona, a municipality of the State of Florida, shall be named as an additionalinsured on the General liability policy.(2) Certificates of insurance shall provide for a minimum of thirty (30) days prior written notice tothe City of any material change or cancellation of the required insurance, with ten (10) day written noticeof cancellation due to non-payment of premium.(3) Certificates of insurance shall identify the Bid number, contract, project, etc. in theDescription of Operations section of the Certificate.(4) Contractor shall be responsible for subcontractors and their insurance.(5) The Certificate holder section of each policy shall state: City OF DELTONA, AMUNICIPALITY OF THE STATE OF FLORIDA, 2345 PROVIDENCE BOULEVARD, DELTONA,FLORIDA 32725.Section 00500 00500- 4


(6) Contractor shall be solely responsible for all deductibles and self-insurance retention onContractor Liability Insurance policies. All of the policies of insurance so required to be purchased andmaintained shall contain a provision or endorsement that the coverage afforded shall not be canceled,materially changed or renewal refused without thirty (30) calendar days written notice, or without ten (10)days written notice of cancellation due to non-payment of premium, being given to City by certified mail.4.5 Indemnity. Contractor shall indemnify and hold City and its agents, officers, commission, or employeesharmless for any damages resulting from failure of Contractor to take out and maintain the above insurance.Additionally, Contractor agrees to indemnify, and hold the City, and its officers, commission, employees andagents free and harmless from and against any and all losses, penalties, damages, settlements, costs, charges,professional and attorney fees, court costs, other expenses and liabilities to the extent resulting from the negligentact, error or omission of Contractor, its agents, employees or representative, in the performance of Contractor’sduties set forth in this Agreement.4.6 Independent Contractor. Contractor agrees that it shall be acting as an independent contractor and shall notbe considered or deemed to be an agent, employee, joint venturer, or partner of City. Contractor shall have noauthority to contract for or bind City in any manner and shall not represent itself as an agent of City or asotherwise authorized to act for or on behalf of City.SAMPLE4.7 Ownership of Deliverables.(a) Title to all work product produced by Contractor pursuant to this Agreement shall be and remain thesole and exclusive property of CityONLYwhen produced. Contractor shall deliver all such original work product toCity upon completion thereof unless it is necessary for Contractor, in City’s sole discretion to retain possessionfor a longer period of time.(b) The documents, reports, and similar materials provided or created by Contractor are public recordsand Contractor shall abide by applicable requirements of Florida law. Contractor shall notify the City within 24hours of receiving the request to release the information concerning the subject project to a member of the mediaand/or to the public. The City’s notification shall to the extent possible provide the name, date, time and type ofinformation requested to be released prior to the Contractor’s release or disclosure of information to the media orto the public.4.8 Return of Materials. Upon the request of the City, but in any event upon termination of this Agreement,Contractor shall surrender to the City all memoranda, notes, records, and other documents or materials pertainingto the services hereunder, that were furnished to the Contractor by the City pursuant to this Agreement.Contractor may keep copies of all work products for its records.4.9 NO CLAIM FOR DAMAGES OR ANY CLAIM OTHER THAN FOR AN EXTENSION OF TIMESHALL BE MADE OR ASSERTED AGAINST THE CITY BY REASON OF ANY DELAYS. Nointerruption, interference, inefficiency, suspension or delay in the commencement or progress of the work fromany cause whatsoever, shall relieve the Contractor of his duty to perform or give rise to any right to damages oradditional compensation from the City. The Contractor expressly acknowledges and agrees that the ContractorSection 00500 00500- 5


shall receive no damages for delay. The Contractor’s sole remedy, if any, against the City shall be the right toseek an extension to the contract time.4.10 Retaining Other Contractors by City. Nothing herein shall be deemed to preclude the City from retainingthe services of other persons or entities undertaking the same or similar services as those undertaken by theContractor or from independently developing or acquiring materials or programs that are similar to or competitivewith, the services provided under this Agreement.4.11 Accuracy. The Contractor is responsible for the professional quality, technical accuracy, timelycompletion and coordination of all the services furnished hereunder. The Contractor shall, without additionalcompensation, correct or revise any errors, omissions or other deficiencies in its services.4.12 Codes and Regulations. All work completed under this Agreement shall at all times comply with allapplicable federal, state and local statutes, codes, regulations and ordinances.4.13 Public Entity Crimes. A person or affiliate who has been placed on the convicted vendor list following aconviction of a public entity crime may not be awarded or perform work as a contractor, supplier, subcontractor,or engineer under a contract with any public entity in excess of the threshold amount provided in Florida Statutes,section 287.017 for Category Two for a period of thirty-six (36) months from the date of being placed on theconvicted vendor list.SAMPLE4.14 Prohibition against Contingent Fees. Contractor warrants that they have not employed or retained anycompany or person, other than a bonaONLYfide employee working solely for the Contractor to solicit or secure thisAgreement and that they have not paid or agreed to pay any person, company, corporation, individual, or firm,other than a bona fide employee working solely for the Contractor, any fee, commission, percentage, gift or otherconsideration contingent upon or resulting from the award or making of this Agreement.Article 5. General Conditions5.1 This Agreement is made under, and in all respects shall be interpreted, construed, enforced, and governedby and in accordance with, the laws of the State of Florida. Venue for any legal action resulting from thisAgreement shall lie solely in Volusia County, Florida.5.2 No modification, amendment or alteration in the terms or conditions contained herein shall be effectiveunless contained in a written document executed with the same formality and of equal dignity herewith. The Citymay make changes in the services at any time by giving written notice to Contractor. If such changes increase(additional services) or decrease (eliminate any amount of work) in the scope of work, City and Contractor shallmodify this agreement through issuance of a change order. All change orders shall be authorized in writing byCity prior to commencing or reducing any term of this agreement.5.3 Neither the City’s review, approval or acceptance of, nor payment for, any of the services required shallbe construed to operate as a waiver of any rights under this Agreement or of any cause of action arising out of theperformance of this Agreement and the Contractor shall be and remain liable to the City in accordance withSection 00500 00500- 6


applicable law for all damages to the City caused by the Contractor’s performance of any of the servicesfurnished under this Agreement.5.4 In the event Contractor, during the course of the work under this Agreement, requires the services of anySub-Contractor or other professional associates in connection with service covered by this Agreement, Contractormust secure the prior written approval of the City. If Sub-Contractors or other professional associates arerequired in connection with the services covered by this Agreement, Contractor shall remain fully and solelyresponsible for the services of and monies owed to Sub-Contractors or other professional associates.5.5 It is recognized that questions in the day-to-day conduct of performance pursuant to this Agreement willarise. The City, upon request by Contractor, shall designate in writing and shall advise Contractor in writing ofone (1) or more City employees to whom all communications pertaining to the day-to-day conduct of theAgreement shall be addressed. The designated representative shall have the authority to transmit instructions,receive information and interpret and define the City’s policy and decisions pertinent to the work covered by thisAgreement.SAMPLE5.6 No claim for services furnished by the Contractor not specifically provided for herein shall hold the Cityliable or be honored by the City.ONLY5.8 The Contractor hereby certifies that no officer, agent or employee of the City has any material interest (as5.7 The Contractor agrees that it will not engage in any action that would create a conflict of interest in theperformance of its obligations pursuant to this Agreement with the City or which would violate or cause others toviolate the provisions of Part III, Chapter 112, Florida Statutes, relating to ethics in government.defined in Section 112.312(15), Florida Statutes, as over 5%) either directly or indirectly, in the business of theContractor to be conducted here, and that no such person shall have any such interest at any time during the termof this Agreement.5.9 The captions utilized in this Agreement are for the purposes of identification only and do not control oraffect the meaning or construction of any of the provisions hereof.5.10 This Agreement shall be binding upon and shall inure to the benefit of each of the parties and of theirrespective successors and permitted assigns. Nothing in this Agreement is intended or shall be deemed to conferany rights or benefits upon any entity or person other than the parties hereto or to make or render any such otherentity or person a third-party beneficiary of this Agreement.5.11 This Agreement may not be amended, released, discharged, rescinded or abandoned, except by a writteninstrument duly executed by each of the parties hereto.5.12 The failure of any party hereto at any time to enforce any of the provisions of this Agreement will in noway constitute or be construed as a waiver of such provision or of any other provision hereof, nor in any wayaffect the validity of, or the right thereafter to enforce, each and every provision of this Agreement.5.13 During the term of this Agreement Contractor assures City that it is in compliance with Title VII of the1964 Civil Rights Act, as amended, and the Florida Civil Rights Act of 1992, in that Contractor does not on theSection 00500 00500- 7


grounds of race, color, national origin, religion, sex, age, disability or marital status, discriminated in any form ormanner against Contractor employees or applicants for employment. Contractor understands and agrees that thisAgreement is conditioned upon the veracity of this statement of assurance.Article 6. Severability and Notice6.1 The invalidity or unenforceability of any particular provision of this Agreement shall not affect the otherprovisions hereof, and this Agreement shall be construed in all respects as if such invalid or unenforceableprovisions were omitted.6.2 Wherever provision is made in this Agreement for the giving, service or delivery of any notice, statementor other instrument, such notice shall be in writing and shall be deemed to have been duly given, served anddelivered, if delivered by hand or mailed by United States registered or certified mail or sent by facsimile,addressed as follows:SAMPLECity of DeltonaONLYIf to Contractor:If to City:{NAME}_________________{TITLE}Public Works Utilities Director{COMPANY NAME}{ADDRESS}2345 Providence Blvd.{CITY, STATE, ZIP} Deltona, Florida 32725Each party hereto may change its mailing address by giving to the other party hereto, by hand delivery, UnitedStates registered or certified mail notice of election to change such address.Article 7. Scope of Agreement7.1 This Agreement is intended by the parties hereto to be the final expression of their Agreement, and itconstitutes the full and entire understanding between the parties with respect to the subject hereof,notwithstanding any representations, statements, or agreements to the contrary heretofore made.7.2 This Agreement consists of the following:This AgreementNotice of Award and Notice to ProceedITB DocumentsAddendum, if anyContractor’s Response to ITB(REMAINDER OF PAGE INTENTIONALLY LEFT BLANK)Section 00500 00500- 8


IN WITNESS WHEREOF, the parties hereto have made and executed this Agreement for the purposes statedherein.ATTEST:CONTRACTOR:__________________________Secretary(CORPORATE SEAL)______________________________President______________________________DateATTEST:SAMPLECITY OF DELTONA___________________________JOYCE KENTCity ClerkONLY___________________________FAITH G. MILLERCity Manager_________________________DateApproved as to Form and Legality:______________________________GARY J. COONEYCity AttorneySection 00500 00500- 9


SECTION 00650CERTIFICATE OF INSURANCEA. INSURANCE REQUIREMENTS1. Contractor shall purchase and maintain such comprehensive generalliability and other insurance as required by the General Conditions andmodified by the Supplementary Conditions. Should any of the requiredinsurance policies be canceled before the expiration date thereof, theinsuring company shall provide written notice to each insured 30 daysprior to cancellation.B. CERTIFICATE OF INSURANCE FORM1. The Certificate of Insurance submitted to the Owner and Engineer shall beon the Insurance Company's form with a format similar to the popularACORD Corporation form.2. The Owner, Engineer and Engineer's Subconsultants as provided inSection 0800: Supplementary Conditions, shall be shown as additionalinsureds.3. The Owner's project name and project number shall be shown on theCertificate.4. Six (6) Certificates shall be submitted along with the executed ContractAgreement and Performance and Payment Bonds.END OF SECTIONSection 00650 00650-1


SECTION 00700GENERAL CONDITIONSTABLE OF CONTENTSARTICLE 1DEFINITIONS/INTERPRETATIONS1.1 Definitions1.2 InterpretationsARTICLE 2PRELIMINARY MATTERS2.1 Copies of Documents2.2 Commencement of the Contract Time;Notice to Proceed2.3 Before Starting Construction2.4 Preconstruction ConferenceARTICLE 3CONTRACT DOCUMENTS3.1 Applicable Law; Intent3.2 Priority of the Contract Documents3.3 Use of Forms Provided3.4 Reuse of DocumentsARTICLE 4AVAILABILITY OF LANDS; PHYSICAL CONDITIONS; REFERENCE POINTS4.1 Availability of Lands4.2 Physical Conditions (Including Underground Facilities)4.3 Differing Physical Conditions (including Underground Facilities)4.4 Resolution of a Report of Differing Physical Conditions4.5 Special Requirements for Underground Facilities4.6 Reference PointsARTICLE 5BONDS AND INSURANCE5.1 Performance, Payment and Other Bonds5.2 Contractor's Insurance - General5.3 City's Insurance5.4 Workers' Compensation Insurance and Employer's Liability Insurance5.5 Liability Insurance5.6 Property Insurance5.7 Waiver of Rights5.8 Owner May Object to InsuranceARTICLE 6CONTRACTOR'S RESPONSIBILITIES6.1 Supervision and Superintendence6.2 Personnel and Working Hours6.3 Apprentices6.4 CONTRACTOR's Responsibilities for Furnishing6.5 Items of Material or Equipment6.6 Wood Products6.7 Equivalent Materials and Equipment6.8 Concerning Subcontractors, Suppliers and Others6.9 Patent Fees and Royalties6.10 Permits6.11 Laws and Regulations6.12 Use of Premises6.13 Record Documents6.14 Safety and ProtectionSection 00700 00700- 1


6.15 Emergencies6.16 Shop Drawings and Samples6.17 Continuing the Work6.18 Indemnity6.19 Progress of the Work6.20 Project Meetings6.21 CONTRACTOR Not Agent of City6.22 Inspection and Audit6.23 Truth-in-Negotiation6.24 Correspondence6.25 Protection of Historical Properties6.26 Responsibility of Connecting to Existing Services and Utilities6.27 Additional ProvisionsARTICLE 7WORK BY OTHERS7.1 Related Work at Site7.2 Mutual Duties and Responsibilities7.3 Extensions in Contract Time7.4 Contract Time CoordinationARTICLE 8CITY'S RESPONSIBILITIES8.1 GeneralARTICLE 9ENGINEER'S STATUS DURING CONSTRUCTION9.1 City's Representative9.2 Visits to Site9.3 Project Representation9.4 Duties, Responsibilities and Limitations of Authority of Construction Manager9.5 Duties, Responsibilities and Limitations of Authority of Field Representative9.6 Clarifications and Interpretations9.7 Authorized Variations in Work9.8 Rejecting Defective Work9.9 Determinations of Quantities and Classifications of Unit Price Work9.10 Decisions on Disputes9.11 Limitations on ENGINEER's, DESIGN ENGINEER's and Field RepresentativeARTICLE 10CHANGES IN THE WORK10.1 Changes in the Work10.2 Change Orders and Change Requests10.3 WaiversARTICLE 11CHANGES IN CONTRACT PRICE OR CONTRACT TIME11.1 Changes in Contract Price or Contract Time11.2 Proposals or Claims Substantiating Adjustments11.3 Methods for Determining Adjustments in Contract Price11.4 Determining Cost Adjustments to Changes in Contract Price11.5 Costs Covered by CONTRACTOR's Allowances11.6 CONTRACTOR Allowances for Change and Additions to the Work11.7 Unit Price Work11.8 Cash Allowances11.9 Criteria for Determining Adjustments in Contract Time11.10 WaiversARTICLE 12SCHEDULES12.1 Progress and Submittal SchedulesSection 00700 00700- 2


ARTICLE 13WARRANTY AND GUARANTEE, TESTS AND INSPECTIONS,CORRECTIONS, REMOVAL OR ACCEPTANCE OF DEFECTIVE WORK13.1 Warranty and Guarantee13.2 Access to Work13.3 Tests and Inspections13.4 Uncovering Work13.5 Correction or Removal of Defective Work13.6 Acceptance of Defective Work13.7 City May Correct Defective Work13.8 Warranty Period13.9 Extended Warranties and Guarantees13.10 Special Maintenance Requirements13.11 Extended Warranty Period Due to Defective WorkARTICLE 14PAYMENTS TO CONTRACTOR AND COMPLETION14.1 Schedules14.2 Application for Payment14.3 Materials on Site14.4 CONTRACTOR's Warranty of Title14.5 Review and Payment14.6 Retainage14.7 Overpayment14.8 Final Application for Payment14.9 Final Payment and Acceptance14.10 Waiver of Claims14.11 City's Obligations14.12 Partial Utilization14.13 Substantial Completion14.14 Final Inspection14.15 CONTRACTOR's Continuing ObligationARTICLE 15SUSPENSION OF WORK AND TERMINATION15.1 City May Stop Work15.2 Suspension for Convenience15.3 Termination for Cause15.4 Termination for Convenience15.5 CONTRACTOR May Stop Work or TerminateARTICLE 16VALUE ENGINEERING INCENTIVEARTICLE 17MISCELLANEOUS17.1 Giving Notice17.2 Notice to Other Agencies17.3 Computation of Time17.4 Claims for Injury or Damage to Person or Property17.5 No Conflict with Laws or Regulations17.6 Partial Invalidity17.7 No Waiver of Rights, Duties17.8 Advertising17.9 Venue17.10 Recovery of DamagesSection 00700 00700- 3


ARTICLE 1 - DEFINITIONS/INTERPRETATIONS1.1 DefinitionsWhenever used in the Contract Documents, the following terms shall have the meanings indicated, whichshall be applicable to both the singular and plural thereof.Addenda - Written or graphic instruments issued prior to the date for opening Bids which modify orinterpret the Contract Documents by additions, deletions, corrections or clarifications.Acceptance, Final Acceptance - The formal action by CITY accepting the Work as being complete aftercertification by ENGINEER of final completion.Agreement - The written agreement between CITY and CONTRACTOR covering the Work to beperformed; other Contract Documents are incorporated in or referenced in the Agreement and made apart thereof as provided therein.Apparent Low Bidder - The Bidder submitting the lowest Bid at the Bid Opening without correction ofnumerical discrepancies or determination of responsiveness and responsibility.Application for Payment - The form furnished in the Contract Documents which is to be used byCONTRACTOR in requesting progress or Final Payments and which shall contain an affidavit ofCONTRACTOR that Progress Payments theretofore received from CITY on account of the Work havebeen applied by CONTRACTOR to discharge in full all of CONTRACTOR's obligations stated in priorApplications for Payment. The application includes such supporting documentation as required by theContract Documents.Bid - The offer or proposal of a Bidder submitted in the prescribed manner on the prescribed forms toperform the Work in accordance with the Contract Documents.Bidder - The individual, partnership, corporation, joint venture, or other legal entity or combination thereofsubmitting a Bid for the Work directly to CITY through an authorized representative.Bid Security - The security designated in the Instructions to Bidders.Bonds - Instruments of security furnished by CONTRACTOR and his surety in accordance with theContract Documents.Change Order - A written instrument issued on or after the Effective Date of the Agreement, which whenduly executed by CITY amends the Contract Documents to provide for changes in the Work or in theprovisions of the Contract Documents, or changes in Contract Price or Contract Time, or any combinationthereof.Change Request - A written instrument which when signed by CITY is a directive authorizing a change inthe Work or in the provisions of the Contract Documents, or an adjustment in Contract Price or ContractTime, or any combination thereof. Even when signed by CITY, a Change Request is not an instrumentthat amends the Contract Documents; however, it may be converted to a Change Order. An unsignedChange Request may be used by CITY and CONTRACTOR to negotiate changes in the Work or in theprovisions of the Contract Documents, or adjustments in Contract Price or Contract Time, or anycombination thereof CITY; the OWNER.Construction Manager - The authorized representative of CITY who is assigned to the Project.Contract Documents - Those documents named in Article 8 of the Agreement.Section 00700 00700- 4


Contract Price - The total compensation, subject to authorized adjustments, payable by CITY toCONTRACTOR under the Contract Documents as stated in the Agreement.Contract Time - The period of time allotted in the Contract Documents, subject to authorized adjustments,for Substantial Completion of the Work, or specified part thereof.CONTRACTOR - The individual, partnership, corporation, joint venture, or other legal entity orcombination thereof who has entered into the Agreement with CITY for the performance of the Work. Theterm "CONTRACTOR" means CONTRACTOR or its authorized representative.Cost and Pricing Data - Refers to all data available to or relied upon by CONTRACTOR in negotiating,pricing or costing Work covered by a Change Order or a Change Request, or involved in a proposal orclaim. Sample Cost and Pricing Data include proposal or claim estimates, CONTRACTOR's Bidestimate, estimating guides, CONTRACTOR's computations and projections, and the assumptions madeby CONTRACTOR in pricing or figuring increases or decreases in Contract Price or Contract Time.Date of Commencement of the Contract Time - The date given by the Notice to Proceed when theContract Time commences to run.Day - A calendar day of 24 hours lasting from midnight one day to midnight the next day.Defective - An adjective which when modifying the word Work refers to work that is unsatisfactory, faultyor deficient, or does not conform to the Contract Documents, or does not meet the requirements of anyinspection, reference standard, test or approval referred to in the Contract Documents, or has beendamaged prior to Final Payment (unless responsibility for the protection thereof has been assumed byCITY).DESIGN ENGINEER - The person, firm, or corporation who is named as such in the Agreement whodesigned the Project and has the rights and authority as assigned to him in the Contract Documents. Theterm "DESIGN ENGINEER" means DESIGN ENGINEER or its authorized representative.Drawings, Plans - The Drawings, Plans or reproduction thereof, which show scope, character, location,dimensions, and other details of the Work to be performed and which are included in the ContractDocuments.Effective Date of the Agreement - The date indicated in the Agreement on which it becomes effective, butif no such date is indicated it means the date on which the Agreement is signed by the last of the twoparties to sign.ENGINEER - The individual, partnership, corporation, joint venture, or any combination thereof, named asENGINEER in the Agreement who will have the rights and authority assigned to ENGINEER in theContract Documents. The term "ENGINEER" means the ENGINEER or its authorized representative.Federal Contract Provisions - Federal Regulatory Agency or statutory requirements applicable to theWork and included in the Contract Documents under this heading.Field Order - A written instrument issued by ENGINEER to CONTRACTOR which orders minor variationsin the Work, as opposed to a change in the Work, and which does not involve an adjustment in ContractPrice or Contract Time.Field Representative - Person who is assigned to the site or any part thereof by CITY.General Requirements - Sections of Division 1 of the Specifications.Holidays - Days designated by CITY as legal holidays.Laws and Regulations; Laws or Regulations - Laws, Rules, Regulations, Ordinances, and/or court oradministrative Orders of the federal, state and local governments.Section 00700 00700- 5


Low Bidder - The lowest responsive, responsible Bidder.Notice of Award - The written notice of the acceptance of the Bid from CITY to Low Bidder.Notice to Proceed - The written notice issued by CITY to CONTRACTOR authorizing it to proceed withthe Work and establishing the Date of Commencement of the Contract Time.OWNER - Refer to definition of CITY.Payment Bond - The security furnished by CONTRACTOR and its surety as a guarantee thatCONTRACTOR will pay in full all Bills and accounts, from claimants as defined in Florida StatutesChapter 713, or as amended, for material, labor, services and supplies used directly or indirectly in theprosecution of the Work; the covered amount of the Payment Bond is separate and distinct from thecovered amount of the Performance Bond.Performance Bond - The security furnished by CONTRACTOR and its surety as a guarantee thatCONTRACTOR will perform all of its contractual obligations in accordance with the terms of the ContractDocuments; the covered amount of the Performance Bond is separate and distinct from the coveredamount of the Payment Bond.Progress Schedule - All documentation related to the planning and scheduling of the Work as describedin these General Conditions and the General Requirements.Project - The total construction of which the Work to be provided under the Contract Documents may bethe whole, or a part as indicated elsewhere in the Contract Documents.Request for Information - CONTRACTOR's inquiries for information as submitted on the Request forInformation form included in the Contract Documents.Shop Drawings - All Drawings, diagrams, illustrations, schedules and other data which are specificallyprepared by or for CONTRACTOR to illustrate some portion of the Work and all illustrations, brochures,standard schedules, performance charts, instructions, diagrams and other information prepared by aSupplier and submitted by CONTRACTOR to illustrate material or equipment for some portion of theWork, specifically indicating how CONTRACTOR will comply with the Contract Documents.Specifications - Those portions of the Contract Documents consisting of written or graphic technicaldescriptions of materials, equipment, construction systems, standards and workmanship as applied to theWork and certain administrative details applicable thereto.Sub-Agreement - A contract or purchase order awarding a part of the Work under the ContractDocuments to a Subcontractor, Supplier or other person or entity.Subcontractor - An individual, partnership, corporation, joint venture, or other combination thereof havinga Sub-agreement with CONTRACTOR for (a) the performance of labor in connection with part of theWork at the site; or (b) for both performing labor in connection with part of the Work at the site andfurnishing items of materials or equipment for incorporation into the Work. Subcontractor also means anindividual, partnership, corporation, joint venture, or other combination thereof who has a Sub-agreementwith another Subcontractor to perform any of the Work at the site.Substantial Completion - That date when (a) the Work (or a specified part thereof) is complete inaccordance with the Contract Documents, with the exception of the minor items identified during theinspection described in these General Conditions, and (b) the Work can be utilized for the purposes forwhich it is intended, as may be evidenced by successful completion of all specified pre-operational startupand demonstration tests. The terms "substantially complete" and "substantially completed" as appliedto any Work refer to Substantial Completion thereof.Section 00700 00700- 6


Supplementary Conditions - The part of the Contract Documents which amends or supplements theseGeneral Conditions or other portions of the Contract Documents as stated therein and is designated assuch.Supplier - A manufacturer, fabricator, supplier, distributor, materialman or vendor.CITY - CITY OF DELTONAUnderground Facilities - All pipelines, conduits, ducts, cables, wires, manholes, vaults, tanks, tunnels orother such facilities or attachments, and any encasements containing such facilities which have beeninstalled underground to furnish any of the following services or materials: electricity, gases, steam, liquidpetroleum products, telephone or other communications, cable television, sewage and drainage removal,traffic or other control systems or water.Unit Price Work - Work to be paid on the basis of unit prices. The term contingent Unit Price Work refersto Unit Price Work which is foreseeable but not certain to materialize during the performance of the Work.Warranty Period - The period of time within which CONTRACTOR shall promptly, without cost to CITYand in accordance with CITY's written instructions, either correct defective Work or, if it has been rejectedby CITY, remove it from the site and replace it with non-defective Work.Work - Any and all obligations, duties, responsibilities, labor, materials, equipment, temporary facilities,utilities, and incidentals and the furnishing thereof necessary to complete the construction assigned to, orundertaken by CONTRACTOR pursuant to the Contract Documents. Also, the completed construction orparts thereof required to be provided under the Contract Documents, including all materials, equipment,and supplies incorporated or to be incorporated in the construction.1.2 Interpretations1.2.1. Any reference to an Article or paragraph in these General Conditions withoutidentification of the particular Section shall means a reference to these GeneralConditions.1.2.2. Each Article in these General Conditions is composed of sub-articles, numbered as thissub-article 1.2 is numbered; parts, numbered as this part 1.2.1 is numbered; and subparts- all of which are generally referred to as "paragraphs". A reference to a sub-articlemeans a reference to the entire sub-article, or to a part, or a sub-part, or any combinationof them, depending on the intent of the reference.1.2.3. Often, the Contract Documents omit the modifying word "all" and "any", and the articles"the" and "an". However, omitting modifiers or articles from, or inserting any of them into,a statement shall not in any way affect the meaning or interpretation of either statement.ARTICLE 2 - PRELIMINARY MATTERS2.1 Copies of DocumentsCITY shall furnish to CONTRACTOR five copies of the Contract Documents free of charge.CONTRACTOR will reimburse the Design Engineer for the preparation of additional copies.2.2 Commencement of the Contract Time; Notice to Proceed2.2.1. The Contract Time will commence to run on the day indicated in the Notice to Proceed.The Notice to Proceed may indicate a Date of Commencement of the Contract Time anytime within thirty days after the Effective Date of the Agreement.Section 00700 00700- 7


2.2.2. CONTRACTOR shall start to perform the Work on the Date of Commencement of theContract Time. No Work shall be done at the site prior to the date on which thecorresponding Contract Time commences to run unless otherwise authorized in writingby CITY.2.3 Before Starting Construction2.3.1. Before undertaking each part of the Work, CONTRACTOR shall carefully study andcompare the Contract Documents and check and verify pertinent figures shown thereonand all applicable field measurements. CONTRACTOR shall promptly report in writing toENGINEER any conflict, error or discrepancy which CONTRACTOR or any of hisSubcontractors or Suppliers may discover and shall obtain a written interpretation orclarification from ENGINEER before proceeding with any work affected thereby; provided,however, CONTRACTOR shall not be liable to CITY or ENGINEER for failure to reportany conflict, error or discrepancy unless CONTRACTOR or any of his Subcontractors orsuppliers had actual knowledge thereof or should reasonably have known thereof.2.3.2. Within ten days after the Effective Date of the Agreement (unless otherwise specified inthe General Requirements), CONTRACTOR shall submit to ENGINEER for review apreliminary Progress Schedule indicating the starting and completion dates of the variousstages of the Work, a proposed schedule of Shop Drawing submissions, a proposedschedule of values of the Work on the form provided by ENGINEER, and a listing ofmanpower and cash flow projections through the Contract Time.2.3.3. The schedule of values shall include quantities and prices of items aggregating theContract Price, and shall subdivide the Work into component parts in sufficient detail toserve as the basis for Applications for Payment during construction. CONTRACTORshall confirm in writing at the time of submission, that an appropriate amount of directcosts, supplemental costs, administrative expenses, contingencies and profit have beenallocated to each item of Work.2.3.4. If the Bid Form contains a bid item price for mobilization, the Schedule of Values shalldistribute these costs such that no more than 50% of the bid item amount shall be paid asmobilization in the first Application for Payment and at least 10% of the bid item amountshall be paid in the last Application for Payment as demobilization with the remainderpaid in equal installments over the Contract Time. In no event shall the Contractor beentitled to receive in its first Application for Payment an amount in excess of five (5)percent of the original Contract Price for mobilization.2.3.5. CITY or ENGINEER will review and return the schedules submitted in accordance withthis Article and CONTRACTOR, if required, shall revise, adjust or modify and resubmitacceptable schedules within the time periods required, and if none are required, at leastten (10) days before submission of the first Application for Payment.2.4 Preconstruction Conference2.4.1. Prior to commencement of Work at the site, a conference will be held for review of theschedules, to establish procedures for handling Shop Drawings and other submittals andfor processing Applications for Payment, and to establish a working understandingamong the parties as to the Work. CONTRACTOR shall attend such conference andshall require any or all of its Subcontractors and Suppliers, as CITY directs, to attend theconference.2.4.2. Unless otherwise stated at the Preconstruction Conference or a Project Meeting, theConstruction Manager as assigned in writing by the CITY will be the single authorizedSection 00700 00700- 8


epresentative assigned the duty of, and authorized to, transmit or receivecommunications between CONTRACTOR and ENGINEER for the remaining term of theAgreement.ARTICLE 3 - CONTRACT DOCUMENTS: INTENT and REUSE.3.1 Applicable Law; Intent3.1.1. The Contract Documents comprise the entire agreement between CITY andCONTRACTOR concerning the Work. The Contract Documents are complementary;what is called for by one is as binding as if called for by all. The Contract Documents willbe governed by the law of the place of the Project.3.1.2. It is the intent of the Contract Documents to describe a functionally complete Project (orpart thereof) to be constructed in accordance with the Contract Documents. Any Work,materials or equipment that may reasonably be inferred from the Contract Documents asbeing required to produce the intended result shall be supplied whether or not specificallycalled for. When words which have a well-known technical or trade meaning are used todescribe Work, materials or equipment, such words shall be interpreted in accordancewith that meaning. Reference to standard specifications, manuals or codes of anytechnical society, organization or association, or to the Laws or Regulations of anygovernmental entity whether such reference be specific or by implication, shall mean thelatest standard specification, manual, code or Laws or Regulations in effect at the time ofopening of Bids, except as may be otherwise specifically stated. However, no provisionof any referenced standard specification, manual or code (whether or not specificallyincorporated by reference in the Contract Documents) shall change the duties andresponsibilities of CITY, CONTRACTOR, DESIGN ENGINEER or ENGINEER, or any oftheir consultants, agents or employees from those set forth in the Contract Documents,nor shall it assign to CITY or ENGINEER, or any of their consultants, agents oremployees, any duty or authority to supervise or direct the furnishing or performance ofthe Work or any duty or authority to undertake responsibility contrary to the provisions ofArticle 8 or 9.3.2 Priority of the Contract Documents3.2.1. If, during the performance of the Work, CONTRACTOR, or any of his Subcontractors orSuppliers, finds a conflict, error or discrepancy in the Contract Documents,CONTRACTOR shall so report to ENGINEER in writing at once, and before proceedingwith the Work affected thereby, shall obtain a written interpretation or clarification fromENGINEER. However, CONTRACTOR shall not be liable to CITY or ENGINEER forfailure to report any conflict, error or discrepancy in the Contract Documents unlessCONTRACTOR or any of his Subcontractors or Suppliers had actual knowledge thereofor should reasonably have known thereof. ENGINEER will promptly investigate thematter and respond to CONTRACTOR with an interpretation or clarification.After CONTRACTOR's discovery of such a conflict, error or discrepancy, or after the datewhen CONTRACTOR should have reasonably known thereof, until the interpretation orclarification is obtained from ENGINEER, any Work done by CONTRACTOR which isdirectly or indirectly affected by same, will be at CONTRACTOR's own risk andCONTRACTOR shall bear all costs and delay arising therefrom.3.2.2. In resolving such conflicts, errors or discrepancies, the Contract Documents shall begiven preference in the following order: Change Orders, Executed Change Requests,Field Orders, Agreement, Notice to Proceed, Notice of Award, Addenda, FederalContract Provisions, Supplementary Conditions, Instructions to Bidders, GeneralConditions, General Requirements, Divisions 2 through 16 of the Specifications andSection 00700 00700- 9


Drawings, Invitation for Bid, CONTRACTORS's Bid, Bonds, Insurance Certificate(s) andEndorsement(s), and Affidavits.3.2.3. If the issue of priority pertains to Divisions 2 through 16 of the Specifications and theDrawings, figured dimensions shall govern over scaled dimensions, but Work notdimensioned shall be as directed, and Work not particularly shown, identified, sized, orlocated shall be the same as similar parts that are shown or specified. Further, detailDrawings shall govern over general drawings, larger scale drawings take precedenceover smaller scale drawings, Change Order or Change Request Drawings govern overContract Drawings, and Contract Drawings govern over standard or Shop Drawings. Inall cases where notes, specifications, sketches, diagrams, details or schedules in theSpecifications or in the Drawings, or between the Specifications and the Drawings,conflict, the higher cost requirement shall be furnished by CONTRACTOR, unlessotherwise directed by ENGINEER.3.2.4. If the issue of priority is due to a conflict or discrepancy between provisions of theContract Documents and any referenced standard specification, manual, or code of anytechnical society, organization or association, the provisions of the Contract Documentswill take precedence if they are more stringent or presumptively cause a higher level ofperformance. If there is any conflict or discrepancy between standard specifications,manuals, or codes of any technical society, organization or association, or between Lawsor Regulations, the provision with the higher cost requirement shall be binding onCONTRACTOR, unless otherwise directed by ENGINEER.3.2.5. In accordance with the intent of the Contract Documents, CONTRACTOR recognizes andaccepts that compliance with the priority order specified shall not justify an increase inContract Price or extension in Contract Time.3.3 Use of Forms ProvidedUnless CITY provides to the contrary, only those forms (Change Request Form, Change OrderForm, Notice of Award, Notice to Proceed, Application for Payment, Insurance Certificates andEndorsements, Bonds, Bid Form, etc.) provided in the Contract Documents shall be used and nomodifications or substitutions shall be allowed.3.4 Re-use of DocumentsNeither CONTRACTOR nor any Subcontractor or Supplier or other person or organization (otherthan CITY) shall acquire any title to or have ownership rights of any of the Drawings,Specifications or other documents (or copies of any thereof) prepared by or bearing the seal ofDESIGN ENGINEER; and they shall not be reused on extensions of the Project or any otherproject nor shall they be generally published without written consent of CITY.ARTICLE 4 - AVAILABILITY OF LANDS; PHYSICAL CONDITIONS; REFERENCE POINTS4.1 Availability of Lands4.1.1. CITY shall furnish, as indicated in the Contract Documents, the lands upon which theWork is to be performed, rights-of-way and easements, and those other lands which aredesignated for the use of CONTRACTOR. Easements for permanent structures orpermanent changes in existing facilities will be obtained and paid for by CITY, unlessotherwise provided in the Contract Documents. Any additional lands, rights-of-way andeasements not furnished by CITY that CONTRACTOR deems necessary, including butnot limited to requirements for temporary construction facilities, access and egress, or forstorage, shall be obtained by CONTRACTOR at no increase in Contract Price orSection 00700 00700- 10


extension in Contract Time, and CONTRACTOR shall confine his operations to thoseareas furnished or obtained at its expense.4.1.2. CONTRACTOR shall obtain permits and written approvals (and submit copies to CITYbefore utilization of those areas) from the appropriate governmental entity or propertyowner(s), for use of lands not furnished by CITY; and for all lands which include borrowpits, waste and disposal areas, such permits and approvals shall specify their treatmentduring and at completion of construction.4.1.3. Access to municipal structures, hydrants, valves, manholes, fire alarms, etc., shall not beobstructed by CONTRACTOR. CONTRACTOR is to make no connections to or operatevalves on water mains or otherwise interfere with the operation of the water system,without first giving written notice to and securing written approval from the appropriategovernmental entity.4.2 Physical Conditions (Including Underground Facilities)4.2.1. The Contract Documents may identify reports of explorations and tests of subsurfaceconditions at the site, and those drawings of physical conditions in or relating to existingsurface and subsurface structures or Underground Facilities owned by CITY which are ator contiguous to the site, that have been utilized by DESIGN ENGINEER in preparationof the Contract Documents. CONTRACTOR may rely upon the accuracy of the technicaldata in those reports or drawings, but not upon nontechnical data, interpretations oropinions, or for their completeness for CONTRACTOR's purposes. Except as indicatedin the preceding sentence and in Paragraphs 4.4 and 4.5, CONTRACTOR shall have fullresponsibility for physical conditions, and Underground Facilities owned by CITY, shownor indicated in the Contract Documents.4.2.2. The information and data shown or indicated in the Contract Documents with respect toUnderground Facilities at or contiguous to the site is based on information and datafurnished to CITY or DESIGN ENGINEER by the owners of such Underground Facilitiesor by others. CITY, ENGINEER and DESIGN ENGINEER shall not be responsible forthe accuracy or completeness of any such information or data, and, CONTRACTOR shallhave full responsibility for reviewing and checking all such information and data.4.2.3. Unless it prejudices Work already excavated and uncovered, CONTRACTOR shallschedule layout, excavation and uncovering of Work or Underground Facilities asufficient time in advance to allow ENGINEER's review, and the possible amending orsupplementing of the Contract Documents.4.3 Differing Physical Conditions (including Underground Facilities)CONTRACTOR shall immediately, after becoming aware thereof, and before the conditions aredisturbed (except in a case of an emergency), notify ENGINEER in writing of any subsurface orlatent physical conditions, or Underground Facilities, encountered at or contiguous to the sitewhich differ materially from those indicated in the Contract Documents; Underground Facilitiesnot shown or indicated in the Contract Documents encountered at or contiguous to the site;unknown physical conditions encountered or uncovered at or contiguous to the site, of an unusualnature, differing materially from those ordinarily encountered at or contiguous to the site whichdiffer materially from those indicated in the Contract Documents; unknown physical conditionsencountered or uncovered at or contiguous to the site, of an unusual nature, differing materiallyfrom those ordinarily encountered and not generally recognized as inherent in Work of thecharacter provided for in the Contract Documents.Section 00700 00700- 11


4.4 Resolution of a Report of Differing Physical Conditions4.4.1. Promptly after receipt of notice from CONTRACTOR, ENGINEER will review thepertinent conditions, determine the necessity of obtaining additional explorations or tests,and advise CITY in writing of his findings and conclusions. Until such time whenCONTRACTOR resumes the affected Work (and at all times thereafter), CONTRACTORshall be responsible for the safety and protection of the affected Work.4.4.2. If CITY, with the advice of ENGINEER, concludes that the conditions do materially differ,and that the Contract Documents need to be amended, CITY shall, without invalidatingthe Agreement and without notice to any surety, by duly executed Change Order orChange Request, order the necessary changes in the Work, as long as CITY has notexercised its rights to terminate the Agreement.Upon receipt of that order, CONTRACTOR shall promptly proceed or continue with theWork involved pursuant to the conditions stated in the order.4.4.3. If CITY, with the advice of ENGINEER, concludes that the Contract Documents need tobe supplemented only, appropriate minor deviations in the Work shall be authorized by aChange Request duly executed by CITY or a Field Order issued by ENGINEER. CITY'sdetermination that the Contract Documents do not need to be amended shall be final andbinding on CONTRACTOR unless CONTRACTOR delivers to CITY written notice of aclaim within seven (7) days of receipt of notification of that decision.4.4.4. If any change in the Work required due to differing physical conditions causes anincrease or decrease in CONTRACTOR's cost of or the time required for the performanceof all or part of the Work, CITY shall make an adjustment in Contract Price or ContractTime, subject to the provisions of this Article, and Articles 10 and 11.4.4.5. If the Contract Documents necessitate amending to order changes in the Work due toUnderground Facilities, whether they be shown or indicated or newly discovered, CITYshall authorize the required changes in the Work, including any necessary adjustments inContract Price, by Change Order or Change Request. If those Underground Facilitiescause or will cause delays in the performance or extend completion of all or part of theWork, CONTRACTOR shall absorb all related delay, extension or acceleration costs,however caused; except that, if CITY and CONTRACTOR believe that the delays requirea change in Contract Time, CITY shall authorize the necessary change in Contract Time.However, an extension in Contract Time, when and if so granted shall beCONTRACTOR's sole and exclusive remedy with respect to CITY for any delay,disruption, interference, extension or hindrance and associated costs, however caused,resulting from variance in the location or configuration of Underground Facilities shown orindicated, or from newly discovered Underground Facilities.4.4.6. No proposal by CONTRACTOR for an adjustment under this Article, nor claim byCONTRACTOR for an adjustment on account of differing physical conditions, shall beallowed unless CONTRACTOR has given the written notice required in paragraph 4.3.4.5 Special Requirements for Underground FacilitiesCONTRACTOR shall have full responsibility: a) for locating any and all Underground Facilitiesshown or indicated as to depth and alignment in advance of excavation; b) for identifying theowner of any newly discovered Underground Facility and promptly notifying that owner andENGINEER of that discovery; c) for shoring, blocking, and protecting Underground Facilitiesshown, indicated or discovered; d) for coordination of the Work with the owners of allUnderground Facilities shown, indicated or discovered; e) for repairing any damage done to thesatisfaction of those owners, to the extent that the damage was due to CONTRACTOR's failure toSection 00700 00700- 12


adhere to the requirements of this paragraph or paragraph 4.2.2., or to the fault or negligence ofCONTRACTOR; and f) for the safety and protection of any affected Work, and for repairing anydamage done to the Work. Except as otherwise provided in paragraphs 4.4.5. and 4.4.6., allcosts involved and time required to perform these responsibilities shall be considered as havingbeen included in the Contract Price and in the CONTRACTOR's schedule for the performance ofthe Work within the Contract Times, even if the Contract Documents need amending to authorizeminor deviations or changes in the Work due to those Underground Facilities.4.6 Reference Points4.6.1. CITY shall provide the engineering surveys to establish reference points for constructionwhich in ENGINEER's judgment are necessary to enable CONTRACTOR to proceed withthe Work. CONTRACTOR shall be responsible for laying out the Work, shall protect andpreserve the established reference points and shall make no changes or relocationswithout the prior written approval of ENGINEER. CONTRACTOR shall report toENGINEER whenever any reference point is lost or destroyed, or requires relocationbecause of necessary changes in grades or locations, and shall be responsible for theaccurate replacement or relocation of such reference points by professionally qualifiedpersonnel.4.6.2. CONTRACTOR shall promptly, after becoming aware thereof and before performing anyaffected Work (except in a case of an emergency), notify CITY in writing of any referencepoints which in CONTRACTOR's judgment need correction to enable CONTRACTOR toproceed with the proper performance of the Work.4.6.3. In resolving a report of differing reference points, CONTRACTOR shall adhere to theprocedures, assume the duties and responsibilities, and accept the conditions outlined inparagraph 4.4 in all respects.ARTICLE 5 - BONDS AND INSURANCE5.1 Performance, Payment and Other Bonds5.1.1. CONTRACTOR shall furnish a Performance Bond and a Payment Bond, each with goodand sufficient surety, and each in an amount at least equal to the Contract Price. TheseBonds shall be recorded with the clerk of the circuit court of the county where the Projectis located no later than the Date of Commencement of the Contract Time. These Bondsshall remain in effect at least until one (1) year after the date when Final Paymentbecomes due, except as otherwise provided by Laws or Regulations, or the otherprovisions of the Contract Documents. CONTRACTOR shall also furnish such otherBonds as are required by the Supplementary Conditions. The Performance Bondrequirement in the Contract Documents shall inure solely to CITY and its successors orassigns, as obligee, and no other person shall have any right of action based thereon.5.1.2. All Bonds shall be in accordance with statutory bond provisions in Florida Statutes and allother applicable Laws and Regulations and be in the form prescribed by the ContractDocuments. All Bonds shall be executed by such sureties as are licensed to conductbusiness in the state of Florida and, except as otherwise provided by Laws andRegulations, are named in the current list of Companies Holding Certificates of Authorityas Acceptable Sureties on Federal Bonds and as Acceptable Reinsuring Companies" aspublished in Circular 570 (amended) by the Audit Staff Bureau of Accounts, U.S.Treasury Department. All Bonds signed by an agent must be accompanied by a certifiedcopy of its authority to act.5.1.3. If the surety on any Bond furnished by CONTRACTOR is declared bankrupt or becomesinsolvent or its license to do business in the state of Florida is terminated or it ceases toSection 00700 00700- 13


meet the requirements of the Contract Documents, CONTRACTOR shall within five (5)days thereafter substitute another Bond and surety, both of which shall be in accordancewith the Contract Documents and acceptable to CITY.5.1.4. In addition to the other bonding requirements, the surety(ies) named on the PerformanceBond and Payment Bond submitted by Low Bidder pursuant to the Contract Documentsshall be subject to the approval of CITY. If CITY has a reasonable objection to theproposed Surety, CITY may request Low Bidder to submit an acceptable substitutewithout an increase in the Bid price. If Low Bidder declines or is unable to make anysuch acceptable substitution, CITY may, at its sole option, rescind the Notice of Award,and any award of the Contract to Low Bidder will be of no effect. The refusal or inabilityto make any such substitution may not constitute grounds for sacrificing its Bid Security.5.2 Contractor's Insurance - General5.2.1. The types of insurance CONTRACTOR shall purchase and maintain are Worker'sCompensation and Employer's Liability Insurance, Liability Insurance, and PropertyInsurance, which shall include the specific coverages set forth in this Article, assupplemented in the Supplementary Conditions, and be written for no less than the limitsof liability coverage provided in the Supplementary Conditions.5.2.2. CONTRACTOR shall not commence or continue to perform any work unless it, at its ownexpense, has in full force and effect all required insurance, and until all insuranceCertificates and Endorsements have been filed evidencing the specific insurancecoverage required, nor shall any payment for Work performed become due and payableuntil such Certificates and Endorsements have been filed. The CONTRACTOR shall notpermit any Subcontractor, Supplier or other person or organization to perform work onthe Project unless the Worker's Compensation Insurance requirements have beencomplied with by such Subcontractor, Supplier or other person or organization.5.2.3. Worker's Compensation and Employer's Liability Insurance shall be maintained in effectfor the full Warranty Period, even as extended. Property Insurance shall continue andshall not terminate until CITY makes Final Acceptance and Payment for the Work, exceptas otherwise provided in the General Conditions. Should any coverage approachexpiration during the period in which it is to remain in full force and effect, it shall berenewed prior to its expiration.5.2.4. Insurance coverage shall be placed with satisfactory carriers licensed to do business inthe State of Florida and countersigned by a resident agent. Insurers shall have at leastan "A" Best's Rating and a Class XI or better financial category in accordance with themost current A. M. Best Company ratings.5.2.5. At the time indicated in the Instructions to Bidders, as evidence of specified insurancecoverage, CONTRACTOR shall provide certificates of insurance evidencing the specificpolicies issued, the limits of coverage afforded, and the specific endorsements provided,all in accordance with the requirements of the forms prescribed in the ContractDocuments, and if none are included, as required by CITY. No alteration or substitutionof said insurance certificate forms will be allowed, unless approved by CITY in writing.5.2.6. If so requested in writing by CITY, CONTRACTOR shall deliver one (1) copy to CITY ofeach insurance policy purchased by CONTRACTOR pursuant to this Article within thirty(30) days of the request.5.2.7. All the policies of insurance so required of CONTRACTOR in the Contract Documentsshall be endorsed to include as additional insurers: CITY, DESIGN ENGINEER,ENGINEER, their consultants, any subsidiaries or affiliates, and each of their directors,officers, employees, representatives, agents or volunteers. In addition, all the policies ofSection 00700 00700- 14


Property Insurance required of CONTRACTOR in the Contract Documents shall beendorsed to include Subcontractors as additional insurers. The insurance afforded tothese additional insurers shall be primary insurance. If the additional insurers have otherinsurance which might be applicable to any loss, the amount of insurance provided underCONTRACTOR's policies of insurance shall not be reduced or prorated by the existenceof the other insurance.5.2.8. All the policies of insurance so required of CONTRACTOR in this Article shall beendorsed to expand coverage as required in this Article, as supplemented in theSupplementary Conditions.5.2.9. Deductible/self-insured retention amounts shall be subject to approval by CITY, and shallbe reduced or eliminated upon written request from CITY. The insurer's cost of defenseincluding attorney's fees (and attorney's fees on appeal) shall not be included within thepolicy coverage but shall remain the responsibility of insurer.5.2.10 Nothing contained in these insurance requirements is to be construed as limiting theliability of CONTRACTOR or CONTRACTOR's insurance carriers. It is to be understoodthat CITY, ENGINEER and DESIGN ENGINEER do not in any way represent that theinsurance (or the limits of insurance) specified in this Article (or in the SupplementaryConditions) is sufficient or adequate to protect CONTRACTOR's interests or liabilities, butare merely minimums.5.2.11 Umbrella Liability Insurance shall not be more restrictive than the underlying insurancepolicy coverages.5.2.12 All the policies of insurance (or the certificates or other evidence thereof) required to bepurchased and maintained by CONTRACTOR in accordance with the ContractDocuments will contain a provision or endorsement that the coverage afforded will not becanceled or materially changed or renewal refused until at least thirty days' prior writtennotice has been given to CITY and ENGINEER by certified mail.5.3 InsuranceCITY shall have the option of self-insuring or purchasing and maintaining its own insurance. IfCONTRACTOR fails to obtain or renew insurance or fails to maintain insurance in a form requiredby the Contract Documents, or if any insurance company CONTRACTOR has procuredinsurance from declares bankruptcy, is declared bankrupt, or if the Insurer loses its "A"policyholder's rating or if its financial size category rating falls below Class XI in the most currentA. M. Best's rating, CITY may procure insurance at CONTRACTOR's expense in the coverageamounts required by the Contract Documents and shall be entitled to deduct CITY'S resultantcosts from the Contract Price by issuing a Change Order. In lieu of procuring insurance atCONTRACTOR's expense, CITY has the option to stop or suspend the Work or terminateCONTRACTOR's services as provided in Article 15. CITY's actions under this paragraph shallnot entitle CONTRACTOR to an increase in Contract Price or an extension of Contract Time.5.4 Worker's Compensation Insurance and Employer's Liability InsuranceCONTRACTOR shall obtain full Worker's Compensation Insurance coverage for no less than thestatutory limits and Employer's Liability Insurance coverage in limits not less than the amounts setforth in the Supplementary Conditions, for all persons whom it employs or may employ in carryingout the Work under the Agreement. This insurance shall be in strict accordance with therequirements of the most current and applicable state Worker's Compensation laws.Section 00700 00700- 15


5.5 Liability Insurance5.5.1. CONTRACTOR shall purchase and maintain the liability insurance described herein toprovide protection from claims arising out of or resulting from CONTRACTOR'sperformance of the Work and CONTRACTOR's other obligations under the ContractDocuments, whether such performance is by CONTRACTOR, by any Subcontractor orSupplier, by anyone directly or indirectly employed by any of them, or by anyone forwhose acts any of them may be liable.5.5.2. The liability insurance shall include liability insurance applicable to CONTRACTOR'sobligations under Articles 6 and 7. CONTRACTOR agrees to pay on behalf of CITY, andto provide and pay a legal defense for, all such claims applicable to CONTRACTOR'sobligations under the indemnification provisions in said Articles. CONTRACTOR acceptsas adequate compensation for the contractual liability insurance the amount contained inthe Contract Documents.5.5.3. The liability insurance coverage shall include as a minimum each of the following types ofinsurance:5.6 Property InsuranceA. General Liability(1) Comprehensive Form.(2) Premises-Operations.(3) Explosion and Collapse Hazard.(4) Underground Hazard.(5) Products/Completed Operations Hazard.(6) Contractual Insurance.(7) Broad Form Property Damage Including Completed Operations.(8) Independent Contractors.(9) Personal Injury [with Employment Exclusion deleted.]B. Automobile Liability(1) Comprehensive Form Including Loading and Unloading.(2) Owned.(3) Hired.(4) Non-Owned.5.6.1. CONTRACTOR shall purchase and maintain property insurance upon the Work at thesite to the full insurable value thereof (subject to such deductible amounts as may beprovided in the Supplementary Conditions or required by Laws and Regulations). Thisinsurance shall insure against the perils of fire and extended coverage and shall include"all risk" insurance for physical loss and damage including, without duplication ofcoverage, lightning, windstorm, rain, hurricane, hail, explosions, riot, sinkholes, flood,theft, vandalism and malicious mischief, collapse and water damage, and such otherperils as may be provided in the Supplementary Conditions, and shall include damages,losses and expenses arising out of or resulting from any insured loss or incurred in therepair or replacement of any insured property (including but not limited to fees andcharges of engineers, architects, attorneys and other professionals).If not covered under the "all risk" insurance or otherwise provided in the SupplementaryConditions, CONTRACTOR shall purchase and maintain similar property insurance onportions of the Work stored on and off the site or in transit when such portions of theWork are to be included in an Application for Payment. The property insurance requiredin this paragraph may have a deductible clause, but said deductible shall not exceed$25,000.00 or the limit set forth, if any, in the Supplementary Conditions.Section 00700 00700- 16


5.6.2. In the event of loss covered by Property Insurance, the proceeds of a claim shall be paidto CITY, which shall apportion the proceeds between CITY and CONTRACTOR as theirinterests may appear.5.6.3. Where applicable, CONTRACTOR shall purchase and maintain adequate flood insurancefor Work in designated flood hazard areas as defined by P.L. 93-234 (Flood DisasterProtection Act).5.6.4. CONTRACTOR shall purchase and maintain such boiler and machinery insurance oradditional property insurance as may be required by the Supplementary Conditions orLaws and Regulations.5.6.5. The risk of loss within the deductible amount if any, in the Property Insurance purchasedand maintained pursuant to this Article will be borne by CONTRACTOR.5.7 Waiver of Rights5.7.1. CITY and CONTRACTOR waive all rights against each other for all losses and damagescaused by any of the perils covered by the policies of insurance provided in response toparagraph 5.6 and any other property insurance applicable to the Work, and also waiveall such rights against the Subcontractors, ENGINEER, DESIGN ENGINEER, CITY's,ENGINEER's and DESIGN ENGINEER's consultants and all other parties named asinsurers in such policies for losses and damages so caused. Each Sub-agreementbetween CONTRACTOR and a Subcontractor will contain similar waiver provisions bythe Subcontractor in favor of CITY, CONTRACTOR, ENGINEER, DESIGN ENGINEER,CITY's, ENGINEER's and DESIGN ENGINEER's consultants and all other parties namedas insurers. None of the above waivers shall extend to the rights that any of the insuredparties may have to proceeds of insurance held by CITY, CONTRACTOR, or otherwisepayable under any policy so issued.5.7.2 CITY and CONTRACTOR intend that any policies provided in response to paragraph 5.6shall protect all of the parties insured and provide primary coverage for all losses anddamages caused by the perils covered thereby. Accordingly, all such policies shallcontain provisions to the effect that in the event of payment of any loss or damage theinsurer will have no rights of recovery against any of the parties named as insurers oradditional insurers, and if the insurers require separate waiver forms to be signed byENGINEER, DESIGN ENGINEER, or CITY's, ENGINEER's, or DESIGN ENGINEER'sconsultants CITY will obtain the same, and if such waiver forms are required by anySubcontractor, CONTRACTOR will obtain the same.5.8 Owner May Object to Insurance5.8.1. Neither CITY's review of the coverage afforded by or the provisions of the policies ofinsurance purchased and maintained by CONTRACTOR in accordance with this Article,nor CITY's decisions to raise or not to raise any objections about either or both, shall inany way relieve or decrease the liability of CONTRACTOR. If CITY elects to raise anobjection to the coverage afforded by or the other provisions of the insurance furnished,CONTRACTOR shall promptly provide to CITY such additional information as CITY mayreasonably request, and CONTRACTOR shall remedy any deficiencies in the policies ofinsurance at once.5.8.2. CITY's authority to object to insurance shall not in any way whatsoever give rise to anyduty on the part of CITY to exercise this authority for the benefit of CONTRACTOR or anyother party.Section 00700 00700- 17


ARTICLE 6 - CONTRACTOR'S RESPONSIBILITIES6.1 Supervision and Superintendence6.1.1. CONTRACTOR shall supervise and direct the Work competently and efficiently, devotingsuch attention thereto and applying such skills and expertise as may be necessary toperform the Work in accordance with the Contract Documents. CONTRACTOR shall besolely responsible for all means, methods, techniques, sequences and procedures ofconstruction, for providing adequate safety precautions, for coordinating all portions ofthe Work under the Contract Documents, and for enforcement of order and cooperationamong CONTRACTOR's employees and all Subcontractors and Suppliers and othershaving a Sub-agreement for a part of the Work. CONTRACTOR shall be responsible tosee that the finished Work complies accurately with the Contract Documents.6.1.2. CONTRACTOR shall keep on the Work at all times during its progress a competentresident superintendent, who shall not be replaced without written notice to ENGINEERexcept under extraordinary circumstances. CITY may, at its sole discretion, requirereplacement of the superintendent, in which case CONTRACTOR shall submit anacceptable replacement at no increase in Contract Price nor extension in Contract Time.The superintendent shall be CONTRACTOR's representative at the site and shall haveauthority to act on behalf of CONTRACTOR. All communications given to thesuperintendent shall be as binding as if given to CONTRACTOR. Whenever thesuperintendent is not present on any particular part of the Work where the ENGINEERmay desire to inform the CONTRACTOR relative to interpretation of the plans andspecifications or regarding disapproval or rejection of materials or work performed, theENGINEER may so inform the foreman or other workers in charge of the particular part ofthe work in reference to which the information is given. Information so given shall be asbinding as if given to the superintendent.6.1.3. The superintendent and similar authorized representatives of any Subcontractor, Supplieror other person or organization shall attend all meetings pertaining to the Work, asrequested by CITY or ENGINEER.6.2 Personnel and Working Hours6.2.1. CONTRACTOR shall at all times maintain good discipline and order at the site.6.2.2. CONTRACTOR shall provide competent, qualified personnel to survey and lay out thework (in accordance with any additional provisions included in the GeneralRequirements) and perform construction as required by the Contract Documents.CONTRACTOR is fully responsible to provide a sufficient number of skilled workers andsupervisory personnel to perform the Work and insure that the Work is completed withinthe Contract Time. Failure to fully man the Project with supervisory personnel and skilledworkers shall be cause for termination of CONTRACTOR.6.2.3. Except in connection with the safety or protection of persons or the Work or property atthe site or adjacent thereto, and except as otherwise indicated in the SupplementaryConditions, all Work at the site shall be performed during normal working hours, andCONTRACTOR will not permit overtime work or the performance of Work on Saturday,Sunday or any Holiday without CITY's written consent given after prior written notice toENGINEER. Normal working hours shall be defined as the CONTRACTOR's normaleight hour working period occurring between the hours beginning at 7:00 a.m. and endingat 6:00 p.m., exclusive of Saturdays, Sundays, or Holidays. Work during other thannormal working hours may be scheduled by CONTRACTOR if he first obtains writtenpermission from CITY.Section 00700 00700- 18


The CITY observes the following holidays: New Year's Day, Martin Luther King Jr. Day,Memorial Day, Independence Day, Labor Day, Thanksgiving Day and Day afterThanksgiving, Christmas Eve and Christmas Day. Holidays falling on Saturday will beobserved Friday, holidays falling on Sunday will be observed Monday.6.2.4. CITY shall be entitled to deduct from the Contract Price, by issuing a Change Order,CITY's extra costs incurred in connection with CONTRACTOR's performance of WORKduring hours other than normal working hours. Such costs may include, but shall not belimited to, ENGINEER'S charges to CITY while acting as CITY's representative (includingcharges outside of normal working hours for Construction Manager and FieldRepresentatives) , CITY's costs incurred in the performance of CITY's responsibilities asset forth in the Contract Documents, and other related costs.6.3 ApprenticesCONTRACTOR's utilization of apprentices shall conform to the provisions of Florida StatutesChapter 446.6.4 CONTRACTOR's Responsibilities for FurnishingUnless otherwise specified in the Contract Documents, CONTRACTOR shall furnish and assumefull responsibility for all materials, equipment, labor, transportation, construction equipment andmachinery, tools, appliances, fuel, power, light, heat, ventilation, cooling, telephone, water,sanitary facilities, temporary facilities and all other facilities and incidentals necessary for thefurnishing, performance, testing, start-up and completion of the Work.6.5 Items of Material or Equipment6.5.1. All materials and equipment shall be of good quality and new, except as otherwiseprovided in the Contract Documents. If required by ENGINEER, CONTRACTOR shallfurnish satisfactory evidence (including reports of required tests) as to the kind andquality of materials and equipment.All materials and equipment shall be handled, stored, applied, installed, connected,erected, used, cleaned and conditioned in accordance with the instructions of theapplicable Supplier except as otherwise provided in the Contract Documents; but noprovision of any such instructions will be effective to assign to ENGINEER, or any ofCITY's or ENGINEER's consultants, agents or employees, any duty or authority tosupervise or direct the furnishing or performance of the Work or any duty or authority toundertake responsibility contrary to the provisions of Article 8 or Article 9.6.5.2. Manufacturers' or Suppliers' warranties for all materials, products and equipment to befurnished by CONTRACTOR and to be incorporated into the completed Work shall befurnished to CITY through CONTRACTOR.6.5.3. CONTRACTOR shall obtain from Suppliers of all materials, products and equipment,complete information as to any special condition or restriction to be applied in the use ofthese items. Should the manner or method of installation, specified performance or testresults as set forth in the Specifications be contrary to the manufacturer'srecommendations for use of the product, CONTRACTOR shall notify ENGINEER inwriting of such conflict as soon as reasonably possible, but no later than the time of ShopDrawing submittal including those products. Failure to provide such written notice beforeproceeding with the Work affected thereby shall be certification by CONTRACTOR thatthe Specification requirements will be met by the materials, products and equipment, andthat the cost and time required to perform or complete the Work affected thereby haveSection 00700 00700- 19


een included in the Contract Price and in the schedule for the performance of the Workwithin the Contract Time.6.5.4. Data submitted on all equipment shall include complete operation and maintenanceinstructions (including preventive maintenance and operating requirement data) and partslists in sufficient detail to facilitate ordering replacements. Such submittals shall conformto any additional requirements provided in the General Requirements.6.6 Wood ProductsExcept as may be otherwise provided by Laws or Regulations, pursuant to Florida StatutesChapter 225, lumber, timber and other forest products specified in the Contract Documents shallbe produced and manufactured in Florida whenever such products are available, provided thatprice, fitness and quality are equal to other available products. This requirement does not applywhere plywood is specified for monolithic concrete forms.6.7 Equivalent Materials and Equipment6.7.1. Whenever materials or equipment are specified or described in the Drawings orSpecifications by using the name of a proprietary item or the name of a particularSupplier, the naming of the item is intended to establish the type, function and qualityrequired. Unless the name is followed by words indicating that no substitution ispermitted, materials or equipment of other Suppliers may be accepted by ENGINEER if(a) the proposed substitution was listed on the substitution list provided on the bid form;and b) sufficient information is submitted by CONTRACTOR to allow ENGINEER todetermine that the material or equipment proposed is equivalent to that named. If theproposed substitution was not listed on the bid form, CONTRACTOR shall request inwriting that CITY waive this requirement. CITY reserves the right to either maintain orwaive this requirement. If CITY elects not to waive this requirement, CONTRACTORshall take immediate action to provide the materials and equipment specified.6.7.2. Requests for review of substitute items of material and equipment will not be accepted byENGINEER from anyone other than CONTRACTOR. If CONTRACTOR wishes tofurnish or use a substitute item of material or equipment CONTRACTOR shall, withinadequate time to allow a proper review without impacting the schedule, make writtenapplication to ENGINEER for acceptance thereof, certifying that the proposed substitutewill perform adequately the functions called for by the general design, be similar and ofequal substance to that specified and be suited to the same use and capable ofperforming the same function as that specified. The application shall state whether or notacceptance of the substitute for use in the Work will require a change in the Drawings orSpecifications to adapt the design to the substitute and whether or not incorporation oruse of the substitute in connection with the Work is subject to payment of any license feeor royalty. All variations of the proposed substitute from that specified shall be identifiedin the application and available maintenance, repair and replacement service shall beindicated. The application shall also contain an itemized estimate of all increases ordecreases in (1) the cost of, or the time required to perform any part of the Work, and thecorresponding adjustments in Contract Price an Contract Time, resulting directly orindirectly from evaluation and acceptance of the proposed substitute, including, but notas a way of limitation, costs and delays associated with redesign, or claims of othercontractors affected by the resulting substitute; and (2) increases or decreases inoperating, maintenance, repair, replacement or spare part costs, all of which will beconsidered by ENGINEER in evaluating the proposed substitute. ENGINEER mayrequire CONTRACTOR to furnish, at CONTRACTOR's expense, additional data aboutthe proposed substitute.Section 00700 00700- 20


6.7.3. ENGINEER shall be the sole judge of acceptability, and no substitute shall be ordered orinstalled without ENGINEER's prior written acceptance. However, CITY reserves theright to reject any proposed substitute which would result in an increase in Contract Priceor Contract Time, and CITY may require CONTRACTOR to furnish at CONTRACTOR'sexpense a special performance guarantee or other surety with respect to any substitute.If approval is given, CONTRACTOR shall not be excused from producing Work inconformity with Contract requirements.6.7.4. ENGINEER will record time required by ENGINEER, DESIGN ENGINEER and theirconsultants in evaluating substitutions proposed by CONTRACTOR and in makingchanges in the Drawings or Specifications occasioned thereby. Whether or notENGINEER accepts a proposed substitute, CITY shall be entitled to deduct from theContract Price, by issuing a Change Order, CITY's costs including the charges ofENGINEER, DESIGN ENGINEER and their consultants for evaluating any proposedsubstitute.6.7.5. The net difference in cost between the substitute item and that specified shall benefitCITY and CONTRACTOR in equal proportions if the substitution was listed on the BidForm. If the substitution was not listed in the Bid Form, all of the savings will go to CITY.If ENGINEER estimates that the deduction proposed by CONTRACTOR does not, in itsopinion, reflect the sharing of costs in the portions described above, this shall beadequate justification to reject the proposed substitution.6.7.6. CONTRACTOR assumes sole responsibility for verifying that the proposed substituteitems are in accordance with the requirements of the Contract Documents, and that thedimensions, arrangement, design and construction details, and all other features ofsubstitute items are suitable for their intended purpose.6.7.7. In the event that a substitute item differs materially from the specified item of material orequipment, and said difference was not expressly identified in CONTRACTOR's requestfor the substitution, or the incorporation of the substitute into the Work results in achange(s) to the Work or in the function or general design of the Project, ENGINEER willhave authority to require the removal and replacement of said substitute.6.8 Concerning Subcontractors, Suppliers and Others6.8.1. CONTRACTOR shall not award Work to Subcontractors in excess of 50 percent of theContract Price without prior written approval of CITY. CONTRACTOR shall not employany Subcontractor, Supplier or other person or organization (including but not limited tothose who are to furnish the principal items of materials or equipment), whether initially oras a substitute, against whom CITY or ENGINEER may have reasonable objection. ASubcontractor, Supplier or other person or organization identified in writing to CITY andENGINEER by CONTRACTOR prior to the Notice of Award and not objected to in writingby CITY or ENGINEER prior to the Notice of Award will be deemed acceptable to CITY orENGINEER. Acceptance of any Subcontractor, Supplier or other person or organizationby CITY or ENGINEER shall not constitute a waiver of any right of CITY or ENGINEER toreject defective Work by CONTRACTOR or any Subcontractor, Supplier or any otherperson or organization. If CITY or ENGINEER after due investigation has reasonableobjection to any Subcontractor, Supplier or other person or organization proposed byCONTRACTOR after the Notice of Award, CONTRACTOR shall submit an acceptablesubstitute. Such Subcontractor, Supplier person or organization shall neither commencenor continue Work after CITY or ENGINEER objects to said entity. In the event that anysuch reasonable objection and acceptable substitute will cause additional expense orextend performance of the Work, or part thereof, beyond the Contract Time for the Work,or part thereof, CONTRACTOR may make a request for an adjustment in Contract Priceor Contract Time. However, any changes in Contract Price made under this paragraphSection 00700 00700- 21


shall exclude any adjustments for any increases in CONTRACTOR's costs in connectionwith an increase in Contract Time resulting from the reasonable objection and acceptablesubstitute submitted pursuant to this paragraph. In any such case, the extension inContract Time so granted, if any, shall be CONTRACTOR's sole and exclusive remedyfor delay, disruption, interference, hindrance and costs thereto. CONTRACTOR shall notbe required to employ any Subcontractor, Supplier or other person or organizationagainst whom CONTRACTOR has reasonable objection.6.8.2. CONTRACTOR shall give prompt written notice to CITY with copy to ENGINEER as tothe identity and qualifications (in accordance with Article 10 of the Instructions to Bidders)of any Subcontractor, Supplier or other person or organization to whom CONTRACTORintends to award Work that was not previously identified in accordance with theInstructions to Bidders, and of CONTRACTOR's intent to remove or replace aSubcontractor, Supplier or other person.6.8.3. CONTRACTOR shall be fully responsible for all acts and omissions of his Subcontractorsand Suppliers and of persons and organizations directly or indirectly employed by themand of persons and organizations for whose acts any of them may be liable to the sameextent that CONTRACTOR is responsible for the acts and omissions of persons directlyemployed by CONTRACTOR. Nothing in the Contract Documents shall create anycontractual relationship between CITY or ENGINEER and any Subcontractor or Supplieror other person or organization having a Sub-agreement with CONTRACTOR, nor shall itcreate any obligation on the part of CITY or ENGINEER to pay or to see to the paymentdue any Subcontractor, Supplier or other person or organization, except as mayotherwise be required by law.CITY or ENGINEER may furnish to any Subcontractor or other person or organization, tothe extent practicable, evidence of amounts paid to CONTRACTOR on account ofspecific Work done. No Subcontractor, Supplier or other person or organization shall bea third party beneficiary of this Contract.6.8.4. The divisions and sections of the Specifications and the identifications of any Drawingsshall not control CONTRACTOR in dividing the Work among Subcontractors or Suppliersor delineating the Work to be performed by any specific trade. The divisions of theSpecifications are complementary, and anything mentioned or shown in a division of theSpecifications or in a specific trade Drawing shall be of like effect as if shown in alldivisions of the Specifications and in all Drawings. In addition to other requirements inthe Contract Documents, Shop Drawings of a specific trade shall be compared to andcoordinated with those from other trades by CONTRACTOR before submission toENGINEER.6.8.5. All Work performed for CONTRACTOR by a Subcontractor, Supplier or other person ororganization will be pursuant to an appropriate Sub-agreement between CONTRACTORand the Subcontractor, Supplier or other person or organization which specifically bindsthe Subcontractor, Supplier or other person or organization to the applicable terms andconditions of the Contract Documents for the benefit of CITY.6.8.6. If requested in writing by CITY, CONTRACTOR shall deliver to CITY a copy of each Subagreementwith a Subcontractor, Supplier or other person or organization performing apart of the Work within seven (7) days of CITY's request.6.9 Patent Fees and RoyaltiesCONTRACTOR shall pay all license fees and royalties and assume all costs incident to the use inthe performance of the Work or the incorporation in the Work of any invention, design, process,product or device which is the subject of patent rights or copyrights held by others. If a particularSection 00700 00700- 22


invention, design, process, product, or device is specified in the Contract Documents for use inthe performance of the Work, and its use is subject to patent rights or copyrights calling for thepayment of any license fee or royalty to others, it shall remain the responsibility ofCONTRACTOR to assume all costs incident to the use in the performance of the Work or theincorporation in the Work of said invention, design, process, product or device.Whenever CONTRACTOR is required or desires to use any design, device, material or processcovered by letters, patent, trademark or copyright, the right for such use shall be provided for bysuitable legal agreements with the patentee or owner, and a copy of this Agreement shall be filedwith ENGINEER. However, whether or not such agreement is made or filed as noted,CONTRACTOR and CONTRACTOR's surety in all cases shall indemnify and hold harmless anddefend CITY and ENGINEER and anyone directly or indirectly employed by either of them fromand against all claims, damages, losses and expenses (including but no limited to charges ofengineers, architects, other professionals and attorneys' fees and attorneys' fees on appeal andall costs of defense or appeal) arising out of any infringement of letters, trademark, patent rightsor copyrights incident to the use in the performance of the Work or resulting from theincorporation in the Work of any invention, design, process, product or device not specified in theContract Documents, and shall defend all such claims in connection with any alleged infringementof such rights.6.10 PermitsUnless otherwise provided in the Contract Documents, CONTRACTOR shall obtain and pay forall construction permits and licenses. CONTRACTOR shall pay all governmental charges andinspection fees necessary for the prosecution of the Work, which are applicable at the time ofopening of Bids. CONTRACTOR shall pay all charges of utility service companies for utilitiesservice to accomplish the Work. If CONTRACTOR fails to obtain or renew any permit or licenserequired by this paragraph, CITY has the option of stopping or suspending the work orterminating the CONTRACTOR's services or procuring any permit or license directly. CITY shallbe entitled to deduct CITY's resultant costs from the Contract Price by issuing a Change Order.CONTRACTOR shall meet all requirements of all permits and licenses.6.11 Laws and Regulations6.11.1 CONTRACTOR shall give all notices and comply with all Laws and Regulationsapplicable to the Work. If CONTRACTOR observes that the Contract Documents are atvariance therewith, CONTRACTOR shall give ENGINEER prompt written notice thereof,and any necessary changes shall be adjusted by an appropriate Change Order (subjectto the provisions of Articles 3, 10, and 11). If CONTRACTOR performs any Workknowing or having reason to know that it is contrary to such Laws or Regulations andwithout such notice to ENGINEER, CONTRACTOR shall bear all costs arising therefrom.CONTRACTOR shall indemnify and hold harmless CITY for all claims, fines, damages,losses and expenses (including but not limited to charges of engineers, architects, otherprofessionals and attorneys' fees and attorneys' fees on appeal and all costs of defenseor appeal) arising out of CONTRACTOR's failure to comply with the terms of thisparagraph.6.11.2 CONTRACTOR shall pay all sales, consumer, use and other taxes required to be paid byit in accordance with the Laws and Regulations of the place of the Project.6.12 Use of Premises6.12.1 CONTRACTOR shall confine construction equipment, the storage of materials andequipment and the operations of workmen to areas permitted by Laws and Regulations,rights-of-way, permits and easements or the requirements of the Contract Documents,and shall not unreasonably encumber the premises with construction equipment or otherSection 00700 00700- 23


materials or equipment. CONTRACTOR shall assume full responsibility for any damageto any such property, or to the owner or occupant thereof or of any other property,caused or alleged to have been caused by or incident to the execution of this Work.CONTRACTOR shall promptly attempt to settle with such other party by agreement orotherwise resolve the claim by arbitration or at law. CONTRACTOR shall, to the fullestextent permitted by Laws and Regulations, indemnify, defend and hold CITY andENGINEER harmless from and against all claims, damages, losses and expenses(including but not limited to charges of engineers, architects and other professionals, andattorneys' fees and attorneys' fees on appeal and all costs of defense or appeal) arisingdirectly, indirectly or consequentially out of any action, legal or equitable, brought by anysuch other party against CITY, DESIGN ENGINEER or ENGINEER to the extent basedon a claim arising out of CONTRACTOR's performance of the Work.6.12.2 Notwithstanding the designation of Contract limits or the indication of temporary fences orbarricades, the provisions of the Contract Documents governing certain phases orportions of the Work, such as trenching and landscaping, may require that certainoperations be carried out beyond such limits. Those operations, if required beyond suchdesignated limits, shall be scheduled in such a manner as to cause or occasion aminimum of inconvenience or disturbance to or interference with the normal operation ofCITY abutters and the public. CONTRACTOR shall obtain CITY's prior approval and allnecessary approvals from others, governmental entities and utility companies for suchoperations, and prosecute such operations expeditiously and restore the affectedproperty to its original condition immediately upon completion of such operations, unlessotherwise specified in the Contract Documents. All those areas on which temporarydriveways or walks are routed shall be restored to their original condition, immediatelywhen normal routing can be reinstated, unless otherwise specified in the ContractDocuments. Pumping, draining and control of surface and groundwater shall be carriedout so as to avoid endangering the Work or any adjacent facility or property, orinterrupting, restricting or otherwise infringing or interfering with the use thereof.6.12.3 Except as specifically arranged with the owners of adjacent premises, CONTRACTORshall avoid any encroachment on adjacent premises. It is specifically agreed thatCONTRACTOR shall repair and make good any damage to adjacent premises orimprovements thereon caused by its operation, including any damage or loss to thetenant of such adjoining premises or to the owners thereof, whether to buildings, stocksof merchandise, trade fixtures, or otherwise.6.12.4 During the progress of the Work, and as directed by the CITY or its representatives,CONTRACTOR shall keep the premises free from accumulations of waste materials,rubbish and other debris resulting from the Work. At the completion of the WorkCONTRACTOR shall remove all waste materials, rubbish and debris from and about thepremises as well as all tools, appliances, construction equipment and machinery, andsurplus materials, and shall leave the site clean and ready for occupancy by CITY.CONTRACTOR shall restore to original condition all property not designated for alterationby the Contract Documents.6.12.5 CONTRACTOR shall not load or permit any part of any structure to be loaded in anymanner that will endanger the structure, nor shall CONTRACTOR subject any part of theWork or adjacent property to stresses or pressures that will endanger it.6.13 Record DocumentsContractor shall maintain in a safe place at the site, one (1) record copy of all drawings,specifications, addenda, change orders, change requests, correspondence, field test records,contractor's daily reports and construction photographs, and written interpretations andclarifications in good order, and annotated to show all changes made during construction. TheseSection 00700 00700- 24


ecord documents, together will all approved samples and shop drawings will be available toENGINEER for reference.The record drawings shall be marked up as the work progresses to reflect current conditions andshall become the "as-built" plans. The revisions are to be indicated in a neat, well-organizedmanner and are to include the elevation and plan location of any utilities, structures, etc.,encountered or installed. A "record" survey book will be kept and shall include the followingitems:1. The location and elevation of all existing utilities, structures, etc. encountered.2. The finished product location and elevation of all utilities and structures installed,including, but not limited to, fire hydrants, catch basin and manhole lids andinverts, and valve boxes.All record notes shall be kept in book(s) designated "record" and no other survey notes will bekept in such books.Contractor will be required to review with ENGINEER the status of the as-built plans and the"record" survey notes in connection with ENGINEER'S evaluation of an application for payment.Failure to maintain record documents current shall be just cause to recommend withholding ofpayments for work performed.Upon completion of the work, ENGINEER shall deliver to the Contractor a reproducible set ofupdated contract plans. CONTRACTOR will transfer all his as-built information to thesereproducible's and deliver the resultant as-built set of plans, together with the record survey bookto ENGINEER for CITY.6.14 Safety and Protection6.14.1 CONTRACTOR shall be solely and completely responsible for initiating, maintaining andsupervising all safety precautions and programs in connection with the Work.CONTRACTOR shall take all necessary precautions for the safety of, and shall providethe necessary protection to prevent damage, injury or loss to all employees on the Workand other persons (including but not limited to the general public) who may be affectedthereby; all the Work and all materials or equipment to be incorporated therein, whetherin storage on or off the site; and other property at the site, adjacent thereto, or utilized byCONTRACTOR including but not limited to trees, shrubs, lawns, walks, pavements,roadways, structures, Underground Facilities and utilities not designated for removal,relocation or replacement in the course of construction regardless of whether or not suchother property is indicated in the Contract Documents. CONTRACTOR's duties andresponsibilities for the safety and protection of the Work shall continue until such time asENGINEER issues a notice to CITY and CONTRACTOR that the Work is acceptable.6.14.2 All damage, injury or loss to any property caused, directly or indirectly, in whole or inpart, by CONTRACTOR, any Subcontractor, Supplier or anyone directly or indirectlyemployed by any of them or anyone for whose acts any of them may be liable, shall beremedied by CONTRACTOR at his sole cost, except damage or loss solely attributable tothe fault of the Drawings or Specifications or the acts or omissions of CITY or ENGINEERor anyone employed by either of them or anyone for whose acts either of them may beliable.6.14.3 CONTRACTOR shall comply with all applicable Laws and Regulations of anygovernmental entity having jurisdiction for the safety of persons or property or to protectthem from damage, injury or loss including, but not limited to, OSHA (Public Law 91-596)and the Contract Work Hours and Safety Standards Act (Public Law 91-54); and shallerect and maintain all necessary safeguards for such safety and protection.Section 00700 00700- 25


CONTRACTOR shall designate a responsible member of his organization at the sitewhose duties shall be preventing accidents and insuring compliance with all applicablesafety regulations. This person shall be CONTRACTOR's superintendent unlessotherwise designated in writing by CONTRACTOR to CITY.6.14.4 When the performance of the Work requires the use of shoring, sheet piling and otherspecial construction related to excavation, and when required by Laws or Regulations,CONTRACTOR shall cause the design of said shoring, sheet piling and other specialconstruction to be performed by a registered professional engineer licensed in the Stateof Florida. CONTRACTOR shall submit, as a Shop Drawing, a certification by theregistered engineer, stating that it has complied with this requirement. CONTRACTORshall meet all requirements of such designs prepared by a registered engineer. Inaddition to any requirements imposed by law, CONTRACTOR shall shore up, brace,underpin, and protect as may be necessary, all foundations and other parts of all existingstructures adjacent to and adjoining the site of the Work which are in any way affected bythe excavations or other operations connected with the performance of the Work.6.14.5 CONTRACTOR shall notify owners of adjacent property and of Underground Facilitiesand utility owners when prosecution of the Work may affect them, and shall cooperatewith them in the protection, removal, relocation and replacement of their property.Whenever any notice is required to be given by CITY or CONTRACTOR to any adjacentor adjoining landowner or other party before commencement of any Work, such noticeshall be given by CONTRACTOR.6.14.6 CONTRACTOR shall take reasonable care during construction to avoid damage tovegetation. Ornamental shrubbery and tree branches shall be temporarily tied back,where appropriate, to minimize damage. Trees which receive damage to branches shallbe trimmed of those branches to improve the appearance of the tree. Tree trunksreceiving damage from equipment shall be treated with a tree dressing.6.14.7 At all times CONTRACTOR shall, and shall cause his Subcontractors and Suppliers to,carefully protect its and their Work, materials, equipment, and supplies against damageor injury from the weather. If in the opinion of ENGINEER any of the above has beendamaged or injured by reason of failure on the part of CONTRACTOR, any Subcontractoror Supplier to perform according to the requirements of this provision, said Work,materials, equipment and supplies shall be removed and replaced at the expense ofCONTRACTOR.6.15 EmergenciesIn emergencies affecting the safety or protection of persons or the Work or property at the site oradjacent thereto, CONTRACTOR, without special instruction or authorization from ENGINEER orCITY, is obligated to act to prevent threatened damage, injury or loss. CONTRACTOR shall giveCITY prompt written notice if CONTRACTOR believes that any significant changes in the Workhave resulted because of the action taken in response to an emergency. If CITY determines thatchanges are required, CITY shall authorize the changes by Change Order or Change Request. Ifthe emergency was not due to the fault or negligence of CONTRACTOR, or any Subcontractor orSupplier or anyone for whose acts any of them may be liable and the changes cause an increaseor decrease in CONTRACTOR's cost or the time required to perform any part of the Work, CITYshall make an adjustment in Contract Price or Contract Time, as provided in Articles 10 & 11.6.16 Shop Drawings and Samples6.16.1 After checking and verifying all field measurements and after complying with applicableprocedures specified in the General Requirements, CONTRACTOR shall submit toSection 00700 00700- 26


DESIGN ENGINEER for review and approval in accordance with the accepted scheduleof Shop Drawing submissions, five (5) copies for use by CITY, DESIGN ENGINEER andENGINEER plus additional copies as required by CONTRACTOR (unless otherwisespecified in the Contract Documents) of all Shop Drawings, which shall have beenchecked by and stamped with the approval of CONTRACTOR and identified as DESIGNENGINEER and ENGINEER may require. CONTRACTOR shall submit a copy of thetransmittal letter providing drawing numbers and titles for each item included in a ShopDrawing submittal to ENGINEER at the same time each submittal is made to DESIGNENGINEER.6.16.2 CONTRACTOR shall also submit to ENGINEER for review and approval, with suchpromptness as to cause no delay in the Work, all samples required by the ContractDocuments. All samples shall have been checked by and stamped with the approval ofCONTRACTOR, identified clearly as to material, manufacturer, any pertinent data suchas catalog numbers and the use for which it is intended.6.16.3 CONTRACTOR's stamp of approval on any Shop Drawing or sample shall specificallyindicate in writing, or if not indicated in writing, shall constitute a representation thatCONTRACTOR has either determined and verified all quantities, dimensions, fieldconstruction criteria, materials, catalog numbers, specified performance criteria, andsimilar data or assumes full responsibility for doing so, and that CONTRACTOR hasreviewed or coordinated each Shop Drawing or sample with the requirements of the Workand the Contract Documents.6.16.4 At the time of each submission, CONTRACTOR shall in writing call ENGINEER'sattention to any deviations that the Shop Drawings or samples may have from therequirements of the Contract Documents, and, in addition, shall cause a specific notationto be made on each Shop Drawing submitted of each such variation.6.16.5 DESIGN ENGINEER will review Shop Drawings and samples and returnCONTRACTOR's submittals stamped with the following notation, as appropriate:NO EXCEPTION TAKEN [ ]FURNISH AS CORRECTED [ ]REVISE AND RESUBMIT [ ]REJECTED [ ]Corrections or comments made on the shop drawings during this review do not relieveCONTRACTOR from compliance with requirements of the drawings and specifications.This check is only for review of the general conformance with the design concept of theproject and general compliance with the information given in the contract documents.The contractor is responsible for: Confirming; and correlating all quantities anddimensions; selecting fabrication processes and techniques of construction; coordinatinghis or her work with that of all other trades and performing all work in a safe andsatisfactory manner."DESIGN ENGINEER's review and approval will be only for conformance with the designconcept of the Project and for compliance with the information given in the ContractDocuments and shall not extend to the accuracy of other matters that may be containedin the submittals, including but not limited to such matters as dimensions, quantities,performance of equipment and systems designed by CONTRACTOR, engineering designfurnished by CONTRACTOR, CONTRACTOR's means, methods, techniques, sequencesor procedures of construction (except where a specific means, method, technique,sequence, or procedure of construction is indicated in or required by the ContractDocuments) or to safety precautions or programs incident thereto, the correctness ofwhich shall remain the sole responsibility of CONTRACTOR. The review and approval ofSection 00700 00700- 27


a separate item as such will not indicate approval of the assembly in which the itemfunctions.CONTRACTOR shall make any corrections required by the DESIGN ENGINEER andshall return the required number of corrected copies of Shop Drawings and resubmit newsamples for review. CONTRACTOR shall direct specific attention in writing to revisionsother than the corrections called for by DESIGN ENGINEER on previous submittals.6.16.6 DESIGN ENGINEER's review and approval of Shop Drawings or samples shall notrelieve CONTRACTOR from responsibility for any variation from the requirements of theContract Documents unless CONTRACTOR has in writing called DESIGN ENGINEER'sattention to each such variation at the time of submission and DESIGN ENGINEER hasgiven written approval of each such variation by a specific written notation thereofincorporated in or accompanying the Shop Drawing or sample approval; nor will anyapproval by DESIGN ENGINEER relieve CONTRACTOR from responsibility for errors oromissions in the Shop Drawings or from responsibility for having complied with theprovisions of paragraph 6.16.3.6.16.7 Where a Shop Drawing or sample is required by the Specifications, no related Work shallbe commenced until the submittal has been returned by DESIGN ENGINEER and noted"No Exception Taken" or "Furnish As Corrected".6.16.8 All costs incurred in connection with DESIGN ENGINEER's or ENGINEER's review andreturn of a particular Shop Drawing or sample submission after DESIGN ENGINEER'ssecond time review shall be borne by CONTRACTOR, including DESIGN ENGINEER'scharges to CITY under the terms of their agreements with CITY. CITY shall be entitled todeduct these costs from the Contract Price by issuing a Change Order.6.16.9 In reviewing Shop Drawings or samples, DESIGN ENGINEER shall be allowed (thirty)30 days from the date DESIGN ENGINEER receives the submittal or re-submittal fromCONTRACTOR to return the submittal in accordance with this Article, unless otherwiseprovided in the Contract Documents. DESIGN ENGINEER's review and return of a ShopDrawing or sample within the time allowed shall not justify an increase in Contract Priceor an extension in Contract Time. Any delay in connection with CONTRACTOR'ssubmittal and any resubmittal of a particular Shop Drawing or sample shall representdelays under the control of CONTRACTOR and shall not justify an increase in ContractPrice or an extension in Contract Time.6.17 Continuing the WorkCONTRACTOR shall carry on the Work and maintain the Progress Schedule during all disputesor disagreements with CITY. No Work shall be delayed or postponed pending resolution of anydisputes or disagreements, except as CONTRACTOR and CITY may otherwise agree in writing.Suspension of the Work by CONTRACTOR during any dispute or disagreement with CITY shallentitle CITY to terminate the CONTRACT for cause, except as otherwise provided in Article 15.6.18 Indemnity6.18.1 To the fullest extent permitted by law, CONTRACTOR shall indemnify, hold harmless anddefend (provide and pay for legal defense) CITY, DESIGN ENGINEER, ENGINEER andtheir consultants, and each of their directors, officers, agents, and employees from andagainst all claims, damages, losses, expenses, and other costs, including costs ofdefense and attorneys' fees, and cost and attorney's fees on appeal, arising in anymanner out of, or resulting from, or in connection with the performance of the Work, bothon and off the job site, provided that any of the foregoing (1) is attributable to personalinjury, bodily injury, sickness, disease or death, or to injury to or destruction of tangibleSection 00700 00700- 28


property (other than the Work itself), including the loss of use resulting therefrom, and (2)is caused in whole or in part by any act or omission of CONTRACTOR, anySubcontractor, any Supplier, anyone directly or indirectly employed by any of them oranyone for whose acts or omissions any of them may be liable, regardless of whether ornot caused in part by any act or omission of a party indemnified hereunder.6.18.2 In any and all claims against the indemnified parties by any employee of CONTRACTOR,any Subcontractor, any Supplier, anyone directly or indirectly employed by any of them oranyone for whose acts any of them may be liable, the indemnification obligation underparagraphs 6.18.1 and 6.18.4 shall not be limited in any way by any limitation on theamount or type of damages, compensation, or benefits payable, by or forCONTRACTOR, or any Subcontractor, or any supplier, or other person under workers'compensation acts, disability benefit acts, or other employee acts.6.18.3 The obligations of CONTRACTOR under paragraphs 6.18.1 and 6.18.4 shall not extendto the liability of DESIGN ENGINEER, ENGINEER and their consultants, and each oftheir directors, officers, employees, and agents arising out of, or resulting from, or inconnection with the preparation or approval of maps, Drawings, opinions, reports,surveys, designs or specifications, providing that the foregoing were the sole andexclusive cause of the loss, damage, or injury.6.18.4 CONTRACTOR shall also indemnify and hold harmless and defend (provide and pay forlegal defense) CITY and ENGINEER and their consultants, and each of their directors,officers, employees, and agents from and against all losses, expenses, damages(including damages to the work itself), attorneys' fees, and other costs (including costsand attorney's fees on appeal), which any of them may incur with respect to the failure,neglect, or refusal of CONTRACTOR to faithfully perform the Work and/or theCONTRACTOR's obligations under the Agreement. Such costs, expenses, and damagesshall include all costs including attorneys' fees and costs and attorneys' fees and costson appeal incurred by the indemnified parties in any lawsuit to which they are a party.6.18.5 At CITY's sole option and utilizing attorneys agreeable to CITY, CONTRACTOR shalldefend all suits or claims as set out in this paragraph 6.18.6.18.6 In the event that CITY incurs costs contrary to this indemnification agreement, CITY shallbe entitled to deduct these costs from the Contract Price by issuing a Change Order.6.19 Progress of the Work6.19.1 If ENGINEER determines that CONTRACTOR is failing to maintain progress of the Workin accordance with the Progress Schedules and the General Requirements,CONTRACTOR shall take steps as may be necessary to improve his progress, andENGINEER may require him to increase his work force, or hours, or days of work, or theamount of construction plant or all of them, and to submit to ENGINEER for approvalsuch supplementary schedule or schedules as may be deemed necessary todemonstrate the manner in which the requisite progress will be regained and maintained,all without additional cost to CITY.6.19.2 Failure of CONTRACTOR to comply with the requirements of ENGINEER under thisArticle shall be grounds for determination by ENGINEER that CONTRACTOR is notprosecuting the Work with such diligence as will insure completion within the timespecified. ENGINEER will then so inform CITY. CITY may thereupon suspend the Workor terminate CONTRACTOR's services should CONTRACTOR fail to comply with theabove paragraph.Section 00700 00700- 29


6.20 Project Meetings6.20.1 The CONTRACTOR along with appropriate subcontractors shall attend Project Meetingsrequested by ENGINEER or CITY for the purpose of discussing and resolving mattersconcerning the various elements of the Work. Representatives attending such meetingsshall have the authority to bind their respective entities to any decisions made.CONTRACTOR shall prepare minutes of the meeting and distribute copies of suchminutes within five (5) calendar days to each participant for review and approval.Participants shall review the above mentioned minutes and, if a discrepancy is foundnotify the other participants in writing within one week of receipt of the minutes. IfCONTRACTOR and/or his subcontractors fail to attend a meeting, CITY shall be entitledto deduct the costs of CITY, COUNTY, ENGINEER, and DESIGN ENGINEERrepresentatives attending the meeting from the CONTRACT PRICE by issuing a ChangeOrder.6.20.2 CONTRACTOR shall submit for the Project Meeting a summary bar chart of the workactivities anticipated for the following fourteen days. This schedule will be used by theENGINEER for the planning of testing and inspection and shall be an item of discussionat the Project Meeting.6.21 CONTRACTOR Not Agent of CITYCONTRACTOR shall perform all Work under this Agreement as an Independent Contractor andshall not be considered an agent of CITY, nor shall CONTRACTOR's Subcontractors or Suppliersor employees be considered agents of CITY. CONTRACTOR and not CITY shall be solelyresponsible to any and all Subcontractors and Suppliers and all those employed by them for theircosts, expenses, fees and profits, if any, in performing the Work.6.22 Inspection and Audit6.22.1 CITY shall have access to the Work and the right to audit all of CONTRACTOR's books,ledgers, records, correspondence, instructions, drawings, receipts, vouchers,memoranda, and other documents pertinent to all Cost and Pricing Data used byContractor in the determination of CONTRACTOR'S Bid for the Work, in pricing,negotiating or costing Work covered by a Change Order, Change Request or claim, orotherwise relating to the Work, and CONTRACTOR shall preserve and make available atCONTRACTOR's office at all reasonable times all such records for a period of five (5)years after Final Payment.6.22.2 In the event of termination, the records relating to the Work, or part thereof, affected bysuch termination shall be made available for five (5) years after the termination. Recordspertaining to claims, to litigation or the settlement of claims arising under or relating to theperformance of the Work shall be made available until disposition of such appeals,litigation, or claims.6.22.3 CONTRACTOR shall insert a provision containing all the requirements of paragraph 6.22,including this paragraph 6.22.3, in all Sub-agreements between CONTRACTOR andSubcontractors or Suppliers or other persons, altering the paragraph only as necessaryto identify properly the contracting parties.6.23 Truth-In-Negotiation6.23.1 CONTRACTOR warrants that all bid line items are true, complete and accurate andinclude all costs, overhead, profit and all other amounts associated with such items andmay be relied upon by CITY when making additions or deductions to the Contract Price.Section 00700 00700- 30


CONTRACTOR further warrants that all Cost and Pricing Data provided to ENGINEERand CITY during the term of the Agreement shall be complete, accurate and currentwhen provided. Should there be any changes in the Cost and Pricing Data previouslysubmitted, the CONTRACTOR shall notify and provide the new information toENGINEER and CITY immediately. CITY shall be entitled to issue an appropriateChange Order to adjust the Contract Price and Contract Time on account of correctionsto inaccurate or incomplete information provided by CONTRACTOR.6.23.2 Despite any provisions in the Contract Documents to the contrary, any amounts paid byCITY to CONTRACTOR in excess of what it is entitled under the Contract Documentsshall be reimbursed by CONTRACTOR to CITY. The making of Final Payment toContractor shall not be a waiver of City's right to reimbursement from Contractor nor shallit discharge Contractor's obligation to refund the overpayment. The terms of paragraph6.23 shall survive the City's making Final Payment.6.23.3 CONTRACTOR shall insert a provision containing all the requirements if paragraph 6.23,including this paragraph 6.23.3, in all Sub-agreements between CONTRACTOR andSubcontractors or Suppliers or other persons, altering the paragraph only as necessaryto identify properly the contracting parties.6.24 CorrespondenceAll CONTRACTOR's correspondence shall have identification numbers assigned byCONTRACTOR. The identification numbers shall be sequential and assigned chronologicallysuch that each CONTRACTOR's submission can be individually identified by reference to theassigned identification number. The numbering system must be approved by ENGINEER. Anycorrespondence not so identified may not be accepted by ENGINEER.6.25 Protection of Historical Properties6.25.1 CONTRACTOR shall comply with Florida's Archives and Historical Act (Florida StatutesChapter 267) and the regulations of the local historic preservation board as applicableand protect against the potential loss or destruction of significant historical orarchaeological data, sites, and properties in connection with the Work.6.25.2 CONTRACTOR shall be responsible for reporting immediately to the governmental entityor agency with jurisdiction any archaeological features which are encountered orunearthed during the performance of the Work, and for protecting same to thesatisfaction of such governmental entity or agency. CONTRACTOR shall absorb allrelated delay, extension or acceleration costs, however caused, except that if CITY andCONTRACTOR believe the delays require an extension in Contract Time, CITY shallauthorize the necessary change in Contract Time only.6.26 Responsibility for Connecting to Existing Services and UtilitiesAt all points where the Work constructed by CONTRACTOR connects to existing utilities andservices, the actual Work of making the necessary connection to the existing service or utilityshall be arranged for by CONTRACTOR at no expense to CITY (unless specifically indicatedotherwise).Services and utilities included within (but not limited to) this responsibility are roads, ditches,electrical, sewer, mechanical utilities, water, reuse, fencing, etc. Connections shall be made at atime that will result in the least possible interference with existing services.Section 00700 00700- 31


6.27 Additional Provisions6.27.1 CONTRACTOR shall be responsible for all cutting of masonry and other materials, andall fitting, drilling or patching which may be necessary to complete the Work or to make itsseveral parts fit together properly, whether or not such Work is expressly specified in theContract Documents.6.27.2 CONTRACTOR shall be responsible for preparing and delivering to ENGINEER, on adaily basis, reports recording labor and equipment available and utilized, and materialsand equipment received each day, on a form acceptable to ENGINEER. IfCONTRACTOR fails to submit reports daily, ENGINEER may withhold approval of anyApplication for Payment until such time as CONTRACTOR submits the requiredinformation. CONTRACTOR shall make available any such records as requested byENGINEER to verify that the reports are accurate.6.27.3 CONTRACTOR shall submit to ENGINEER at the beginning of each work shift, a list ofspecific items requiring final inspection, monitoring, or witnessing by ENGINEER.ARTICLE 7 - WORK BY OTHERS7.1 Related Work At Site7.1.1 CITY may perform other work at the site by CITY's own forces, provide for or allow otherwork to be performed by other owners, or let other direct contracts for other work. If thefact that such other work is to be performed was not noted in the Contract Documents,written notice thereof will be given to CONTRACTOR prior to starting any such otherwork.7.1.2 CONTRACTOR shall afford each owner and contractor (or CITY, if CITY is performingthe additional work with CITY's employees) proper and safe access to the site and areasonable opportunity for the introduction and storage of materials and equipment andthe execution of such work, and shall properly connect and coordinate the Work withtheirs. CONTRACTOR shall do all cutting, fitting and patching of the Work that may berequired to make it integrate properly with such other work. CONTRACTOR shall notendanger any work of others by cutting, excavating or otherwise altering their work andwill only cut or alter their work with the written consent of ENGINEER and the otherswhose work will be affected. The Contractor is not entitled to exclusive use of the site.7.1.3 If any part of CONTRACTOR's Work depends for proper execution or results upon thework of CITY or any such other contractor or owner, CONTRACTOR shall inspect andpromptly report to ENGINEER in writing any delays, defects or deficiencies in such workthat render it unavailable or unsuitable for such proper execution and results.CONTRACTOR's failure to so report will constitute an acceptance of the other work as fitand proper for integration with CONTRACTOR's Work except for latent or nonapparentdefects and deficiencies in the other work. Wherever Work to be performed byCONTRACTOR is dependent upon the work of any separate contractor, CONTRACTORshall: (1) coordinate his Work with the dependent work; (2) provide necessary dependentdata and requirements; (3) supply and/or install items to be built into dependent work ofothers; (4) make provisions for dependent work; (5) check and verify dependentdimensions of previously placed work; (6) notify ENGINEER of previously placeddependent work or dependent dimensions which are unsatisfactory or will prevent asatisfactory installation of any such Work; and (7) not proceed with any such Work untilany unsatisfactory dependent conditions have been corrected. Installation of Work byCONTRACTOR or by a Subcontractor in any given area shall constitute acceptance byCONTRACTOR or by such Subcontractor of all previously placed dependent work,subject to the exceptions previously noted.Section 00700 00700- 32


7.1.4 If CITY contracts with others for the performance of other work at the site, the person ororganization with the authority and responsibility for coordination of the activities amongthe various prime contractors may be identified in the Supplementary Conditions, and thespecific matters to be covered by such authority and responsibility may be itemized, andthe extent of such authority and responsibilities may be provided, in the SupplementaryConditions. Unless otherwise provided in the Supplementary Conditions, coordinationwith other prime contractors will be the responsibility of each prime contractor and neitherCITY nor ENGINEER shall have any authority or responsibility in respect of suchcoordination.7.2 Mutual Duties and Responsibilities7.2.1. Should CONTRACTOR cause damage to the work or property of any separate contractoror owner performing work at or contiguous to the site, or should any claim arising out ofCONTRACTOR's performance of Work at or contiguous to the site be made by anyseparate contractor or utility owner against CONTRACTOR, CITY, ENGINEER, orDESIGN ENGINEER, CONTRACTOR shall promptly attempt to settle with such separatecontractor or utility owner by agreement, or to otherwise resolve the dispute at equity orat law. CONTRACTOR shall, to the fullest extent permitted by Laws and Regulations,hold harmless, defend and indemnify CITY, ENGINEER, DESIGN ENGINEER, and theirconsultants, directors, officers, agents, and employees from and against all claims,damages, losses, costs and expenses (including attorney's fees and attorney's fees onappeal) arising directly, indirectly or consequentially out of any action, legal or equitable,or resulting from damage to the Work of others caused by CONTRACTOR's performanceof the Work.7.2.2. Should any separate contractor or owner cause damage to the Work or property ofCONTRACTOR, or should the performance of work by any separate contractor or ownerat or contiguous to the site give rise to any other claim by CONTRACTOR,CONTRACTOR shall promptly attempt to settle with such separate contractor or ownerby agreement, or to otherwise resolve the dispute at equity or at law. CONTRACTORshall not institute any action, legal or equitable, against CITY, ENGINEER, DESIGNENGINEER, or their consultants directors, officers, agents, and employees or permit anyaction against them to be maintained and continued in its name or for its benefit in anycourt or before any arbiter which seeks to impose liability or recover damages from CITY,ENGINEER, DESIGN ENGINEER or their consultants, directors, officers, agents, oremployees on account of these.7.2.3. In the event that CITY incurs costs contrary to the provisions of this paragraph, CITY willbe entitled to deduct these costs from the Contract Price by using a Change Order.7.3 Extensions in Contract Time7.3.1. If CONTRACTOR is delayed at any time in performing or furnishing the Work by any actor neglect of another contractor or entity performing work at the site noted in the ContractDocuments, CONTRACTOR may request an extension in Contract Time; if CITYbelieves that the delay requires an adjustment in Contract Time, CITY shall authorize thenecessary extension of Contract Time. However, an extension in Contract Time(s), if sogranted, shall be CONTRACTOR's sole and exclusive remedy with respect to CITY,ENGINEER, and DESIGN ENGINEER, and their consultants, agents and employees forany delay, disruption, interference, extension, acceleration or hindrance and associatedcosts, however caused, resulting from delays caused by others performing other work atthe site.Section 00700 00700- 33


7.4 Contract Time Coordination7.4.1. CONTRACTOR shall give prompt written notice to CITY, ENGINEER and any otheraffected contractor(s) whenever CONTRACTOR anticipates a conflict in Contract Time(s)related to or simultaneous with associated contract time (s) in the work of others. Withinseven (7) days thereafter, CONTRACTOR shall be required to deliver to ENGINEERproposed actions to either (a) prevent an adverse effect on the Progress Schedule of theother contractors arising from delays to the Work, or (b) prevent or overcome an adverseeffect on the Progress Schedule for the Work arising from delays from another contract.7.4.2. When Work is performed out of sequence and ahead of interfacing work, CONTRACTORshall be responsible for taking reasonable steps to minimize damage or loss to the Workwhich may be caused by others during the performance of their work, including (but notlimited to) furnishing written notice to ENGINEER and to the other contractors that Workhas been performed out of sequence and ahead of interfacing work.7.4.3. When work by others is performed out of sequence and ahead of interfacing Work, thesaid work shall be considered as if it had been shown on the Contract Documents.CONTRACTOR shall be responsible for protecting said work and shall replace, repair orotherwise settle with others any and all damage caused as a result of the performance ofwork out of sequence unless CONTRACTOR had no actual knowledge thereof or couldnot reasonably have known thereof.ARTICLE 8 - CITY'S RESPONSIBILITIES8.1 General8.1.1. CITY shall generally issue all communications to CONTRACTOR through theConstruction Manager.8.1.2. In case of termination of the employment of ENGINEER, CITY shall appoint an engineerwhose status under the Contract Documents shall be that of the former ENGINEER.8.1.3. CITY shall furnish the data required of CITY under the Contract Documents promptly andshall make payments to CONTRACTOR promptly after they are due as provided inArticle 14.8.1.4. CITY's duties in respect of providing lands and easements and engineering surveys toestablish reference points, and identifying and making available to CONTRACTORcopies of reports of explorations and tests of subsurface conditions at the site and inexisting structures which have been utilized by DESIGN ENGINEER in preparing theDrawings and Specifications are set forth in Article 4.8.1.5. CITY will issue unilaterally or negotiate, at its discretion, Change Orders and ChangeRequests as provided in Article 10.8.1.6. CITY's responsibility in respect of certain inspections, tests and approvals is set forth inArticle 13.8.1.7. CITY may allow its consultants, agents, attorneys, employees, and others access to thesite. CONTRACTOR shall cooperate with CITY in allowing such access.Section 00700 00700- 34


ARTICLE 9 - ENGINEER'S AND DESIGN ENGINEER'S STATUS DURING CONSTRUCTION9.1 CITY'S RepresentativeENGINEER will be CITY's representative during the construction of the Work. The duties andresponsibilities and the limitations of authority of ENGINEER as CITY's representative duringconstruction are set forth in the Contract Documents and shall not be extended without writtenconsent of CITY and ENGINEER.9.2 Visits to Site9.2.1. DESIGN ENGINEER may make visits to the site at intervals appropriate to the variousstages of construction to observe the progress and quality of the executed Work and todetermine, in general, if the Work is proceeding in accordance with the ContractDocuments.9.2.2. ENGINEER will make visits to the site at intervals appropriate to the various stages ofconstruction to observe the progress and quality of the executed Work and to determine,in general, if the Work is proceeding in accordance with the Contract Documents.9.3 Project RepresentationCITY may furnish a Construction Manager and/or Field Representative(s) to represent the CITYand observe the performance of the Work.9.4 Duties, Responsibilities and Limitations of Authority of Construction Manager:9.4.1. Construction Manager or Field Representative will act as directed by the CITY and willconfer with ENGINEER regarding his activities. Construction Manager, if assigned, willperform the duties and responsibilities described herein with the assistance of FieldRepresentative(s). ENGINEER shall generally issue all communications toCONTRACTOR through Construction Manager, including but not limited tocommunications directed to CONTRACTOR, from CITY through ENGINEER.CONTRACTOR shall generally issue all communications to CITY, DESIGN ENGINEERand ENGINEER through Construction Manager or Field Representative.9.4.2. Construction Manager will: provide instructions to Field Representative(s) on proceduresto be followed and schedule inspections of the Work; review daily inspection reportsprepared by Field Representative(s); prepare draft Field Orders, Change Requests orChange Orders as required and review them with Field Representative(s),DesignEngineer, ENGINEER or CITY, as applicable.9.4.3. Construction Manager or Field Representative will attend meetings with CONTRACTOR,such as the Preconstruction Conference, Project Meetings and any other Project relatedmeetings and review and circulate copies of minutes thereof.9.4.4. Construction Manager will serve as DESIGN ENGINEER's liaison with CONTRACTOR,working principally through CONTRACTOR's superintendent, to assist in understandingthe intent of the Contract Documents, and will serve as CITY's liaison withCONTRACTOR when CONTRACTOR's operations affect CITY's on-site operations, andwhen additional information is required from CITY for proper execution of the Work.9.4.5. Construction Manager will advise CONTRACTOR, through or with the assistance of FieldRepresentative(s), of the commencement of any Work requiring a Shop Drawing orsample, when it is observed that a submittal has not been reviewed by DESIGNENGINEER.Section 00700 00700- 35


9.4.6. Construction Manager will conduct on-site observations of the Work in progress andreceive Field Representative(s)'s observation comments and non-conformance reports,to determine if the Work is proceeding in accordance with the Contract Documents.9.4.7. Construction Manager will notify CONTRACTOR of disapproval or rejection of Workwhenever Construction Manager or ENGINEER believe that any Work is defective, andwill notify CONTRACTOR whether defective Work is to be corrected, or replaced.9.4.8. Construction Manager will notify CONTRACTOR of any Work that is to be uncovered forobservation, testing inspection or approval.9.4.9. Construction Manager will accompany, through or with the assistance of FieldRepresentative(s), visiting inspectors representing governmental or other agencieshaving jurisdiction over the Project, and record the results of the inspections and report toENGINEER.9.4.10 Construction Manager will transmit to CONTRACTOR clarifications and interpretations asissued by ENGINEER.9.4.11 Construction Manager will consider and evaluate CONTRACTOR's proposed variationsand the changes in the Work or the Contract Documents and report such proposals andevaluations to ENGINEER. Construction Manager will communicate decisions on suchproposals to CONTRACTOR as issued by ENGINEER or CITY.9.4.12 Construction Manager will report promptly to ENGINEER and CITY upon gainingknowledge of the occurrence of any accident at the site.9.4.13 Construction Manager will prepare reports of the progress of the Work and ofCONTRACTOR's compliance with the Progress Schedule.9.4.14 Construction Manager will consult as appropriate with ENGINEER in advance ofscheduled major tests, inspections or the commencement of important phases of theWork.9.4.15 Construction Manager will review and evaluate CONTRACTOR's Application for Paymentand advise ENGINEER accordingly.9.4.16 Construction Manager will review and evaluate CONTRACTOR's notice thatCONTRACTOR considers the Work (or part thereof) substantially complete and adviseENGINEER accordingly.9.4.17 Construction Manager will observe whether all items on lists of items to be completedprior to Final Payment have been completed and make recommendations to ENGINEERconcerning Acceptance.9.4.18 During the course of the Work, the Construction Manager will verify that certificates,maintenance and operation manuals and other data required to be assembled andfurnished by CONTRACTOR are applicable to the items actually installed and deliver thismaterial to ENGINEER.9.4.19 Construction Manager will not: (1) authorize any variation or change in the Work or in theContract Documents or approve any equivalent material or equipment; (2) exceed thelimitations of Construction Manager's authority as set forth in this document; (3)undertake any of the responsibilities of CONTRACTOR, Subcontractors orCONTRACTOR's superintendent, or expedite the Work; (4) inspect, advise on or issueSection 00700 00700- 36


directions relative to any aspect of the means, methods, techniques, sequences orprocedures of construction unless such is specifically called for in the ContractDocuments; (5) inspect, advise on or issue directions as to safety precautions andprograms in connection with the Work; (6) certify Substantial Completion of the Work; or(7) participate in specialized field or laboratory tests.9.5 Duties, Responsibilities and Limitations of Authority of Field Representative(s)9.5.1. As requested by Construction Manager, Field Representative(s) will assist in obtainingfrom CITY additional details or information, when required at the job site for properexecution of the Work.9.5.2. Field Representative(s) will advise Construction Manager and CONTRACTOR of thecommencement of any Work requiring a Shop Drawing or sample submission if heobserves that a submittal(s) has not been reviewed by DESIGN ENGINEER.9.5.3. Field Representative(s) will conduct on-site observations of the Work in progress to assistConstruction Manager in determining if the Work is proceeding in accordance with theContract Documents and that completed Work will substantially conform to the ContractDocuments.9.5.4. Field Representative(s) will notify CONTRACTOR and report to Construction Manager forreview and possible disapproval or rejection by ENGINEER or Construction Managerwhenever he believes that any Work is defective.9.5.5. Field Representative(s) will notify CONTRACTOR and report to Construction Manager fordetermination of necessary action by ENGINEER or Construction Manager when hebelieves Work should be uncovered for observation, testing, inspection or approval.9.5.6. Field Representative(s) will verify that tests, equipment and systems start-ups andoperating and maintenance instructions are conducted as required by the ContractDocuments and in the presence of the required personnel and that CONTRACTORmaintains adequate records thereof; observe, record and report to Construction Managerappropriate details relative to the test procedures and start-ups.9.5.7. Field Representative(s) will report to Construction Manager when clarifications andinterpretations of the Contract Documents are needed or requested.9.5.8. Field Representative(s) will keep a diary recording hours on the job site, weatherconditions, data relative to questions of extras or deductions, lists of visiting officials andrepresentatives of Suppliers, daily activities, decisions, observations in general andspecific observations in more detail as in the case of observing test procedures. FieldRepresentative(s) will summarize such information on the daily inspection report andsubmit copies to Construction Manager.9.5.9. Field Representative(s) will assist Construction Manager with record keeping as directedby Construction Manager.9.5.10 Field Representative(s) will report immediately to CITY, ENGINEER and ConstructionManager upon gaining knowledge of the occurrence of any accident.9.5.11 Field Representative(s) will assist Construction Manager with the review and evaluationof CONTRACTOR's Application for Payment, noting particularly their relation to theschedule of values, Work completed, and materials and equipment delivered at the sitebut not incorporated in the Work.Section 00700 00700- 37


9.5.12 Field Representative(s) will prepare draft lists of items to be completed or corrected(punch lists) as directed by Construction Manager.9.5.13 Field Representative(s) will not: (1) authorize any variation or change in the Work or inthe Contract Documents or approve any equivalent material or equipment; (2) exceed thelimitations of Field Representative(s)'s authority as set forth in this document; (3)undertake any of the responsibilities of CONTRACTOR, Subcontractors orCONTRACTOR's superintendent, or expedite the Work; (4) inspect, advise on or issuedirections relative to any aspect of the means, methods, techniques, sequences orprocedures of construction unless such is specifically called for in the ContractDocuments; (5) inspect, advise on or issue directions as to safety precautions andprograms in connection with the Work; (6) certify Substantial Completion of the Work; or(7) participate in specialized field or laboratory tests.9.6 Clarifications and InterpretationsENGINEER will issue with reasonable promptness such written clarifications or interpretations ofthe requirements of the Contract Documents (in the form of Drawings or otherwise) asENGINEER may determine necessary, which shall be consistent with or reasonably inferablefrom the overall intent of the Contract Documents.9.7 Authorized Variations in WorkENGINEER may authorize minor variations in the Work from the requirements of the ContractDocuments which do not involve an adjustment in the Contract Price or the Contract Time andare consistent with the overall intent of the Contract Documents and required to produce theintended result. These may be accomplished by a Field Order and will be binding onCONTRACTOR who shall perform the Work involved promptly.9.8 Rejecting Defective WorkENGINEER will have authority to disapprove or reject Work at any time during the construction ofthe Work, which ENGINEER believes to be defective. ENGINEER will also have authority torequire special inspection or testing of the Work, whether or not the Work is fabricated, installed,or completed. When CONTRACTOR has been notified by ENGINEER of disapproval or rejectionof defective Work, CONTRACTOR shall take immediate action to correct or replace same.9.9 Determinations of Quantities and Classifications of Unit Price WorkField Representative or Construction Manager will determine the actual quantities of eachclassification of Unit Price Work. Field Representative or Construction Manager will review withCONTRACTOR, Field Representative or Construction Manager's preliminary determinations onsuch matters before rendering a written decision thereon (by recommendation of an Applicationfor Payment or otherwise). Field Representative or Construction Manager's written decisionsthereon will be final and binding upon CONTRACTOR, unless, with seven (7) days after the dateof any such decision, CONTRACTOR delivers to CITY written notice of a claim.9.10 Decisions on DisputesDESIGN ENGINEER will be the initial interpreter of the requirements of the Contract Documents,and in such capacity will render initial determinations in respect of the acceptability of the Workthereunder. Unless otherwise provided in the Contract Documents, notices, proposals or othermatter relating to the acceptability of the Work or the interpretation of the requirements of theContract Documents pertaining to the performance and furnishing of the Work will be referredinitially to DESIGN ENGINEER in writing with a request for a formal decision in accordance withthis paragraph, which DESIGN ENGINEER will render within a reasonable time. DESIGNSection 00700 00700- 38


ENGINEER's written determination thereon shall be final and binding on CONTRACTOR unlessCONTRACTOR delivers to CITY written notice of a claim within seven (7) days of receipt of suchdecision.9.11 Limitations on ENGINEER's and DESIGN ENGINEER's Responsibilities9.11.1 Neither ENGINEER's or DESIGN ENGINEER's authority to act under this Article orelsewhere in the Contract Documents nor any decision or determination made byENGINEER or DESIGN ENGINEER in good faith to exercise or not to exercise suchauthority shall give rise to any duty or responsibility of ENGINEER or DESIGNENGINEER to CONTRACTOR, any Subcontractor, any Supplier, or any other person ororganization performing any of the Work, or to any surety for any of them.9.11.2 Whenever in the Contract Documents the terms "as ordered", "as directed", "as required","as allowed", "as approved" or terms of like effect or import are used, or the adjectives"reasonable", "suitable", "acceptable", "proper" or "satisfactory" or adjectives of like effector import are used to describe requirement, direction, review or judgment of ENGINEERor DESIGN ENGINEER as to the Work, it is intended that such requirement, direction,review or judgment will be solely to evaluate the Work for compliance with the ContractDocuments (unless there is a specific statement indicating otherwise).The use of any such term or adjective shall not be effective to assign to ENGINEER orDESIGN ENGINEER any duty or authority to supervise or direct the furnishing orperformance of the Work or any duty or authority to undertake responsibility contrary tothe provisions of this Article.9.11.3 ENGINEER and DESIGN ENGINEER will not be responsible for CONTRACTOR'smeans, methods, techniques, sequences or procedures of construction, or the safetyprecautions and programs incident thereto, and ENGINEER and DESIGN ENGINEERwill not be responsible for CONTRACTOR's failure to perform or furnish the Work inaccordance with the Contract Documents.9.11.4 ENGINEER and DESIGN ENGINEER will not be responsible for the acts or omissions ofCONTRACTOR or of any Subcontractor, any Supplier, or of any other person ororganization performing or furnishing any of the Work.ARTICLE 10 - CHANGES IN THE WORK10.1 Changes in the Work10.1.1 Without invalidating the Agreement and without notice to any surety, CITY may, at anytime, by duly executed Change Order or Change Request, order changes within thescope of the Agreement consisting of additions, deletions or other revisions in the Work.Upon receipt of that order, CONTRACTOR shall promptly proceed or continue with theWork involved (based on the conditions stated and other applicable conditions in theContract Documents). If a change under this Article causes an increase or decrease inthe Contract Price or any extension or shortening of the Contract Time, CITY will makean adjustment as provided in Article 11.10.1.2 CITY or ENGINEER may present to CONTRACTOR an unsigned proposed ChangeRequest requesting that CONTRACTOR submit a proposal for an adjustment in ContractPrice or Contract Time for a proposed change in the Work. CONTRACTOR shall submita proposed adjustment with all supporting data in accordance with Article 11 and thedirections given in the Change Request within 14 days of receipt. Said proposedadjustment shall include an itemized estimate of all costs and time for the performancethat will result directly or indirectly from the changes described. Estimates shall beSection 00700 00700- 39


prepared in accordance with the requirements of Article 11 and in sufficient detail andwith documentation such that ENGINEER can (1) analyze all material, labor, equipment,subcontract, overhead costs and fees, and any other costs covering all aspects of theWork involved in the change, whether such was added, deleted, changed, or impacted;(2) determine that the proposal reflects all impacts on the Contract of the proposedchange; and (3) establish that all Contract provisions have been complied with. Anyamount proposed for Subcontractors or Suppliers shall be similarly supported.10.1.3 CITY or ENGINEER may give instructions which may result in changes in the Work notinvolving an adjustment in the Contract Price or the Contract Time when such changesare necessary or expedient to the satisfactory performance and completion of the Work.These instructions shall be binding on CONTRACTOR.Any instruction, direction, interpretation, or determination from CITY, ENGINEER or anyother source which causes a change shall be treated as a change under this Articleprovided that CONTRACTOR gives ENGINEER written notice stating the date,circumstances, specific order, and that CONTRACTOR regards the instruction as achange.Such written notification shall be given to ENGINEER within 7 days after receipt andbefore CONTRACTOR acts on said instruction, direction, interpretation, or determination.No claim, change or notice by CONTRACTOR will be allowed if asserted after work hascommenced on, or if notice is not provided within the stated time limit provided afterreceipt of, the instruction, direction, interpretation, or determination from CITY,ENGINEER, or any other source.10.1.4 In making changes under this Article, CITY may give consideration to a notice, proposalor claim from CONTRACTOR, provided the notice, proposal or claim is presented inaccordance with the requirements of this Article and Article 11. CONTRACTOR shallprovide CITY or ENGINEER any additional or supplemental information requested forpurposes of evaluation of CONTRACTOR's submittal, but such requests by the CITY orENGINEER will not constitute acceptance of the notice, proposal or claim.10.1.5 ENGINEER will evaluate a change notice, proposal or claim from CONTRACTOR, andCITY will review with CONTRACTOR the results of the evaluation before rendering adetermination. If CITY, with the advice of ENGINEER, concurs that a change in the Workhas occurred or been ordered, CONTRACTOR will be directed to submit a proposal foran adjustment in accordance with paragraph 10.1.2. If CITY concludes that a changehas not occurred or been ordered, CITY's determination shall be final and binding onCONTRACTOR unless CONTRACTOR delivers to CITY written notice of a claim within 7days from receipt of such decision.10.1.6 If notice of any change affecting the general scope of the Work or change in the ContractPrice is required by the provisions of any Bond to be given to the Surety, it shall beCONTRACTOR's responsibility to so notify the Surety, and the amount of each applicableBond shall be adjusted accordingly. CONTRACTOR shall furnish proof of suchadjustment to CITY if requested.10.2 Change Orders and Change Requests10.2.1 Contract Price or Contract Time shall be changed only by Change Order. The basis for asubsequent change in Contract Price or Contract Time may also be authorized byChange Request duly executed by the CITY.10.2.2 A Change Order duly executed by CITY and CONTRACTOR provides for an all inclusivesettlement for all changes and direct, supplemental, indirect, consequential andSection 00700 00700- 40


cumulative costs and delays, and CONTRACTOR's signature represents a waiver of anyand all rights to file a claim on account of that instrument.10.2.3 CITY and CONTRACTOR shall execute Change Orders covering changes in the Work(including any necessary adjustments in Contract Price or Contract Time) which areordered or agreed to by the parties, changes in Contract Price or Contract Time whichare agreed to in total or in part, or previously executed Change Requests with reasonablepromptness. Adjustments to Contract Price resulting from changed work shall only beincluded in Applications for Payment after a Change Order has been duly executed.10.2.4 When duly executed by CITY, CITY may use Change Requests to order changes in theWork, provide the basis for a subsequent adjustment in Contract Price or Contract Time,or authorize deviations in the Work. Amounts for work directed by a Change Requestshall not be included in Applications for Payment until that Change Request has beenincorporated into a Change Order.10.2.5 A Change Order, or Change Request, duly executed by CITY, but not executed byCONTRACTOR, or executed by CONTRACTOR with a notice of reservation of rights toclaim additional adjustments, shall become final and binding on CONTRACTOR, withoutconsideration of the reservation of rights, unless CONTRACTOR delivers to CITY writtennotice of a claim within 7 days after receipt of that instrument.10.2.6 An unsigned Change Request may be used by CITY and CONTRACTOR to negotiatechanges in the Work, or in Contract Price or Contract Time. A Change Request will bethe instrument used by CITY to direct Work on a cost of the Work basis as described inArticle 11.10.3 WaiversA Change Order will be issued to incorporate the instruction to proceed with a change ona cost of the Work basis into the Contract Documents after the actual cost of the workhas been determined.10.3.1 No proposal or claim by CONTRACTOR for an adjustment under this Article shall beallowed for any costs or delay incurred more than 7 days before CONTRACTOR giveswritten notice as required.10.3.2 No proposal or claim by CONTRACTOR for an adjustment under this Article shall beallowed if made after the date of Final Payment.10.3.3 Additional Work performed without authorization of a Change Order or properly executedChange Request will not entitle CONTRACTOR to an increase in Contract Price or anextension of Contract Time, except in the case of an emergency as provided in Article 6.10.3.4 CONTRACTOR acknowledges that there may be changes during the course of the Workand acknowledges that the probable effect of changes has been accounted for in thedevelopment of the Contract Price and Progress Schedule. Whenever CONTRACTORmakes a proposal or claim under Article 11 such proposal or claim shall include the totalamount of adjustment in Contract Price and Contract Time to which the CONTRACTORbelieves it is entitled. Except as CITY and CONTRACTOR may otherwise agree inwriting, CONTRACTOR shall be deemed to have waived (1) any adjustment to which itmight otherwise be entitled under Article 11 where such proposal or claim fails to requestsuch adjustments, (2) any increase in the amount of adjustment additional to thatrequested in the proposal or claim, and (3) any claim for reimbursement of impactallegedly resulting from the cumulative effect of the number, nature, or extent of anychanges.Section 00700 00700- 41


ARTICLE 11-CHANGES IN CONTRACT PRICE OR CONTRACT TIME11.1 Changes in Contract Price or Contract TimeThe Contract Price constitutes the total compensation (subject to authorized adjustments)payable to CONTRACTOR for all duties, responsibilities, and obligations required to perform theWork. All duties, responsibilities, and obligations assigned or undertaken by CONTRACTOR shallbe at its expense without change in the Contract Price or Contract Time except as set out below.11.2 Proposals or Claims Substantiating Adjustments11.2.1 Supporting data for any proposal or claim by the CONTRACTOR shall include at aminimum a complete and detailed breakdown of the proposed price and a detailedexplanation of any time impact for the change. Said proposed price shall be based onthe lowest reasonable cost consistent with sound construction practice. Such breakdownshall include itemizations by trade of all labor with man hours and hourly rates, equipmentwith hours of use and rates, and material by item with costs, all in sufficient detail toevaluate the cost of the individual components of the Work, including copies of purchaseorders, invoices and subcontract change orders.11.2.2 CONTRACTOR proposals or claims shall state in writing, and provide evidence that theamounts included cover all direct, supplemental, indirect, consequential, and cumulativecosts and delays, as applicable, and that those costs and delays would be or werenecessarily incurred, despite CONTRACTOR's reasonable, prudent and diligent efforts tomitigate them.11.2.3 CONTRACTOR proposals and claim supporting data shall become due within 14 days ofreceipt of the unsigned Change Request or receipt by CITY of written notice of claim(unless ENGINEER allows an additional period), and shall remain firm for a period of notless than 60 days from receipt by ENGINEER of the proposal or supporting data. Anydelay in the submittal of a proposal or claim will not justify or constitute basis for anincrease in Contract Price or Contract Time. Proposals or claims shall be submitted onforms acceptable to CITY.11.2.4 Failure of CONTRACTOR to comply with the time requirements for written notice or forsubmittal of supporting data shall be considered a waiver by CONTRACTOR of any claimfor an addition to the Contract Price or an adjustment to the Contract Time andCONTRACTOR agrees that no additional compensation or time adjustments are due ifthe provisions of Article 10 and this Article are not complied with.11.2.5 Where the change in Contract Price arises from changes in the schedule of all or part ofthe Work, or where a change in Contract Time is sought, the proposal shall be based ona detailed analysis of the Progress Schedule, and shall cover all applicable elementsaffecting the Work involved, including, but not limited to, labor crews, craft levels,equipment utilization, work during other than normal working hours, productivity andproduction rates, shop drawing preparation, submittal and review, material andequipment delivery, and testing and start-up times.11.2.6 Proposals or claims shall cover all aspects of the Work involved, whether relating todeleted, added, revised, or impacted items of Work. Amounts for Subcontractors orSuppliers at any tier shall be equally supported.11.2.7 No proposal or claim for an adjustment in Contract Price or Contract Time shall be validunless submitted in accordance with Article 10 and this Article.Section 00700 00700- 42


11.3 Methods for Determining Adjustments in Contract Price11.3.1 The methods to be used to determine an adjustment in Contract Price necessitated bychanges ordered or negotiated pursuant to these General Conditions, or Work coveredby a proposal or a claim, collectively to be referred to as the "Work involved," are limitedto the following:11.3.2 Contract Unit Prices: Where the Work involved is covered or is of the same character asUnit Price Work, by application of those unit prices to the quantities of the items involved(subject to the provisions covering Unit Price Work). No additional allowances or chargesshall be added to these unit prices.11.3.3 Negotiated Unit Prices: Where the Work involved is not covered by unit prices containedin the Contract Documents, unit prices may be negotiated on the basis of costscalculated in accordance with this Article.11.3.4 Negotiated Lump Sum: By mutual acceptance of a lump sum price negotiated on thebasis of CONTRACTOR's itemized estimate of the anticipated Cost of the Work involved,determined as specified in this Article.11.3.5 Cost of the Work: Where CITY and CONTRACTOR cannot agree on any of the methodsdescribed in paragraphs 11.3.2, 11.3.3, or 11.3.4, CITY may direct CONTRACTOR toproceed with the Work involved on the basis of actual costs in accordance with thisArticle. When the cost of the Work basis is directed by CITY, CITY shall prescribe therequired procedures for accounting of the allowed costs. These procedures shall includedaily accounting of the material and equipment used and labor employed. Failure tosubmit this information for acknowledgment by the ENGINEER within one day after anypart of the Work is performed shall result in any discrepancy between ENGINEER'srecords and CONTRACTOR's records being resolved in favor of the ENGINEER'srecords.11.3.6 Estimated Adjustment: Where CITY and CONTRACTOR cannot agree on any of themethods described in paragraphs 11.3.2, 11.3.3, or 11.3.4, and the CITY does not wishto proceed on a Cost of the Work basis as described in paragraph 11.3.5, CITY with theadvice of ENGINEER shall determine a reasonable adjustment of the Contract Price forthe Work involved on the basis as described in Article 10 and this Article. Theadjustment in Contract Price and Contract Time will be issued by Change Request,incorporated into the Contract Documents by Change Order and CONTRACTOR shall bepaid on that basis. CITY's determination shall be final and binding unlessCONTRACTOR delivers to CITY written notice of a claim within seven (7) days of receiptof such determination.11.3.7 Where the Work involved is not covered by any of the preceding methods, and whenpayment is to be determined by a court of competent jurisdiction, it is agreed that the costof the WORK method shall be the appropriate method for determining the cost of theWork involved. Payroll, equipment, material and other costs will only be allowable whendetermined from daily time sheets which expressly correlate to the Work involved, wereprepared while work was in progress, clearly list actual units and usage, and weresubmitted to ENGINEER as the work was performed.11.3.8 Anticipated or actual costs computed for the Work involved means the sum of allincremental costs which would be, or actually were, necessarily incurred byCONTRACTOR in the proper performance of the Work. Those costs shall be in amountsno higher than those prevailing in the locality of the Project or as allowed elsewhere inthese Contract Documents, and shall include only the appropriate items for labor,material, equipment, and supplemental costs specified below.Section 00700 00700- 43


11.4 Determining Cost Adjustments to Changes in Contract Price11.4.1 CONTRACTOR shall provide to ENGINEER, if requested, proof of any burdens, includinginsurance costs, added to base wages to determine payroll costs described in this Article.11.4.2 Changes in the Contract Price made on the basis of the methods described in paragraph11.3 shall be based upon the following:11.4.2.1 Payroll costs for craft labor in the direct employ of CONTRACTOR assigned tothe site and engaged in furnishing and incorporating materials or equipment inthe Work involved. Payroll costs shall include wages plus the necessary laborburdens, which may include social security, unemployment, workerscompensation, health and retirement benefits, vacation and Holiday pay, andother payments pursuant to union agreements but shall exclude profit sharing,bonuses, and similar remunerations. Labor charges shall be allowed only forhourly labor directly involved in the Work. Such personnel may include workingforeman at the site. The cost of all salaried employees shall be considered as apart of allowances allowed in this Article. Labor rates shall be as actually paidbased on certified payroll records or in accordance with general rates for variouspay categories established by union agreements or by mutual agreementbetween CITY and CONTRACTOR prior to the commencement of the Work.The expenses of performing Work outside of normal working hours, on weekendsor Holidays, shall be included in the above to the extent authorized by CITY asset out in the Contract Documents.11.4.2.2 Payments by CONTRACTOR to Suppliers for all material and equipment in theWork involved, including transportation and storage costs, and necessarySuppliers field services. All cash deposits shall accrue to CITY, if CITYadvances funds to CONTRACTOR with which to make payments. All tradediscounts, rebates and refunds and all returns from sale of surplus items shallaccrue to CITY and CONTRACTOR shall make provisions so that they may beobtained.When required by CITY, CONTRACTOR shall obtain competitive bids fromSuppliers in order to achieve a reasonable price. When determining material andequipment costs, actual invoices segregating items associated with Workinvolved shall be the record upon which actual costs shall be based.11.4.2.3 Payments by CONTRACTOR to Subcontractors for Work involved performed bySubcontractors. When required by CITY, CONTRACTOR shall obtaincompetitive detailed bids from Subcontractors in order to achieve a reasonableprice.When determining Subcontractor costs at any tier, the Subcontractor's Cost shallbe determined in the same manner as CONTRACTOR's costs. All Subcontractsshall be subject to the provisions of this Article insofar as applicable.11.4.2.4 Costs of field supplies consumed in the performance of the Work involved, andpurchase costs of small tools used or consumed in the performance of the Workinvolved (and purchase cost less market value if used but not consumed) whichare individually valued at less than $1,000.00. Consumables shall include suchitems as rags, nails, fasteners, weld rod, gases, lubricants, paper, grout, stakes,power and fuel for tools and equipment, chains, cables, hoses, water, and similaritems normally used in the course of the Work. Costs of field supplies will beSection 00700 00700- 44


paid as a percentage of direct labor cost in an amount that shall not exceed theallowance shown in this Article.11.4.2.5 Equipment costs required solely in connection with the Work involved reflectingrented or leased or owned equipment cost for individual construction equipmentor machinery whose replacement value is in excess of $1,000.00. Transportation,loading and unloading, installation, dismantling and removal costs shall beincluded only if such equipment is or was transported to the site solely to performthe Work involved. All equipment costs shall cease when the equipment is nolonger necessary to perform the Work involved. Payroll costs for craft laboroperating the equipment shall be as in paragraph 11.4. Equipment costs shall becomputed using the same accounting and estimating rules regardless of whetherrelated to added or deleted items of Work.11.4.2.5.1 Rented or owned equipment at the site, and not in actual use, shall bepaid at the rates for rented equipment, or on the basis of fifty percent(50%) of the rates for owned equipment, respectively, as specifiedbelow. In no event shall the idle time claimed in a day exceed theestablished normal working hours. Payments for idle equipment shallcome due only as long as the equipment was idled solely by actions ofCITY, and provided that the idle period exceeds that normallyexperienced for such equipment.11.4.2.5.2 Except as provided below, for equipment rented or leased,CONTRACTOR shall be entitled to amounts based on negotiated rentalor lease rates, but in no event shall the amounts allowed exceed anhourly rate based on the monthly rates, listed in the most current andmost appropriate Rental Rate Blue Book (Blue Book) published byDataquest, Inc. for the area where the Project is located (presently 3volumes, relating to equipment of various ages) divided by 176 hours permonth. Rates for equipment not included in the Blue Book shall beinterpolated or extrapolated from the information contained therein. Inaddition to the rental or leasing rate, operating costs shall not exceed theestimated hourly operation rate in the Blue Book. For multiple shiftWork, the allowable equipment rate for second or third shifts shall notexceed fifty percent (50%) of the adjusted base rate.11.4.2.5.3 For equipment rented or leased from lessor firms associated with orowned by CONTRACTOR, CONTRACTOR shall be entitled toreimbursement as though the equipment was owned equipment, asspecified below.11.4.2.5.4 For equipment owned by CONTRACTOR, CONTRACTOR shall beentitled to costs based on billings established by his normal accountingpractices, but in no event shall those costs exceed the maximumallowable costs for rented or leased equipment.11.4.2.6 Costs of special consultants who are not employees in the direct employ ofCONTRACTOR or any of the Subcontractors or Suppliers, or specialSubcontractors; provided that those costs are or were authorized by CITY prior toproceeding with the Work involved, and only if their activities are not covered bycosts included under paragraph 11.4, or are not excluded by paragraph 11.9.11.4.2.7 Sales, consumer, or similar taxes related to the Work involved, and for whichCONTRACTOR is liable, royalty payments, and fees for permits and licenses,any of them related solely to the Work involved.Section 00700 00700- 45


11.4.2.8 Deposits to be lost for causes other than negligence of CONTRACTOR, anySubcontractor or anyone directly or indirectly to be employed by any of them orfor whose acts any of them may be liable, related solely to the Work involved.11.4.2.9 Increased costs of premiums for Bonds and Insurance resulting solely becauseof the Work involved.11.5 Costs Covered by CONTRACTOR's Allowances11.5.1 Except as otherwise specifically provided in paragraph 11.9, the cost of the Workinvolved shall not include any of the following costs, all of which are considered to becovered by CONTRACTOR's Allowances:11.5.2 Payroll costs and other compensation of personnel employed by CONTRACTOR whetherat the site or in CONTRACTOR's principal or a branch office for management oradministration of the Work, including, but not limited to, (a) CONTRACTOR's officers,executives, principals, general managers, project managers, construction managers,estimators, schedulers, detailers, claims consultants, attorneys, auditors, accountants,purchasing and contracting agents, expediters, and (b) resident superintendents,nonworking foremen, field engineers and architects, safety personnel, timekeepers, andclerks.11.5.3 Expenses of CONTRACTOR's principal, branch and site offices except as authorized inwriting by CITY prior to proceeding with the Work involved.11.5.4 Any part of CONTRACTOR's capital expenses, including interest on CONTRACTOR'scapital employed for the Work involved and charges for delinquent payments.11.5.5 Costs due to the fault or negligence of CONTRACTOR, any Subcontractor, or anyonedirectly or indirectly employed by any of them or for whose acts any of them may beliable, including but not limited to deposits to be lost, costs to correct defective Work,disposal of materials or equipment wrongly supplied and making good any damage toproperty.11.5.6 Market value of small tools used but not consumed which remain in the property ofCONTRACTOR.11.5.7 Costs associated with the preparation of Change Orders or Change Requests (whetheror not ultimately authorized by CITY), or the preparation or filing of claims.11.5.8 Expenses of CONTRACTOR associated with anticipated lost profits or lost revenues, lostincome or earnings, lost interest on earnings or unpaid retainage.11.5.9 Costs derived from the computation of a "home office overhead" rate by application of theEichleay, Allegheny, Burden Fluctuation, or other similar methods.11.5.10 Costs of special consultants or attorneys, whether or not in the direct employ ofCONTRACTOR, employed for services specifically related to the resolution of a claim,dispute, or other matter relating to the acceptability of the Work.11.5.11 Over administrative expense or contingent costs of any kind, and the costs of any itemnot specifically and expressly included in Article 11.Section 00700 00700- 46


11.6 CONTRACTOR Allowances for Changes to the WorkCONTRACTOR's allowances, which includes costs not directly chargeable under this Article,expenses itemized in paragraph 11.5, and profit shall not exceed the following percentages of thevarious portions of the Work involved. No other allowances in addition to these will be allowed.Cost ElementAllowance for Additions Allowances for DeductionsCONTRACTOR andSubcontractor labor per 11.4.2.1. 15% (15)%exclusive of the premium portionof craft laborCONTRACTOR andSubcontractor equipment andmaterials per 11.4.2.2. 15% (15)%Subcontractor costs resultingfrom direct Sub-agreement withCONTRACTOR per 11.4.2.3. 5% (5)%Allowance for small tools andconsumables per 11.4.2.4. (percentageof direct labor) 2% (2)%CONTRACTOR andSubcontractor owned or rentedequipment per 11.4.2.5. 15% (15)%CONTRACTOR and Subcontractorsupplemental costs per 11.4.2.9.premium portion of craft laborcosts; and other authorized costs. 0% (0)%11.7 Unit Price Work11.7.1 Where the Contract Documents provide for Unit Price Work, the Contract Price stated inthe Agreement will include for all Unit Price Work an amount equal to the sum of the unitprices for each item of Unit Price Work times the estimated quantity of each item asindicated in the Agreement.Each unit price will be deemed to include an amount considered by CONTRACTOR to beadequate to cover all costs, including supplemental and administrative costs, and profit.The estimated quantities of Unit Price Work indicated in the Agreement are given solelyfor the purpose of comparison of bids and determining the Contract Price for the Work asawarded.11.7.2 CONTRACTOR shall promptly, after becoming aware of, and before proceeding with anysignificant quantities of affected Work, notify CITY in writing of any additional or reducedquantities for an item of Unit Price Work which will require a twenty percent (20%) orhigher adjustment in the as-awarded quantity for that item or an increase in ContractPrice greater than 5%.11.7.3 CITY reserves the right to notify CONTRACTOR in writing of any variation in quantitiesmeeting the criteria established in this paragraph.Section 00700 00700- 47


11.7.4 Prior to Final Payment, or before the total amount paid exceeds the established ContractPrice, an appropriate Change Order will be issued on the recommendation ofENGINEER, to adjust the estimated quantities for Unit Price Work and to correspondinglyadjust the Contract Price.11.7.5 If CITY determines that the additional or reduced quantities for an item of Unit Price Workjustify an adjustment in the unit price, CITY shall authorize such an adjustment. Noadjustment shall be provided under this paragraph unless the variation between actualand estimated quantities for all Unit Price Work result in an increase or decrease inContract Price by more than ten percent (10%). If CITY determines that the unit pricesestablished in the Agreement are valid even for the additional or lower quantities, thatdecision shall be final and binding on CONTRACTOR unless CONTRACTOR delivers toCITY written notice of a claim within 7 days from receipt of such decision.11.7.6 In re-evaluating unit prices contained in the Contract Documents, CONTRACTOR andCITY shall take into account increases or decreases in CONTRACTOR's supplementaland administrative costs for the performance of the Work solely as a result of thevariation in quantities, as opposed to as a result of CONTRACTOR's fault or negligence,or bid estimate errors.11.8 Cash AllowancesIt is understood that when cash allowances are named in the Contract DocumentsCONTRACTOR has included in the Contract Price all allowances so named. CONTRACTORshall cause the Work so covered to be within the limit of the allowances set forth in the ContractDocuments. Upon Final Payment, the Contract Price shall be adjusted as required and anappropriate Change Order issued. CONTRACTOR agrees that the original Contract Priceincludes such sums as the CONTRACTOR deems proper for costs and profit on account of cashallowances. No demand for additional cost or profit in connection therewith will be valid.11.9 Criteria for Determining Adjustments in Contract Time11.9.1 The criteria to be used to determine an adjustment in Contract Time necessitated bychanges ordered or negotiated pursuant to these General Conditions, or Work coveredby a proposal or a claim, are limited to the following:11.9.2 An extension in Contract Time will not be granted unless CONTRACTOR candemonstrate through an analysis of the Progress Schedule that the increases in the timeto perform or complete the Work, or specified part of the Work, beyond the correspondingContract Time(s) arise from unforeseeable causes beyond the control and without thefault or negligence of both CONTRACTOR and his Subcontractors, Suppliers or otherpersons or organizations, and that such causes in fact lead to performance or completionof the Work, or specified part in question, beyond the corresponding Contract Time. Anadjustment in Contract Time will be based solely upon net increases in the time requiredfor the performance or completion of parts of the Work controlling achievement of thecorresponding Contract Time(s) at the time that the incident which causes the changeoccurs. However, even if the time required for the performance or completion ofcontrolling parts of the Work is extended, an extension in Contract Time will not begranted until performance or completion of the controlling Work necessarily extendsbeyond the Contract Time in question despite CONTRACTOR's reasonable and diligentactions to guard against those effects.Examples of unforeseeable causes include: (1) acts of God or of the public enemy; (2)acts of CITY or ENGINEER in its sovereign or contractual capacity; (3) acts of theGovernment or another Public Entity in its sovereign capacity; (4) acts of anothercontractor in the performance of a contract with the CITY or COUNTY, if not identified inSection 00700 00700- 48


the Contract; (5) fires, floods, epidemics, quarantine restrictions; (6) sink holes,archaeological finds; (7) strikes, freight embargoes; (8) unfavorable weather defined in11.11; (9) a case of differing physical conditions; (10) a case of existing UndergroundFacilities owned by others.11.9.3 Notwithstanding any provisions in the Contract Documents to the contrary, an extensionof Contract Time shall be the sole remedy of CONTRACTOR for any delay of any kind.The only exception, under which an adjustment in Contract Price shall be allowed, shallbe if the delay has been caused solely by acts constituting intentional interference byCITY or ENGINEER with CONTRACTOR's performance of the Work and such actscontinue after CONTRACTOR's notice to ENGINEER of such interference. Intentionalinterference is an act or omission by the CITY or ENGINEER by which the CITY orENGINEER intentionally, willfully, or knowingly delays job progress. The CITY's exerciseof any of its rights under Article 10 and this Article regardless of the extent or number ofthe changes, or the CITY's exercise of its remedies of stopping the Work or requiringcorrection or re-execution of any defective work shall not under any circumstances beconstrued as intentional interference with the CONTRACTOR's performance of the Work.No adjustment in Contract Price under this paragraph shall be provided for any reason if:(1) performance would have been so extended by any one other cause, including fault ornegligence of CONTRACTOR, or his Subcontractors, Suppliers, or other persons ororganizations or; (2) an adjustment is provided or excluded under any other provision ofthe Contract Documents or; (3) delays merely prevent CONTRACTOR's achievement ofcompletion of the Work, or part in question, ahead of the corresponding Contract Time(s),including any authorized adjustments.11.9.4 An adjustment in Contract Price, to complement an extension in Contract Time, onaccount of delays meeting the requirement for an adjustment in Contract Price underparagraph 11.9.3 shall be determined as follows subject to all applicable requirements ofparagraph 11.9. Amounts shall only be allowed to the extent they were increased ordecreased on account of such delays, and shall include only the appropriate amounts forCONTRACTOR and Subcontractors: labor, material and equipment costs, constructionequipment costs, supplemental costs, and in accordance with paragraph 11.4, payrollcosts, and travel and subsistence expenses, for the superintendent and other personnelclassifications agreed by CITY, which shall not include any of the personnel listed inparagraph 11.9.2 (a), in the direct employ of CONTRACTOR and Subcontractors at thesite; rental/lease costs of site office and temporary facilities, and costs of utilities,telephone service and sanitary facilities expended to maintain such facilities, and anallowance of 15% of the total of these costs for any other costs not directly chargeable(including overhead expense) and profit.11.10 WaiversCONTRACTOR's recovery (1) of acceleration costs incurred as an alternative to an extension inContract Time on account of delays not meeting the requirements for extensions in Contract Timeor an adjustment in Contract Price; (2) of escalation costs for any part of the Work; (3) of delaycosts, except as otherwise specifically provided in this Article, shall be excluded.11.11 Unfavorable WeatherThe Contractor shall become familiar with and prepare for the normal weather conditions existingin Osceola County, Florida. Normal weather conditions are expected to impact the Work innumerous ways including but not limited to delays during and after periods of rainfall, temporaryflooding and ponding, we ground, high winds and debris. The Contractor acknowledges that itsBid Proposal and subsequent schedule anticipates and includes as a minimum the normallyanticipated number of unfavorable weather days historically anticipated in Osceola County for theSection 00700 00700- 49


period of time covered by this Agreement. The consequences and impact of such unfavorableweather conditions are neither excusable nor compensable.The Contractor acknowledges that the following conditions must all exist before unfavorableweather conditions may be found to exist:(1) Unfavorable weather conditions actually existed at the Project Site for one ormore work days in excess of the number of work days historically anticipated.ARTICLE 12 - SCHEDULES12.1 Progress and Submittal Schedules12.1.1 Types of Schedules12.1.1.1 CONTRACTOR shall prepare and submit to ENGINEER for review, a ProgressSchedule in accordance with Section 01310.12.1.1.2 CONTRACTOR shall prepare and submit to ENGINEER for review, a scheduleof Shop Drawing and sample submissions. This schedule shall consist of a list ofthe submittals to be made over the course of the project; anticipated and actualdates of submittal and return for both initial and resubmissions; and theanticipated dates of submittal approval so as not to delay the Project. Theschedule shall allow for review and processing time by DESIGN ENGINEER andENGINEER.12.1.1.3 CONTRACTOR shall prepare and submit to ENGINEER for review with theProject Schedule, manpower charts and cash flow projections contemplated orrequired by the schedule in a form acceptable to ENGINEER. Updated plan andactual expended manpower charts and cash flow projections shall be submittedwith each monthly or interim schedule submission when requested byENGINEER.12.1.2. Submittal12.1.3. Review12.1.2.1 CONTRACTOR shall enter on the Progress Schedules the actual progress on amonthly basis, or at such intervals as requested by ENGINEER, and shall deliverto ENGINEER five (5) copies of the schedule documentation.12.1.2.2 Progress Schedules are to be submitted with each Application for Payment. AnApplication for Payment shall not be paid until the schedule submittal and anyrequested corrections or clarifications have been accepted by ENGINEER forinclusion into the Application for Payment. If additional updated schedules arerequested by ENGINEER they are to be provided within seven days of the dateof request, but do not constitute permission to submit additional Applications forPayment.12.1.3.1 ENGINEER shall review schedule submittals. If, in the opinion of ENGINEER,the schedule (1) does not accurately reflect CONTRACTOR's actual progress orwork plan or, (2) is unreasonable or cannot be used to effectively evaluateCONTRACTOR's progress or, (3) is not in compliance with this Article and otherappropriate sections of the Contract, it will be returned to CONTRACTOR forcorrections or clarification.Section 00700 00700- 50


CONTRACTOR shall make the necessary corrections and resubmit or shallrespond in detail to ENGINEER's comments and request that the submittal beaccepted without modification. Failure by CONTRACTOR to provide correctionsor clarifications to schedule submittals as directed by ENGINEER shall constitutereason to withhold approval of any Application for Payment.12.1.3.2 ENGINEER's review of schedule submittals shall not relieve CONTRACTORfrom responsibility for any variation from the requirements of the ContractDocuments unless CONTRACTOR has, in writing, called CITY's attention toeach such variation at the time of submission and CITY has given writtenapproval of each such variation; nor shall any approval by CITY or ENGINEERrelieve CONTRACTOR from responsibility for compliance with any provision ofthe Contract Document.12.1.4. Time of PerformanceThe Contract Time establishes the period and duration in which CITY expects the Work to beperformed. Any schedule which shows completion ahead of the Contract Time shall includeadditional supporting data to explain the basis of the shorter time for performance. ENGINEERshall review the supporting data, and make recommendations to CITY as to the acceptability ofthe shorter schedule. CITY may (1) notify CONTRACTOR that the Contract Time is beingadjusted by Change Order to reflect the shorter schedule duration or (2) elect not to adjust thepresent Contract Time and allow the use by all parties of the increased schedule flexibility that theshorter schedule represents. In any case CITY shall not be responsible for any costs, actual oranticipated, resulting from any delay to CONTRACTOR that prevents completion of any part or allof the Work unless it prevents completion by the Contract Time(s); nor shall the CITY beobligated to incur any additional costs for administration or inspection of accelerated Work.12.1.5. ChangesIt is understood that revisions in the schedule are inherent in the nature of construction. This mayrequire that changes be made in the schedule to reflect the dynamic nature of the design and theWork.Actions by CITY, CONTRACTOR, ENGINEER or DESIGN ENGINEER that may affect theprogress of any part or all of the Work shall make use of the flexibility in the Progress Schedule,often expressed as schedule float or slack time, and that which may result from changes in thesequencing of individual work items, to limit the impact of such actions. The concept of sharedschedule flexibility shall not be limited by the inclusion of restraints, logic or imposed dates intothe schedule that cannot be reasonably justified.Excessive use of schedule flexibility by any party is contrary to this sharing concept and may because for denial of a request for an extension in Contract Time or, in the case of excessive use bythe CITY, ENGINEER or DESIGN ENGINEER, may be cause for an extension in Contract Time ifso allowed by Article 11.12.1.6. As-Built ScheduleAfter Substantial Completion, but prior to Final Payment, CONTRACTOR shall submit an as-builtschedule. The schedule shall reflect (1) all as-built critical paths, (2) all contract activities,including all added activities, with their actual start and finish dates, (3) the actual number ofseparate work days during which work was performed on each activity, and (4) the actual numberof man-days that were required to complete each activity.Section 00700 00700- 51


ARTICLE 13 - WARRANTY AND GUARANTEE, TESTS AND INSPECTIONS, CORRECTION,REMOVAL OR ACCEPTANCE OF DEFECTIVE WORK13.1 Warranty and GuaranteeCONTRACTOR warrants and guarantees that all Work will be in accordance with the ContractDocuments and will not be defective. All defective Work, whether or not in place, may berejected, corrected or accepted as provided in this Article. The obligations of CONTRACTORunder this paragraph shall be in addition to and not in limitation of any obligation imposed uponhim by special guarantees required by the Contract Documents or otherwise prescribed by Lawsor Regulations.13.2 Access to WorkCITY, ENGINEER, DESIGN ENGINEER, their representatives, testing agencies andgovernmental entities with jurisdiction shall be permitted access to the Work for their observation,inspection and testing. CONTRACTOR shall provide proper and safe conditions for such access.13.3 Tests and Inspections13.3.1 CONTRACTOR shall give ENGINEER timely notice of readiness of the Work for allrequired inspections, tests or approvals. Inspections, tests or observations byENGINEER, DESIGN ENGINEER, CITY or their agents may be performed at theirdiscretion to provide information to the CITY on the progress of the Work. However, suchinformation is not intended to fulfill the CONTRACTOR's obligations in accordance withthe Contract Documents.13.3.2 If any law, ordinance, rule, regulation, code or order of any public body, governmententity or court having jurisdiction requires any Work (or part thereof) to specifically beinspected, tested or approved, CONTRACTOR shall assume full responsibility therefor,pay all related costs, schedule related activities at appropriate times, and furnishENGINEER the required certificates of inspection, testing or approval. CONTRACTORshall also be responsible for and shall pay all costs, in connection with any inspection ortesting required in connection with CITY's or ENGINEER's acceptance of a proposedmanufacturer, fabricator, supplier or distributor of materials or equipment proposed to beincorporated in the Work, or of material or equipment submitted for approval prior toCONTRACTOR's purchase thereof for incorporation of the Work. All inspections, tests orapprovals shall be performed by persons or organizations acceptable to CITY andENGINEER.13.3.3 The CONTRACTOR shall perform sufficient testing and inspection of the Work to supportthe Warranty and Guaranty requirements.13.3.4 Neither observations by ENGINEER or CITY nor inspections, tests or approvals by othersshall relieve CONTRACTOR from his obligations to perform the Work in accordance withthe Contract Documents.13.3.5 If any testing, inspection or approval under this paragraph reveal defective Work,CONTRACTOR shall not be allowed to receive any associated costs and CITY shall beentitled to deduct from the Contract Price, by issuing a Change Order, CITY's costsarising out of the defective Work, including costs of repeated procedures, compensationfor ENGINEER's and DESIGN ENGINEER's services and other related costs.Section 00700 00700- 52


13.4 Uncovering Work13.4.1 If any Work that is to be inspected, tested or approved is covered without writtenconcurrence of ENGINEER, it must, if requested by ENGINEER, be uncovered forobservation. Such uncovering shall be at CONTRACTOR's expense and will exclude theright to an increase in the Contract Price or Contract Time unless CONTRACTOR hasgiven ENGINEER timely written notice of CONTRACTOR's intention to cover such Workand ENGINEER has not acted with reasonable promptness in response to such notice.13.4.2 If ENGINEER considers it necessary or advisable that covered Work be observed byENGINEER or inspected or tested by others, CONTRACTOR, at ENGINEER's request,shall uncover, expose or otherwise make available for observation, inspection or testingas ENGINEER may require, that portion of the Work in question, furnishing all necessarylabor, material and equipment. If it is found that such Work is defective, CONTRACTORshall bear all the expenses of such uncovering, exposure, observation, inspection andtesting and of satisfactory reconstruction, including compensation for additionalprofessional services, any additional expenses experienced by the CITY due to delays toothers performing additional work, other contractual obligations, and attorneys' fees andCITY shall be entitled to issue an appropriate deductive Change Order. CONTRACTORshall further bear the responsibility for maintaining the schedule and will not be allowedan increase in Contract Price or Contract Time due to the uncovering. If, however, suchWork is not found to be defective, and paragraph 13.4.1 is not applicable,CONTRACTOR shall be allowed an increase in the Contract Price or the Contract Time,or both, directly attributable to such uncovering, exposure, observation, inspection,testing and reconstruction if it makes a claim therefor as provided in Article 10.13.5 Correction or Removal of Defective WorkCONTRACTOR shall promptly, without cost to CITY and as specified by ENGINEER, eithercorrect any defective Work, whether or not fabricated, installed or completed, or, if the Work hasbeen rejected by ENGINEER, remove it from the site and replace it with conforming Work. TheCONTRACTOR shall bear the cost of repairing or replacing all Work and property of the CITY orothers destroyed or damaged or in any way impacted by such correction or removal.13.6 Acceptance of Defective WorkIf, instead of requiring correction or removal and replacement of defective Work, CITY prefers toaccept it, CITY may do so. In such case, if acceptance occurs prior to Final Payment, CITY shallbe entitled to issue a Change Order incorporating the necessary revisions in the ContractDocuments, including appropriate reduction in the Contract Price. If the acceptance occurs aftersuch Final Payment, an appropriate amount shall be paid by CONTRACTOR to CITY.13.7 CITY May Correct defective WorkIf CONTRACTOR fails within a reasonable time after written notice of ENGINEER to proceed tocorrect and to correct defective Work or to remove and replace rejected Work as required byENGINEER in accordance with this Article, or if CONTRACTOR fails to perform the Work inaccordance with the Contract Documents (including any requirements of the Progress Schedule),CITY may, after seven days written notice to CONTRACTOR, correct and remedy any suchdeficiency. In exercising its rights under this paragraph CITY shall proceed with reasonablepromptness. To the extent necessary to complete corrective and remedial action, CITY mayexclude CONTRACTOR from all or part of the site, take possession of all or part of the Work, andsuspend CONTRACTOR's services related thereto, take possession of CONTRACTOR's tools,appliances, construction equipment and machinery at the site and incorporate in the Work allmaterials and equipment stored at the site or for which CITY has paid CONTRACTOR but whichare stored elsewhere. CONTRACTOR shall allow CITY, CITY's representatives, agents andemployees such access to the site as may be necessary to enable CITY to exercise its rightsSection 00700 00700- 53


under this paragraph. All direct and indirect costs of CITY in exercising such rights shall becharged against CONTRACTOR in an amount documented by CITY, and CITY will be entitled toissue a Change Order incorporating the necessary revisions in the Contract Documents and areduction in the Contract Price.Such direct and indirect costs shall include, in particular but without limitation, all corrective orreplacement costs, compensation for additional professional services required and all costs ofrepair and replacement of property of others destroyed, impacted or damaged by correction,removal or replacement of CONTRACTOR's defective Work. CONTRACTOR shall not beallowed an increase in the Contract Price or the Contract Time because of any delay in theperformance of the Work attributable to the exercise by CITY of CITY's rights hereunder.13.8 Warranty Period13.8.1 The Warranty Period shall commence on the date of Substantial Completion of the entireWork, or a later date if so specified in the Contract Documents , and extend untilexpiration period may be prescribed by Laws or Regulations or by the terms of anyapplicable special guarantee or specific provision of the Contract Documents.13.8.2 If within the designated Warranty Period, the Work, or any part of the Work, is discoveredto be defective, CONTRACTOR shall promptly, without an adjustment in Contract Priceand in accordance with CITY's or ENGINEER's written instructions, either correct thatdefective Work, or if it has been rejected by CITY or ENGINEER, remove it from the siteand replace it with non-defective Work. If circumstances warrant it, including, but notlimited to, in an emergency, CITY may have the defective Work corrected or the rejectedWork removed and replaced. In that event, CONTRACTOR shall not be allowed torecover any associated costs, and he shall reimburse CITY for all direct, indirect andconsequential costs of CITY, or CITY shall be entitled to issue a Change Order toincorporate an appropriate decrease in Contract Price if prior to Final Payment. CITYshall reserve and retain all of its rights and remedies at law and equity againstCONTRACTOR and its Surety for damages and for corrections of any and all latentdefects.13.9 Extended Warranties and Guarantees13.9.1 CITY may at its sole discretion advance or defer the date of commencement of theWarranty Period, in which case CONTRACTOR shall maintain the warranties andguarantees in full force and effect until the revised date for commencement of theWarranty Period. If such advancement or deferral in the date for commencement of theWarranty Period causes an increase or decrease in the cost of the warranties andguarantees provided by CONTRACTOR, CITY shall make an adjustment in ContractPrice or Contract Time, as provided in Articles 10 and 11.13.9.2 In circumstances where CITY undertakes Partial Utilization of a portion of the Work whichwas specifically identified in the Contract Documents, CONTRACTOR shall maintain thewarranties and guarantees in full force and effect during the period between theapplicable commencement of Partial Utilization date, and the date of commencement ofthe Warranty Period, and for such warranties and guarantees CONTRACTOR shallreceive no adjustment in Contract Price.13.9.3 In special circumstances where CONTRACTOR fails to complete the Work, or aseparable portion of the Work within the corresponding Contract Time, including anyauthorized adjustments, and CITY undertakes Partial Utilization, CONTRACTOR shallmaintain the warranties and guarantees in full force and effect during the period betweenthe applicable commencement of Partial Utilization date, and the date of commencementSection 00700 00700- 54


of the Warranty Period, and for such warranties and guarantees CONTRACTOR shallreceive no adjustment in Contract Price.13.10 Special Maintenance RequirementsIn special circumstances where the Work, or a designated part, reaches Substantial Completion,but as provided in the Contract Documents, is not placed in continuous service until thecommencement of the Warranty Period, CONTRACTOR shall maintain the Work, or designatedpart, in good order and in proper working condition, provide suitable drainage, and take all otheractions as are necessary for its protection during the period between the applicable SubstantialCompletion date and the date of commencement of the Warranty Period, and for suchmaintenance CONTRACTOR shall receive no adjustment in Contract Price. In the event thatWork suffers loss or damage, however caused, CONTRACTOR shall rebuild, repair, restore, andmake good without an increase in Contract Price all losses or damages to any portion of anyWork and shall without an increase in Contract Price provide suitable drainage and erect suchtemporary structures and take all other actions as are necessary for its protection. Suspension ofWork or the granting of an extension in Contract Time for any cause shall not relieveCONTRACTOR of his responsibility for the Work, or designated part, as specified in thisparagraph.13.11 Extended Warranty Period Due to Defective WorkAny defective Work that is either corrected or rejected and replaced will be warranted andguaranteed for a period of one (1) year from the date of such correction or removal andreplacement, even if it had previously been corrected or replaced, in accordance with theprovisions of this Article 13. If within such extended Warranty Period, that Work is once againfound to be defective, CITY shall be entitled to all of CITY's rights and remedies under this Article.ARTICLE 14 - PAYMENTS TO CONTRACTOR AND COMPLETION14.1 SchedulesAt least ten days prior to submitting the first Application for Payment, CONTRACTOR shall(except as otherwise specified in the General Requirements) submit to ENGINEER acceptableProgress and Shop Drawing Submittal Schedules, acceptable manpower and cash flowprojections, and a final schedule of values of the Work. These schedules shall be satisfactory intype, form and substance to ENGINEER. ENGINEER may require the schedule of values to beadjusted if in its opinion the breakdown does not accurately reflect the true distribution of theContract Price. Upon written approval of the schedule of values by ENGINEER, it shall beincorporated into a form of Application for Payment acceptable to CITY. After the first Applicationfor Payment, Contractor shall submit a revised, updated Progress Schedule, satisfactory in type,form and substance to the ENGINEER with each subsequent Application for Payment. TheContractor will not be entitled to receive a Progress Payment until the revised Progress Scheduleis approved by the ENGINEER.14.2 Application for PaymentCONTRACTOR shall submit to ENGINEER not later than the first working day of each month anApplication for Payment completed and signed by CONTRACTOR covering the Work completedduring the previous month and accompanied by such supporting documentation as is required bythe Contract Documents and also as ENGINEER may reasonably require. On each Applicationfor Payment, CONTRACTOR shall (1) list the name and address of each of its Subcontractorsand Suppliers who have performed Work or provided supplies or material during the time periodof Work reflected by the Application and(2) submit certified payroll sheets for his own forces andall Subcontractors for the month preceding this application. After the first Application for Payment,CONTRACTOR shall include an affidavit stating that all previous progress payments received onSection 00700 00700- 55


account of the Work have been applied (1) to discharge CONTRACTOR's obligations and (2) topay in full (less retainage) all amounts owed to its Subcontractors and Suppliers reflected in priorApplications for Payment. CONTRACTOR shall on the Application for Payment form note andexplain when it has not discharged its obligations or paid in full (less retainage) all amounts owedas stated above. Neither CITY or ENGINEER is under any duty or obligation whatsoever to anySubcontractor, Supplier, laborer or any other party to ensure that payments due and owing byCONTRACTOR to any of them are or will be made.14.3 Materials on Site14.3.1 CITY may, at its sole option, pay an amount equal to ninety percent (90%) of the value ofmaterials and equipment not incorporated into the Work but delivered and suitably stored,less in each case the aggregate of payments previously made. In no event shallpayments for materials and equipment stored on site exceed ninety percent (90%) of thevalue of the related cost for the specific item of work shown in the schedule of valuesregardless of the stated value of the material or equipment. CITY may, at its sole option,pay an amount equal to ninety percent (90%) of the value of materials and equipment notincorporated into the Work and stored off site if stored in a manner acceptable to CITY,as stated above for on-site stored materials. When payment to CONTRACTOR is madefor stored material and equipment, CONTRACTOR shall submit invoices marked paid bythe Supplier with the Application for Payment following payment to CONTRACTORdocumenting that CONTRACTOR has paid for said materials and equipment or thepreviously paid amount shall be deducted from remaining payments or retainage forstored materials and equipment not so properly documented.14.3.2 If payment is requested on the basis of materials and equipment not incorporated into theWork but delivered and suitably stored at the site or at another location agreed to inwriting, the Application for Payment shall be accompanied by such data, satisfactory toCITY, as will establish CITY's title to the material and equipment and protect CITY'sinterest therein, including applicable insurance. In no event shall the quantity of materialand equipment submitted for payment be in excess of the actual final installed quantity.CITY may deduct from the final Application for Payment amounts paid CONTRACTORfor material and equipment not finally installed in the Work.14.4 CONTRACTOR's Warranty of TitleThe CONTRACTOR warrants and guarantees that title to all Work, materials and equipmentcovered by any Application for Payment, whether incorporated in the Project or not, will pass toCITY at the time of payment free and clear of all liens, claims, security interests andencumbrances (hereafter referred to as "Liens").14.5 Review and Payment14.5.1 ENGINEER will, within twenty days after receipt of each Application for Payment, eitherindicate in writing a recommendation of payment and present the Application to CITY, orreturn the Application to CONTRACTOR indicating in writing ENGINEER's reasons forrefusing to recommend payment. In the latter case, CONTRACTOR may make thenecessary corrections and resubmit the Application.CITY shall, within twenty days of presentation to it of the Application for Payment byENGINEER, giving consideration to ENGINEER's recommendation, but not being boundthereby, pay CONTRACTOR the amount to which he is entitled.14.5.2 ENGINEER's recommendation of any payment requested in an Application for Paymentwill constitute a representation by ENGINEER to CITY, based on on-site observations ofthe Work in progress and on ENGINEER's review of the Application for Payment and theSection 00700 00700- 56


accompanying data and schedules, that the Work has progressed to the point indicated;that to the best of ENGINEER's knowledge, information and belief, the quality of theWork is in accordance with the Contract Documents (subject to an evaluation of the Workas a functioning Project prior to or upon Substantial Completion; to the results of anysubsequent tests called for in the Contract Documents; or to any qualifications stated inthe recommendation) and that CONTRACTOR is entitled to payment of the amountrecommended. However, by recommending any such payment, ENGINEER will notthereby be deemed to have represented that any examination has been made toascertain how or for what purpose CONTRACTOR has used the monies paid or to bepaid to CONTRACTOR on account of the Contract Price, or that title to any Work,materials or equipment has passed to CITY free and clear of any lien.14.5.3 ENGINEER may refuse to recommend the whole or any part of any payment if, in itsopinion, it would be incorrect to make such representations to CITY. ENGINEER mayalso refuse to recommend any such payment, or, because of subsequently discoveredevidence or the results of subsequent inspections or tests, nullify any such paymentpreviously recommended to such extent as may be necessary in ENGINEER's opinion toprotect CITY from loss or anticipated loss because: (1) the Work is defective, orcompleted Work has been damaged requiring correction or replacement or, (2) writtenclaims have been made against CITY or Liens have been filed in connection with theWork or, (3) the Contract Price has been reduced because of Change Order or, (4) CITYhas been required to correct defective Work or complete the Work or, (5) ofCONTRACTOR's unsatisfactory prosecution of the Work in accordance with the ContractDocuments or, (6) of CONTRACTOR's failure to make payment to Subcontractors,Suppliers or for labor, or (7) of CONTRACTOR's failure to provide acceptable schedulesubmittals for inclusion into the Application for Payment or, (8) of CONTRACTOR's failureto properly maintain and submit with Application for Payment Record Documents.14.6 Retainage14.6.1 The value of each Application for Payment shall be equal to the total value of the workperformed to date, less an amount retained, and less payments previously made andamounts withheld in accordance with this Article.14.6.2 Payments will be made in an amount equal to ninety percent (90%) of the Workcompleted. Upon Substantial Completion of all of the Work, CITY may, at it sole option,pay an amount sufficient to increase total payments to CONTRACTOR to ninety-fivepercent (95%) of the value of the completed work.14.7 OverpaymentAny overpayment by CITY to CONTRACTOR shall be promptly repaid to CITY upon demand.14.8 Final Application for Payment14.8.1 After CONTRACTOR has completed all corrections to the satisfaction of CITY andENGINEER as verified by Final Inspection and delivered all maintenance and operatinginstructions, schedules, guarantees, warranties, Bonds, certificates of inspection,marked-up record documents and other documents, all as required by the ContractDocuments and acceptable to CITY, and after ENGINEER has indicated that Work isacceptable, CONTRACTOR may make application for Final Payment following theprocedure for Applications for Payment.14.8.2 The final Application for Payment shall be accompanied by all documentation Called forin the Contract Documents and such other data and schedules as ENGINEER mayreasonably require, together with complete and legally effective releases or waiverSection 00700 00700- 57


(satisfactory to CITY) of all Liens and claims arising out of or filed in connection with theWork. In lieu thereof and as approved by CITY, CONTRACTOR may furnish receipts orreleases in full with an affidavit of CONTRACTOR that the releases and receipts includeall labor, services, material and equipment for which a Lien or claim could be filed, andthat all payrolls, material and equipment bills and other indebtedness in connection withthe Work for which CITY might in any way be responsible, have been paid or otherwisesatisfied. CITY shall require consent of the Surety to Final Payment.14.9 Final Payment and Acceptance14.9.1 If, on the basis of ENGINEER's observations of the Work during construction and FinalInspection, and ENGINEER's review of the final Application for Payment andaccompanying documentation all as required by the Contract Documents, ENGINEER issatisfied that the Work has been completed and CONTRACTOR has fulfilled all of itsobligations under the Contract Documents, ENGINEER will, within twenty days afterreceipt of the final Application for Payment, indicate in writing its recommendation ofpayment and present the Application to CITY for payment. Thereupon ENGINEER willgive written notice to CITY and CONTRACTOR that the Work is acceptable.Otherwise, ENGINEER will return the Application to CONTRACTOR, indicating in writingthe reasons for refusing to recommend Final Payment, in which case CONTRACTORshall make the necessary corrections and resubmit the Application. If the Application andaccompanying documentation are appropriate as to form and substance, CITY shall,within twenty days after receipt from ENGINEER, pay CONTRACTOR the amount duegiving consideration to the recommendations of ENGINEER, but not being boundthereby.14.9.2 After receipt of the ENGINEER's written notice that the Work is acceptable and prior toFinal Payment, CONTRACTOR shall submit an affidavit, in a form acceptable to CITY,certifying that the Bonds and insurances required under Article 5 are in effect and will notbe allowed to expire for the required period of time.14.10 Waiver of Claims14.10.1 The making and acceptance of Final Payment shall constitute:14.10.2 A waiver of all claims by CITY against CONTRACTOR, except claims arising fromunsettled Liens, from defective Work appearing after final inspection, from fraud orgross negligence amounting to fraud, or from failure to comply with the ContractDocuments or the terms of any special guarantees specified therein or the terms of anyBonds; however, it shall not constitute a waiver by CITY of any rights in respect ofCONTRACTOR's continuing obligations under the Contract Documents; and14.10.3 A waiver of all claims by CONTRACTOR against CITY, ENGINEER, and DESIGNENGINEER other than those enumerated in the Final Application for Payment.14.11 CITY's Obligations14.11.1 In no event shall any interest be due and payable to CONTRACTOR on any of thesums retained by CITY pursuant to any of the terms or provisions of any of the ContractDocuments.14.11.2 Any provision to the contrary notwithstanding, CITY shall not be obligated to make anypayment to CONTRACTOR and may withhold partial payments if any one or more ofthe following conditions exists: (1) CITY has reason to believe CONTRACTOR is indefault of any of its obligations or otherwise is in default under any of the ContractSection 00700 00700- 58


14.12 Partial UtilizationDocuments; (2) Any part of such payment is attributable to Work which is defective,provided, however, payment shall be made for Work which is performed in accordancewith the Contract Documents and is not defective; (3) CONTRACTOR has failed tomake payments promptly to Subcontractors and Suppliers or for labor and material forwhich CITY has made payment to CONTRACTOR; (4) If CITY, in its good faithjudgment, determines that the portion of the Contract Price remaining unpaid will not besufficient to complete the Work in accordance with the Contract Documents; (5)CONTRACTOR has failed to maintain progress of the Work in accordance with theProgress Schedule or CONTRACTOR has failed to meet an interim completion date orthe Substantial or Final Completion Date.14.12.1 Use by CITY of completed portions of the Work may be accomplished at the option ofCITY prior to Substantial Completion of all the Work subject to the following:4.12.1.1 CITY at any time may request CONTRACTOR in writing to permit CITYto use any part of the Work which CITY believes to be substantiallycomplete and which may be so used without significant interference withconstruction of the other parts of the Work. If CONTRACTOR agrees,CONTRACTOR shall certify to CITY that said part of the Work issubstantially complete and request ENGINEER to issue a certificate ofSubstantial Completion for that part of the Work. CONTRACTOR at anytime may notify CITY and ENGINEER in writing when CONTRACTORconsiders that a portion of the Work which has been identified in theContract Documents as eligible for Partial Utilization is substantiallycomplete. Within a reasonable time thereafter, CITY, CONTRACTOR,and ENGINEER shall make an inspection of that part of the Work todetermine its status of completion. If ENGINEER does not consider thatpart of the Work to be substantially complete, ENGINEER will notifyCONTRACTOR in writing giving the reasons therefor. If ENGINEERconsiders that part of the Work to be substantially complete, ENGINEERwill execute and deliver to CITY and CONTRACTOR a certificate to thateffect, fixing the date of Substantial Completion as to that part of theWork, and attaching a list of minor items as to that part of the Work to becompleted or corrected before Final Payment.14.12.1.2 Prior to issuing a certificate of Substantial Completion as to part of theWork, ENGINEER will deliver to CITY and CONTRACTOR a writtenrecommendation as to the division of responsibilities pending FinalPayment between CITY and CONTRACTOR with respect to security,operation, safety, maintenance, utilities, insurance and the WarrantyPeriod for that part of the Work. CITY shall have the right to excludeCONTRACTOR from any part of the Work which ENGINEER has socertified to be substantially complete, but CITY shall allowCONTRACTOR reasonable access to complete or correct itemsdescribed above.14.12.1.3 In lieu of the issuance of a certificate of Substantial Completion as to partof the Work, CITY may take over operation of a facility constituting partof the Work whether or not it is substantially complete if such facility isfunctionally and separately useable; provided that prior to any suchtakeover, CITY and CONTRACTOR have agreed in writing as to thedivision of responsibilities between CITY and CONTRACTOR forsecurity, operations, safety, maintenance, Warranty Period, utilities andinsurance with respect to such facility. During such utilization and prior toSection 00700 00700- 59


14.13 Substantial CompletionSubstantial Completion of that portion of the Work, CITY shall allowCONTRACTOR reasonable access to complete or correct items and tocomplete other related Work.14.13.1 When CONTRACTOR considers the entire Work to have progressed to the point where itis substantially complete, CONTRACTOR shall, in writing to ENGINEER, certify thatthe entire Work is substantially complete, submit to ENGINEER all operation andmaintenance manuals and instructions and spare parts required by the ContractDocuments, and request that ENGINEER issue a Certificate of Substantial Completion.Within a reasonable time thereafter, CITY, CONTRACTOR and ENGINEER shall makean inspection of the Work to determine the status of completion. If ENGINEER doesnot consider the Work substantially complete, ENGINEER will notify CONTRACTOR inwriting giving the reasons therefor. CONTRACTOR shall then accomplish the requisiteWork and then recertify that the entire Work is substantially complete. If ENGINEERconsiders the Work substantially complete, ENGINEER will prepare and deliver toCONTRACTOR and CITY a Certificate of Substantial Completion which shall fix thedate of Substantial Completion. There shall be attached to the certificate a list of items(which should be minor in scope and nature) to be completed or corrected before FinalPayment. CONTRACTOR shall continue to be responsible for maintaining the Workuntil the date of certification of Substantial Completion, or longer if so required by theContract Documents.14.13.2 CITY shall have the right to exclude CONTRACTOR from the Work, or specified part,after the date of Substantial Completion, but CITY shall allow CONTRACTORreasonable access to complete or correct items on the list attached to the Certificate ofSubstantial Completion.14.14 Final InspectionUpon written notice from CONTRACTOR that the minor items described in the list attached to theCertificate of Substantial Completion have been completed, ENGINEER will make an inspectionwith CITY and CONTRACTOR and will notify CONTRACTOR in writing of the results of thisinspection as to the items of the Work that appear to be incomplete, non-conforming or defective.CONTRACTOR shall immediately take such measures as are necessary to remedy suchdeficiencies, and notify ENGINEER upon completion. The Final Inspection by ENGINEER withCITY and CONTRACTOR will verify completion of all items.14.15 CONTRACTOR's Continuing ObligationCONTRACTOR's obligation to perform and complete the Work in accordance with the ContractDocuments shall be absolute. Neither recommendation of any progress or Final Payment byENGINEER, nor the issuance of a Certificate of Substantial Completion, nor any payment byCITY to CONTRACTOR nor any Partial Utilization by CITY nor any act of acceptance by CITYnor any failure to do so, nor any review and approval of the Shop Drawings or samples, nor anyreview of a Progress Schedule, nor the issuance of a notice of acceptability by ENGINEER, norany correction of defective Work by CITY will constitute an acceptance of Work not in accordancewith the Contract Documents or a release of CONTRACTOR's obligation to perform the Work inaccordance with the Contract Documents except as provided in a waiver of claims at the time ofmaking and acceptance of Final Payment.Section 00700 00700- 60


ARTICLE 15 - SUSPENSION OF WORK AND TERMINATION15.1 CITY May Stop the WorkIf the Work is defective and the CONTRACTOR has been notified by ENGINEER or CITY, or ifCONTRACTOR fails to furnish or perform the Work in such a way that the completed Work willconform to the Contract Documents, or if CONTRACTOR fails to supply sufficient supervisorypersonnel or skilled workmen or suitable materials or equipment, or if CONTRACTOR fails toobtain, maintain or renew insurance in conformance with the Contract Documents in a formacceptable to CITY, or if any insurance company CONTRACTOR has obtained insurance fromdeclares bankruptcy or is declared bankrupt, or if CONTRACTOR fails to prosecute the Workwithout endangering persons or property, CITY may order CONTRACTOR to stop the Work, orany portion thereof, until the cause for such order has been eliminated. CITY's order to stop theWork may be communicated through ENGINEER or by CITY. This right of CITY to stop theWork shall not give rise to any duty on the part of CITY or ENGINEER to exercise this right for thebenefit of CONTRACTOR or any other party. CONTRACTOR shall bear all direct, indirect, andconsequential costs of such order to stop the Work (including but not limited to fees and chargesof engineers, attorneys and other professionals, any additional expenses incurred by CITY due todelays to others performing work under a separate contract with CITY, and other obligations), andCONTRACTOR shall further bear the responsibility for maintaining the Progress Schedule andshall not be entitled to any extension of Contract Time or increase in the Contract Price. CITYshall be entitled to deduct any expenses so incurred from the Contract Price by issuing a ChangeOrder.15.2 Suspension for Convenience15.2.1 Without invalidating the Agreement, and without notice to any surety, CITY may, at anytime, order CONTRACTOR in writing to stop, delay or interrupt Work for such a period oftime as CITY may deem appropriate. Upon receipt of that order, CONTRACTOR shallimmediately proceed in accordance with any specific provisions or instructions, protectand maintain the Work, and make reasonable and diligent efforts to mitigate costsassociated with the suspension order.15.2.2 If any suspension of Work under this paragraph causes an increase or decrease inCONTRACTOR's cost or the time required to perform or complete any part of the Work,CITY shall make a change in Contract Price or Contract Time, as provided in Article 10and 11; except that no change in Contract Price or Contract Time will be made for anysuspension of Work to the extent that performance would have been suspended anyhowby causes not meeting the criteria in Article 11, or for which an adjustment is provided orexcluded under any other provision of the Contract Documents.15.3 Termination for Cause15.3.1 CITY may upon the occurrence of any one or more of the following events terminate theservices of CONTRACTOR:15.3.1.1 If a trustee, receiver, custodian or agent of CONTRACTOR is appointedunder applicable law or under contract, whose appointment or authorityto take charge of property of CONTRACTOR is for the purpose ofenforcing a Lien against such property or for the purpose of generaladministration of such property for the benefit of CONTRACTOR'screditors;15.3.1.2 If CONTRACTOR admits in writing an inability to pay its debts generallyas they become due;Section 00700 00700- 61


15.3.1.3 If CONTRACTOR fails to perform the Work in accordance with theContract Documents (including, but not limited to, failure to supplysufficient skilled workers, sufficient supervisory personnel, or suitablematerials or equipment or failure to adhere to the Progress Schedules);15.3.1.4 If CONTRACTOR discontinues prosecution of the Work or any portionthereof;15.3.1.5 If CONTRACTOR allows any final judgment against it to remainunsatisfied for a period of ten days;15.3.1.6 If CONTRACTOR disregards laws, policies, court orders, oradministrative directives, etc. of any governmental body, agency or courthaving jurisdiction;15.3.1.7 If CONTRACTOR disregards the authority of ENGINEER;15.3.1.8 If CONTRACTOR otherwise violates in any substantial way anyprovisions of the Contract Documents; or15.3.1.9 If CONTRACTOR fails to promptly pay Subcontractors, Suppliers,Materialmen, Laborers, etc.15.3.2 As it is recognized that if CONTRACTOR is adjudged bankrupt or makes a generalassignment for the benefit of creditors or if a receiver is appointed on account of itsinsolvency, such could impair or frustrate CONTRACTOR's performance of the Work,therefore it is agreed that upon occurrence of any such event, CITY shall be entitled torequest CONTRACTOR or its successor to provide adequate assurance of futureperformance in accordance with the terms and conditions of the Contract Documents.Failure to provide said adequate assurance within seven (7) days of the delivery of therequest shall entitle CITY to terminate CONTRACTOR. In all events pending receipt ofadequate assurance of performance and actual performance in accordance herewith,CITY shall be entitled to proceed with the Work with its own forces or with theircontractors on a time and material or other appropriate basis the cost of which will beback charged against CONTRACTOR. CITY shall be entitled to deduct these costs fromthe Contract Price by issuing a Change Order.15.3.3 CITY may, after giving CONTRACTOR and surety seven (7) days written notice, and tothe extent permitted by laws and regulations, terminate the services of CONTRACTOR,exclude CONTRACTOR from the site and take possession of the Work and of allCONTRACTOR's tools, appliances, construction equipment and machinery at the siteand use the same to the full extent they could be used by CONTRACTOR (withoutliability to CONTRACTOR for trespass or conversion), incorporate in the Work allmaterials and equipment stored at the site or for which CITY has paid CONTRACTORbut which are stored elsewhere, and finish the Work as CITY may deem expedient.CONTRACTOR shall assign all of its interest in any or all Sub-Agreements to CITY uponCITY's request. In such case CONTRACTOR shall not be entitled to receive any furtherpayment until the Work is finished. If the unpaid balance of the Contract Price exceedsthe direct, indirect and consequential costs of completing the Work (including but notlimited to fees and charges of engineers, architects, attorneys and other professionalsand court and arbitration costs including costs for appellate proceedings) such excess willbe paid to CONTRACTOR. If such costs exceed such unpaid balance, CONTRACTORshall pay the difference to CITY. If CONTRACTOR leaves the site at any time during theseven day period, CITY shall have the right to secure the site to protect the property fromdamage and to insure the health and safety of the public.Section 00700 00700- 62


15.3.4 Notwithstanding the above notice period, in the event of an emergency, the CITY maytake over the site and perform any or all of the activities set out above immediately. CITYshall provide notice of such takeover within 24 hours after its occurrence.15.3.5 Where CONTRACTOR's services have been terminated by CITY, the termination shallnot affect any rights of CITY against CONTRACTOR then existing or which maythereafter accrue. Any retention or payment due CONTRACTOR by CITY will notrelease CONTRACTOR from liability.15.3.6 CITY may, at its sole discretion, permit CONTRACTOR to continue to perform work whenCONTRACTOR is in default, however caused. Such a decision by CITY shall in no wayoperate as a waiver on the part of CITY of any of its rights under the ContractDocuments.15.4 Termination for Convenience15.4.1 CITY may, without prejudice to any other right or remedy, terminate this Contract inwhole or in part at any time for its convenience by giving CONTRACTOR and suretyseven (7) days written notice. CITY shall have the right, in that event, to take over any orall of CONTRACTOR's materials, (whether stored on or off site) supplies, equipment,Sub-Agreements or other obligations to complete the Work and CONTRACTOR shallassign them to CITY upon CITY's request. CONTRACTOR shall proceed to completeany part of the Work, as directed by CITY, and shall settle all its claims and obligationsunder the Agreement.15.4.2 In any such termination for the convenience of CITY, CONTRACTOR shall be paid forWork completed in accordance with the Contract Documents prior to receipt of the noticeof termination, and for reasonable termination settlement costs relating to commitmentswhich had become firm prior to the termination; however, payment to CONTRACTOR willexclude any and all anticipated supplemental costs, administrative expenses overheadand profit on uncompleted Work. CONTRACTOR shall justify its claims as requested byCITY with thorough, accurate records and data.15.4.3 If, after notice of Termination for Cause of CONTRACTOR, it is determined thatCONTRACTOR was not in default, the termination shall be deemed to have been for theconvenience of CITY. In such event CONTRACTOR may recover from CITY payment inaccordance with paragraph 15.4.2.15.5 CONTRACTOR May Stop Work or TerminateIf, through no act or fault of CONTRACTOR, or a Subcontractor or their agents or employees orany other person for whose acts they may be responsible, the Work is suspended for a period ofmore than ninety (90) days by CITY or under an order of court or other public authority, orENGINEER fails to act on any Application for Payment within forty-five (45) days after it issubmitted, or CITY fails for forty-five (45) days to pay CONTRACTOR any sum finally determinedto be due, then CONTRACTOR may, upon seven (7) days written notice to CITY andENGINEER, terminate the Agreement and recover from CITY payment for all Work executed andany expense sustained plus reasonable termination expenses. In addition and in lieu ofterminating the Agreement, if ENGINEER has failed to act on an Application for Payment or CITYhas failed to make any payment as aforesaid, CONTRACTOR may upon seven (7) days' noticeto CITY and ENGINEER stop the Work until payment of all amounts then due. Except asspecifically provided in this paragraph, these provisions shall not relieve CONTRACTOR of theobligation under Article 6 to carry on the Work in accordance with the Progress Schedule andwithout delay during disputes and disagreements with the CITY.Section 00700 00700- 63


ARTICLE 16 - VALUE ENGINEERING INCENTIVE16.1 This provision applies to any CONTRACTOR developed, prepared, and submitted ValueEngineering Change Proposal (VECP). The following definitions shall apply to thisarticle:16.1.1 "CONTRACTOR's development and implementation costs" means those costsincurred in a VECP before CITY acceptance and those costs CONTRACTORincurs specifically to make the changes required by CITY acceptance of a VECP.16.1.2 "CITY costs" means those costs that result directly from evaluating andimplementing the VECP and any net increases in the cost of testing, operations,maintenance, repair, replacement, spare parts, and support. They includeENGINEER's and DESIGN ENGINEER's charges to CITY in connection withevaluating and implementing the VECP and the cost of any consultant retainedby CITY, ENGINEER or DESIGN ENGINEER to assist in the evaluation of theVECP. However, they do not include the normal administrative costs ofprocessing the VECP.16.1.3 "Contract savings" means the estimated reduction in CONTRACTOR's cost ofperformance resulting from acceptance of the VECP, minus CONTRACTOR'sdevelopment and implementation costs (including Subcontractors' developmentand implementation costs).16.1.4 "Value Engineering Change Proposal (VECP)" means a proposal that: (1)requires a change to the Contract Documents to implement, and (2) results inreducing the Contract Price or estimated cost without impairing in any waynecessary functions or characteristics of the Project, provided that it does notinvolve a change in deliverable end-item quantities only.16.2 As a minimum, CONTRACTOR shall include the following information in each VECP insufficient detail to allow CITY a meaningful evaluation:16.2.1 A description of the difference between the existing requirement in the ContractDocuments and that proposed, the comparative advantages and disadvantagesof each, a justification when an item's function or characteristics are proposed tobe altered, and the effect of the change on the end items performance.16.2.2 A list of all changes to the Contract Document that must be made if the VECP isaccepted, including any suggested specification revisions (and also including anyadditional items such as new permits, regulatory entity approvals, etc.).16.2.3 An itemized estimate of Contract savings, which shall contain at a minimum,separate, detailed cost estimates for both the requirement of the existingContract Documents and the VECP, CONTRACTOR'S development andimplementation costs, and any license fees or royalty payments to be made.CONTRACTOR's cost estimate for the VECP shall also include, but not belimited to, costs of any delays that may be associated with implementing theVECP and cost and claims of other contractors affected by the VECP.CONTRACTOR shall also provide a description and itemized estimate of costsCITY may incur in implementing the VECP, such as those defined above.16.2.4 A statement of the time by which a Change Request or Change Order acceptingthe VECP must be issued in order to achieve the maximum cost reduction, notingany effect on the Contract Time(s) or Progress Schedule.Section 00700 00700- 64


16.2.5 Identification of any previous submissions of the VECP.16.3 CONTRACTOR shall submit VECP's to ENGINEER. ENGINEER shall notifyCONTRACTOR of the status of the VECP within 45 days after ENGINEER receives it. Ifadditional time is required, as determined by ENGINEER, CONTRACTOR shall benotified within the 45 day period and provided the reason for the delay and the expecteddate of CITY's decision. VECP's shall be processed expeditiously; however, CITY shallnot be liable for any delay in acting upon a VECP. If additional information is required,ENGINEER shall inform CONTRACTOR, who shall expeditiously provide the requiredinformation, and failing to comply with said request shall waive the benefits under thisArticle.16.4 If the VECP is not accepted by CITY, ENGINEER shall provide CONTRACTOR writtennotification of rejection. CONTRACTOR may withdraw, in whole or in part, any VECP notaccepted by CITY within the period specified in the VECP. ENGINEER may require thatCONTRACTOR provide written notification before undertaking significant expendituresfor VECP effort. Nothing contained herein to the contrary, CITY is under no obligation toaccept all or part of any VECP, and CITY may at its discretion reject a VECP in whole orin part for any reason. CONTRACTOR shall be responsible for CONTRACTOR'sdevelopment and implementation costs and CITY costs incurred in connection with arejected VECP. CITY will be entitled to an appropriate decrease in Contract Price forCITY costs incurred in connection with a rejected VECP.16.5 Any VECP may be accepted in whole or in part by a Change Order citing this clause.CITY may accept the VECP, even though an agreement on price reduction has not beenreached, by a Change Request ordering CONTRACTOR to proceed with the change.Until such Change Request is issued, CONTRACTOR shall perform in accordance withthe existing Contract Documents. CITY's decision to accept all or part of any VECP shallnot be contestable by CONTRACTOR..16.6 The CONTRACTOR's share of savings will be fifty percent (50%) of Contract savings.16.7 Payment of any amount due CONTRACTOR for use of a VECP shall be authorized by aChange Order which (1) accepts the VECP, (2) reduces the Contract Price or estimatedcost by the amount of Contract savings, and (3) provides CONTRACTOR'S share ofsavings by adding the amount calculated in 16.6 to the Contract Price as reduced inclause (2) herein.16.8 CONTRACTOR shall include value engineering clauses in any Sub-Agreement of$50,000 or more and may include them in Sub-Agreements of lesser value. To computeany adjustment in the Contract Price, CONTRACTOR's VECP development andimplementation costs shall include any Subcontractor's development and implementationcosts that clearly result from the VECP, but shall exclude any value engineering incentivepayments to Subcontractors. CONTRACTOR may choose any arrangement forSubcontractor value engineering incentive payments, provided that these payments arenot made from CITY's share of the savings resulting from the VECP.16.9 CONTRACTOR may restrict CITY's right to use any part of a VECP or the supportingdata by marking the following legend on the affected parts:"These data, furnished under the Value Engineering Incentive clause of Contract_____________________, shall not be disclosed outside the CITY by CITY,ENGINEER or DESIGN ENGINEER, except as otherwise required by law, orduplicated, used, or disclosed, in whole or in part, for any purpose other than toevaluate a VECP submitted under the clause. This restriction does not limit theCITY's right to use information contained in these data if it has been obtained orSection 00700 00700- 65


is otherwise available from the CONTRACTOR or from another source withoutlimitations."If a VECP is accepted, CONTRACTOR hereby grants CITY unlimited rights in the VECPand supporting data, except that, with respect to data qualifying and submitted as limitedrights technical data, CITY shall have the rights specified in the Change Orderimplementing the VECP and shall appropriately mark the data.ARTICLE 17 - MISCELLANEOUS17.1 Giving Notice17.1.1 Whenever any provision of the Contract Documents requires the giving of written notice itshall be deemed to have been validly given as of the time of actual delivery if delivered inperson; or if it is delivered by registered mail, delivery service, or telegram, chargesprepaid, at the actual time of delivery at the last business address known to the giver ofthe notice.17.1.2 Written notice to be delivered to CITY or ENGINEER or to any of its representatives byCONTRACTOR shall be delivered at the office stated in the Agreement, unlessotherwise specified in writing to CONTRACTOR. Written notice to CONTRACTOR byCITY or ENGINEER shall be delivered to the individual or member of the firm or to anofficer of the corporation for whom it is intended at the office stated in the Agreement, orsuch other office or individual designated by CONTRACTOR in writing to CITY.17.2 Notice to Other AgenciesCONTRACTOR shall notify all public and private entities or agencies in accordance with any andall ordinances, laws, agreements, licenses, and any other directions of construction activity,disruption of access or services. CITY or ENGINEER shall not be responsible for any suchnotification.17.3 Computation of TimeWhen any period of time is referred to in the Contract Documents by days, it shall be computed toexclude the first and include the last day of such period. If the last day of any such period falls ona Saturday or Sunday or on a Holiday, such day shall be omitted from the computation.17.4 Claims for Injury or Damage to Person or PropertyShould CITY or CONTRACTOR suffer injury or damage to person or property because of anyerror, omission or act of the other party or of any of the other party's employees or agents orothers for whose acts the other party is legally liable, claim will be made in writing to the otherparty within a reasonable time from the first observance of such injury or damage. This provisionshall not be construed as a substitute for or a waiver of the provisions of any applicable statute oflimitations or repose.17.5 No Conflict with Laws or Regulations17.5.1 The duties, obligations, criteria or procedure imposed by these General Conditions andthe rights and remedies made available are in addition to, and are not to be construed inany way as a limitation of any rights and remedies available to any or all of them whichare otherwise imposed or available by Laws or Regulations, except that in the event thata specific part or detailed requirement of a provision, criterion or procedure in theseGeneral Conditions and a specific part or detailed requirement of a provision, criterion orprocedure imposed or available by Laws or Regulations are in conflict the specific part orSection 00700 00700- 66


detailed requirement of Laws and Regulations shall govern. All other specific parts ordetailed requirements in the provisions, criteria or procedures of the applicable Laws orRegulations and these General Conditions not in conflict shall remain in full force andeffect and be read with the controlling specific part or detailed requirement.17.5.2 The provisions of this paragraph will be as effective as if repeated specifically in theContract Documents in connection with each particular duty, obligation, right and remedyto which they apply.17.5.3 Each and every provision of law and clause required by law to be inserted in the ContractDocuments shall be deemed to be inserted therein and the Contract shall be read andenforced as though it were included therein.17.6 Partial InvalidityIf any provision of this contract is held by a court of competent jurisdiction to be invalid orunenforceable, such invalidity or un-enforceability shall not affect the other parts of this Contract ifthe rights and obligations of the parties contained herein are not materially prejudiced and if theintentions of the parties can continue to be effectuated. To that end, this contract is declaredseverable.17.7 No Waiver of Rights, Duties17.7.1 Except as otherwise specifically provided in the Contract Documents, no action or failureto act by the CITY, ENGINEER, CITY's Representative(s), or CONTRACTOR shallconstitute a waiver of any right or duty afforded any of them under the ContractDocuments, nor shall any such action or failure to act constitute an approval of oracquiescence of any breach thereunder.17.7.2 All representations, indemnities, warranties and guarantees required by the ContractDocuments, including the Warranty Period shall survive Final Payment and termination orcompletion of this Agreement.17.8 Advertising17.9 VenueNo advertising shall be permitted upon any part of the site or structures located on the site. Newsor press releases pertaining to the services, work product(s), or performance of CONTRACTORunder this Agreement or the Project to which it relates shall be at the sole discretion of CITY.The location of any litigation arising between the parties shall only be in the courts of VolusiaCounty, Florida.17.10 Recovery of DamagesIn no event shall CONTRACTOR be entitled to recover from CITY any indirect, incidental, orconsequential damages in any proceeding arising out of or relating to this Agreement or breachthereof.END OF SECTIONSection 00700 00700- 67


SECTION 00800SUPPLEMENTAL CONDITIONSThese Special Conditions are specific to this project and are in addition to the GeneralConditions.SP-1 References to “Specifications”, and “Standard Specifications” in theContract Documents refer to The Florida Department of TransportationStandard Specifications for Road and Bridge Construction”.SP-2 The roadway improvements to be constructed under this contract fallunder the jurisdiction of the City of Deltona and these improvements,including drainage and sidewalks, shall be built in compliance with theTechnical Specifications and the “Florida Department of Transportation(FDOT) Standard Specifications for Road and Bridge Construction”, aswell as the “FDOT Design Standards for Design, Construction,Maintenance and Utility Operations on the State Highway System”(Standard Index).The Contractor will be responsible to obtain applicable right-of-wayutilization, utility, dewatering or other required permits, and to pay thecosts associated with those permits. The Contractor shall be responsibleto coordinate his activities with the respective agencies as required.SP-3 The Contractor shall be solely responsible for compliance with allapplicable regulations issued by the Florida Department of EnvironmentalProtection (FDEP), the St. Johns River Water Management District(SJRWMD), and the U.S. Environmental Protection Agency (EPA)(NPDES permit) for this project.SP-4 The Contractor shall prepare a stormwater pollution plan per Federalguidelines, submit said plan to the SJRWMD, and submit a Notice ofIntent (NOI) to obtain an NPDES permit (copies to be submitted to theOwner). SEE CONSTRUCTION PLAN SHEET 34. Compliance with therequirements of the plan and the permit (including inspections of theerosion control facilities) shall be the sole responsibility of the Contractor(with copies of erosion reports sent to owner). Silt fences, as a minimum,Section 00800 00800- 1


shall be utilized to control erosion. The contractor shall be responsible forthe proper maintenance of the erosion control features duringconstruction. The contractor shall be responsible for the removal of the siltfences and temporary erosion control features after erodable surfaces arestabilized. A COPY OF THE CONTRACTOR’S STORMWATERPOLLUTION PREVENTION PLAN AND INSPECTION REPORTS SHALLBE SUBMITTED WITH THE CONTRACTOR’S INITIAL APPLICATIONFOR PAYMENT. NO FUNDS SHALL BE RELEASED UNLESS THESEDOCUMENTS ARE SUBMITTED.SP-5 No plants for preparation of construction material (i.e. asphalt, soil cementmills, etc.) shall be allowed on-site.SP-6 The Contractor hereby acknowledges the Trench Safety Act of Florida(90-96), and has included the cost of compliance in his bid.SP-7 Control staking (roadway centerlines and a benchmark) will be provided.All other staking shall be provided by the Contractor.SP-8 Geotechnical testing (not retesting) shall be provided by the City ofDeltona. Any retesting will be billed to the Contractor.SP-9 Soil cement preparation may not utilize existing soil at this site.SP-10 Geotechnical information is shown in the construction plans on sheet 41,“Roadway Soil Survey”. The complete report is available for review at theoffices of Bowyer-Singleton & Associates, Inc. The Contractor shall makehis own field inspection of the site to supplement this information.SP-11 Only minimal tracking of construction dirt onto adjacent streets will beallowed. The Contractor shall keep a mechanical broom on-site.SP-12 Any unsuitable soils on-site shall be disposed of in locations determinedby the Owner.SP-13 Any hydrocarbon (i.e., fuel, oil, et cetera) tanks stored on-site must beapproved by the Owner. Adequate liners to contain any and all tank spillsSection 00800 00800- 2


and rainwater shall be approved prior to use. The Contractor shall cleanup any such spills in accordance with state requirements.SP-14 Substantial completion as defined by Article 14.13 of the GeneralConditions, is hereby further defined. The Work will be consideredsubstantially complete when:1. The ponds and storm drainage systems have been constructed perplan, and the following related tests / inspections / clearances havebeen completed and approved:a. Storm drainage systems:i. Backfill density testsii. Lamping and video inspection.iii. As-Built inverts and Top elevations provided.b. Ponds:i. As-Built outfall structure elevations and dimensions.ii. Pond slope As-Built elevations provided.2. The roadway, including pavement, curb, sidewalks, walls andappurtenances have been constructed per plan, and the followingtests / inspections / clearances have been completed andapproved:a. Pavement & Curb:i. Subgrade density tests.ii. Base compaction depth & tests.iii. Asphalt density tests and cores.iv. Concrete compression tests (cylinders), whereapplicable.b. Sidewalks:i. Subgrade density tests.c. Other:i. Sod and/or seed mulch placed – disturbed areasrestored.ii. Striping, signage and signalization items have beenconstructed per plan.SP-15 All disturbed areas shall be seeded and mulched, by the site contractor athis expense, per DOT specifications. This shall include all material storageSection 00800 00800- 3


areas, vehicular parking and travel areas and other areas disturbedthroughout the course of construction.SP-16 The Contractor shall schedule and coordinate with BellsouthTelecommunications, Inc., Florida Power & Light, Florida Public Utilities,Progress-Energy, Deltona Water, Century Link, AT&T, and Bright HouseCable Network. Any areas disturbed by the utility contractors shall bereseeded, by the site contractor at his expense, upon their completion. Itis the responsibility of the Contractor to notify the utility companies toinstall their sleeves prior to curb installation. Ref: Instructions to Bidders,Section 00100, Article 6.7.SP-17 N/ASP-18 Sod shall match existing sod type. Sod at pond slopes and median areasto be Bahia.SP-19 The Contractor shall take adequate precautions to prevent siltation fromentering the lake system. A final chemical treatment may be required atthe Contractors expense should he cause unacceptable levels of turbidityto occur.SP-20 All design slopes of 5:1 or steeper shall be sodded with bahia, or to matchexisting sod type.SP-21 N/ASP-22 The contractor shall be responsible for fine grading of the right of way andother areas disturbed during the execution of his work.SP-23 The cost for Pre-Construction Audio-Video (Section 01390) shall beincluded in item 101-1a Mobilization on the Bid Response Form (Section00300). Contractor shall include sufficient coverage beyond the proposedlimits of construction to protect City & contractor from claims relating topre-existing conditions. Video coverage shall include homes near pondtracts, driveways and landscaping.Section 00800 00800- 4


SP-24 Instructions to Bidder, Section 00100, Article 6.2.2 is amended as follows:Reference to Supplementary Conditions Paragraph SC-4.2.1 is deleted.SP-25 Time is of the essence, timely completion of project improvements isimperative. Engineer’s estimated time of construction is 270 days.SP-26 Payment for removal of existing storm drainage pipe and structures,sidewalk and retaining walls as shown on plans will be included underClearing & Grubbing.SP-27 Bid Item 102-1, “Maintenance of Traffic” to include temporary pavement asshown on Plan Sheet 35.SP-28 There is an anticipated surplus of excavated material on the project.Contractor shall coordinate with the City of Deltona to arrange for astockpile locations. Contractor shall be responsible for all cost associatedwith the excavation, hauling, stockpiling and providing required erosion /pollution abatement measures. In the event that the City of Deltona cannot provide sufficient land to stockpile all the surplus material, the excessmaterial shall become the property of the contractor and the contractorshall be responsible for the handling and disposal of the material.SP-29 The contractor is encouraged to coordinate with property owners toeliminate retaining walls and handrails.SP-30 Within Twenty-one (21) calendar days after receiving the Notice toProceed, the CONTRACTOR shall establish in the field the proposedroadway centerline, right-of-way and construction easements usingwooden 1” X 4’X 4’0” stakes at a maximum spacing of 100 feet_ Stationsshall be marked on each stake and shall be of sufficient size and claritythat they can be easily read by the unaided eye at a 150 feet distance.Right-of-way and construction easement staking shall be maintained bythe CONTRACTOR throughout construction. No invoice for payment willbe processed until the right-of-way has been staked to the satisfaction ofthe ENGINEER. Payment is included in the price for bid item number101-1 “Mobilization”. CONTRACTOR shall pay all expenses in connectionwith this work.Section 00800 00800- 5


Section 00800 00800- 6END OF SECTION


SECTION 00841NOTICE OF AWARD FORMContractorDate:RE:Notice to Proceed on Project:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”You are notified that your bid dated _______________, 20___ for the above Contracthas been considered and the OWNER expects to award you a contract for:__________________________________________________________________________________________________________________________________________________________________________________________________________________________________________(Indicate total Work, Alternates or Sections of Work Awarded)The Contract Price of your contract is_________________________________________ Dollars ($____________).Six (6) copies of the following proposed Contract Documents (except Project Manualand Drawings) accompany this Notice of Award:Agreement Between Owner and ContractorPerformance BondPayment BondNotice of AwardYou must comply with the following conditions precedent to the award of the Contractwithin ten (10) days of the Notice of Award, that is by ________________, 20___.1. You must deliver to the OWNER six (6) fully executed counterparts of theAgreement.2. You must deliver with the executed Agreement six (6) completed originaldocuments with original signatures on the Payment and Performance Bond in theform specified in the Bidding Documents.Section 00841 00841- 1


3. You must provide in writing the correct name and address of the surety which isproviding the Payment and Performance Bonds and the correct name andaddress of the surety’s resident agent for service of process in Florida.4. You must deliver with the executed Agreement six (6) completed, with originalsignatures, Certificates and Endorsements of Insurance in the form specified inthe Bidding Documents.Failure to comply with these conditions within the time specified will entitle the OWNERto consider you Bid abandoned, to annul this Notice of Award, and to declare your BidSecurity forfeited.Within ten (10) days after you comply with these conditions, the OWNER will return toyou one (1) fully signed counterpart of the Agreement with the Contract Documentsattached.OWNER: CITY OF DELTONAACCEPTANCE OF AWARD:Utility Director(Contractor)(Authorized Signature)(Address)Acct. No.:(Title)(Authorized SignatureAcknowledge of Receipt of Notice)(Title)Copy to:Bowyer-Singleton & Associates, Inc.520 South Magnolia AvenueOrlando, FL 32801Attn: Kevin E. Knudsen, P.E.(Date)END OF SECTIONSection 00841 00841- 2


SECTION 00842NOTICE TO PROCEED FORMContractorDate:RE:Notice to Proceed on Project:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”You are notified that the Contract Time under the above contract will commence to runon _______________, 20___. On that date you are to start performing the work andother obligations under the Contract Documents. Based on the Contract Time stated inthe Agreement, we calculate that the first set of dates for Substantial Completion andFinal Completion are _______________, 20___ and _______________, 20___,respectively.Enclosed is one (1) set of Drawings and one (1) bound copy of the Project Manualcontaining:1. Bid Forms (Bidding Documents, entire Section 00300).2. Bidders Contract & Information Form (Section 301).3. Subcontractor Listing (Section 0301-A-3).4. Bid Bond or security (surety bond or cashier’s check). (Section 00410).5. Power of Attorney (for surety bond only).6. Corporate Resolution (any corporate employee other than president or vicepresident,Section 00420).7. Sworn Statement Pursuant to Section 287.133(3)(a), Florida Statutes on PublicEntity Crimes (Section 00470).8. Non-Collusion Affidavit Form (Section 00480).9. Trench Safety Affidavit (Section 00490).Section 00842 00842- 1


OWNER:BY:(Contractor)(Address)(Authorized Signature)(Authorized SignatureAcknowledge of Receipt of Notice)(Title)(Title)(Date)END OF SECTIONSection 00842 00842- 2


SECTION 00843CHANGE ORDER FORMProject:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”CHANGE ORDER NO.DATE OF ISSUANCE:EFFECTIVE DATE:CONTRACTOR:ENGINEER: Bowyer-Singleton & Assoc., Inc.OWNER’S CONTRACT NO.:The following Changes are hereby made to the Contract Documents:CHANGE IN CONTRACT PRICE:Original Contract Price:CHANGE IN CONTRACT TIMES:Original Contract Times (Days or Dates):Substantial Completion: _____________$________________________________Net changes from previous Change Orders No. ___to No. ___$_______________________________Contract Price prior to Change Order$ ______________________________Ready for Final Payment: ____________Net changes from previous Change Orders No. ___to No. _____________________________________(Days)Contract Times prior to this Change OrderSubstantial Completion: ______________Ready for Final Payment: _____________Net Increase (decrease) of this Change Order$ _______________________________Contract Price with all approved Change Orders$ ________________________________Net increase (decrease) of this Change Order____________________________ (Days)Contract Times with all approved Change OrdersSubstantial Completion: _____________Ready for Final Payment: ____________(Days orDates)Section 00843 00843-1


CHANGES ORDERED:I. GENERAL: This change order is necessary to cover changes in the workto be performed under this Contract. The General Conditions,Supplementary Conditions, Specifications and all parts of the ProjectManual listed in Article 1, Definitions, of the General Conditions apply toand govern all work under this change order.Change Order No. _________II. REQUIRED CHANGES:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________III. JUSTIFICATION:____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________IV. PAYMENT:______________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________V. APPROVAL AND CHANGE AUTHORIZATION:______________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________Section 00843 00843-2


Acknowledgements:The aforementioned change, and work affected thereby, is subject to allprovisions of the original contract not specifically changed by this Change Order,and,It is expressly understood and agreed that the approval of the Change Ordershall have no effect on the original contract other than matters expresslyprovided herein.Change Order Requested by:Change(s) Ordered by:RECOMMENDED BY:ACCEPTED BY:(Engineer)(Contractor)By:(Authorized Signature and Date)By:(Authorized Signature and Date)(Title)(Title)APPROVED BY:(Owner)By:(Authorized Signature and Date)END OF SECTIONSection 00843 00843-3


SECTION 00844APPLICATION AND CERTIFICATION FOR PAYMENT FORMApplication No. Progress FinalEngineer’s Project No.:Project:Contractor:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”Contract Date:Contract for:Application Date:For Period Ending:Change Order SummaryChange Orders approved inPrevious months by OWNERTOTALApproved this monthNumber DateApprovedADDITIONSDEDUCTIONSTOTALSNet Change by Change Orders1. ORIGINAL CONTRACT SUM $2. Net Change by Change Order $3. CONTRACT SUM TO DATE (Line 1 and 2) $4. TOTAL COMPLETED AND STORED TO DATE $5. RETAINAGE: (Column I & N, Forms 00845 and 00846)a. _____% of Completed Work $b. _____% of Stored Material $6. TOTAL EARNED LESS RETAINAGE $(Line 4 less Line 5 Total)7. LESS PREVIOUS CERTIFICATES FOR PAYMENT $(Line 6 from prior Certificate)8. AMOUNT DUE THIS APPLICATION $9. BALANCE TO FINISH, PLUS RETAINAGE $(Line 3 less Line 6)Section 00844 00844-1


Contractor’s Certification:The undersigned Contractor hereby swears under penalty of perjury that (1) all previousprogress payments received from the Owner on account of Work performed under thecontract referred to above have been applied by the undersigned to discharge in full allobligations of the undersigned incurred in connection with Work covered by priorApplications for Payment numbered 1 through ___ inclusive; and (2) all materials andequipment incorporated in said Project or otherwise listed in or covered by thisApplication for Payment are free and clear of all liens, claims, security interest andencumbrances; (3) all Work covered by this Application for Payment is in accordancewith the Contract Documents and not defective as term is defined in the ContractDocuments.Dated, 20__.(Contractor)By:(Name)(Title)COUNTY OFSTATE OFBefore me on this day of , 20__, personally appears, known to me, who being duly sworn, deposes and says that (s)he is theof the Contractor above mentioned; that (s)he executed the above Application forPayment and statement on behalf of said Contractor; and that all of the statementscontained therein are true, correct and complete.Notary PublicMy Commission ExpiresSection 00844 00844-2


Engineer’s RecommendationPayment of the above AMOUNT DUE THIS APPLICATION is recommended.Dyer, Riddle, Mills & Precourt, Inc. (DRMP)By:(Authorized Signature)Date:Owner’s ApprovalBy:(Authorized Signature)Date:Account Number:END OF SECTIONSection 00844 00844-3


SECTION 00845SCHEDULE OF VALUESPay Estimate No. ProjectFor Period Ending Prepared by Page ofA B C D E F G H IItem Description BidQuantityUnits UnitPriceBidAmountCompleteThrough LastPeriodCompleteThrough ThisPeriodValue ofItemsCompletedQty % Qty %SubtotalsEND OF SECTIONSection 00845 00845-1


SECTION 00846MATERIALS STORED ON SITE FORMPay Estimate No. Project Date PreparedFor Period Ending Prepared by Page ofABItem Description Quantity UnitPriceValue Last Period (-)(+)Value Material Installed Value Material DeliveredValue This PeriodC D E F G H I J K L M NInvoice Quantity Unit Invoice Quantity Unit Invoice Quantity UnitAmountPrice AmountPrice AmountPriceInvoiceAmountEND OF SECTIONSection 00846 00846-1


SECTION 00847SHOP DRAWING SUBMITTAL FORMOwner: City of Deltona Specification No.:2345 Providence Boulevard Project: Normandy Boulevard – Sect. BDeltona, FL 32725Roadway ImprovementsContractor:Bowyer-SingletonProject Number:Owner’sProject Number:FOR BOWYER-SINGLETON USE ONLY:DATE RECEIVEDDATE RETURNEDContractor’sSubmittal Number:Contractor’s Resubmittal Yes NoProject Number:ITEMNO.RESUBMITTALNO.NO. OFCOPIESVENDOR DESCRIPTION ENGINEER’SACTIONACTION CODE (As defined in the General Conditions)A APPROVED Submitted by _____________________AN APPROVED AS NOTEDContractorAR AMEND AND RESUBMITR REJECTED Date ________________________ENGINEER’S COMMENTS:DistributionDiscipline Review:ContractorCopiesOwnerCopiesBowyer-Singleton Copies Reviewed By DateDiscipline Review:Reviewed ByDateProject ManagerDateSection 00847 00847-1


SECTION 00848CERTIFICATE OF SUBSTANTIAL COMPLETIONOWNER’S Project No.:ENGINEER’S Project No.:CITY OF DELTONAROADWAY IMPROVEMENTSNORMANDY BOULEVARD – SECTION “B”CONTRACTORContract Date:This Certificate of Substantial Completion applies to all Work under the ContractDocuments or to the following specified parts thereof.ToAnd ToOwnerContractorThe Work to which this Certificate applies as been inspected by authorizedrepresentatives of OWNER, CONTRACTOR and ENGINEER, and that Work is herebydeclared to be substantially complete in accordance with the Contract Documents onDate of Substantial CompletionCertificate of Substantial CompletionPage 1 of 3Section 00848 00848-1


A tentative list of items to be completed or corrected is attached hereto. This list maynot be all-inclusive, and the failure to include an item therein does not alter theresponsibility of CONTRACTOR to complete all the Work in accordance with theContract Documents. When this Certificate applies to a specified part of the Work theitems in the tentative list shall be completed or corrected by CONTRACTOR within_____ days of the above date of Substantial Completion.The date of Substantial Completion is the date upon which all guarantees andwarranties begin, except as follows:The responsibilities between OWNER and CONTRACTOR for security, operation,safety, maintenance, heat, utilities and insurance shall be as follows:RESPONSIBILITIES:OWNER:CONTRACTOR:The following documents are attached to and made a part of this Certificate:Certificate of Substantial CompletionPage 2 of 3Section 00848 00848-2


This Certificate does not constitute an acceptance of Work not in accordance with theContract Documents nor is it a release of CONTRACTOR’S obligation to complete theWork in accordance with the Contract Documents.Executed by ENGINEER on, 20__.(Engineer)The CONTRACTOR accepts this Certificate of Substantial Completion on:, 20__.By:By:(Contractor)Certificate of Substantial CompletionPage 3 of 3END OF SECTIONSection 00848 00848-3


SECTION 00849CONTRACTOR’S FINAL RELEASE OF LIENBefore me the undersigned authority in said County and State, appearedwho, being first duly sworn, deposes and says that he isof, a company and/or corporation authorized to do business under the laws ofFlorida, which is the Contractor on the Contract described as:dated theday of , 20__., that the said deponent is duly authorized to make thisaffidavit by resolution of the Board of Directors of said company and/or corporation; thatdeponent knows of his won knowledge that said Contract has been complied with inevery particular by said Contractor and that all parts of the work have been approved bythe Owner’s Engineers; that there are no bills remaining unpaid for labor, material, orotherwise, in connection with said Contract and Work, and that there are no suitspending against the undersigned as Contractor or anyone in connection with the workdone and materials furnished or otherwise under said Contract. Deponent further saysthat the final estimate which has been submitted to the Owner simultaneously with themaking of the affidavit constitutes all claims and demands against the Owner onaccount of said Contract or otherwise, and the acceptance of the sum specified in saidfinal estimate will operate as a full and final release and discharge of the Owner fromany further claims, demands or compensation by Contractor under the above Contract.Deponent further agrees that all guarantees under this Contract shall be in full forcefrom the date of this release as spelled out in the Contract Documents.Sworn to and subscribed to before me thisday of , 20__.Notary PublicMy Commission ExpiresWe, thehaving heretofore executed a Performance Bond for theabove-mentioned Contractor covered Project and Section as described above in thesum ofDollars ($ ), hereby agree that the Owner may make fullpayment of the final estimate, including the retained percentage, to said Contractor.It is fully understood that the granting of the right to the Owner to make payment for thefinal estimate to said Contractor and/or his assigns, shall in no way relieve the sureycompany of its obligations under its bond, as set forth in the Specifications, Contractand Bond pertaining to the above Project.Section 00849 00849-1


IN WITNESS WHEREOF, The has caused thisinstrument to be executed on its behalf by itsand/or itsduly authorized attorney in fact, and its corporate seal to be hereunto affixed, all of thisday of, A.D., 20___.Surety Company(Power of Attorney must be attached if executed by Attorney in Fact)STATE OF FLORIDACOUNTY OFAttorney in FactBefore me the undersigned authority, personally appeared to me well known as theperson described in and who executed the foregoing instrument in the name ofand/orpurpose therein expressed and that he had due andlegal authority to execute the same on behalf of said, acorporation.IN WITNESS WHEREOF, I have hereunto set my hand and official seal atthis day of , 20__.Notary PublicEND OF SECTIONSection 00849 00849-2


SECTION 00850FIELD ORDERFIELD ORDER NO.[ ] OWNER: No. of Copies[ ] ENGINEER: No. of Copies[ ] ARCHITECT : No. of Copies[ ] CONTRACTOR: No. of Copies[ ] FIELD: No. of Copies[ ] OTHER: No. of CopiesPROJECT DATA:CONTRACT DATA:Name: Roadway Improvements Number:Location: Normandy Blvd, Section B Date:Owner: City of Deltona Drawing No.:Other:Spec. Section:To: (Contractor)You are hereby directed to execute promptly this Field Order which interprets theContract Documents or orders minor changes in the Work without change in ContractSum or Contract Time.If you consider that a change in Contract Sum or Contract Time is required, pleasesubmit your itemized proposal to the Engineer immediately and before proceeding withthis Work. If your proposal is found to be satisfactory and in proper order, this FieldOrder will in that event be superseded by a Change Order.Description (of interpretation or change):Section 00850 00850-1


Attachments (listing of attached documents that support description):1. Contractor Request for Information No. :2. _3. _4. _5. _Bowyer-Singleton & Associates, Inc.By:Project No.Date:END OF SECTIONSection 00850 00850-2


SECTION 00851CONTRACTOR REQUEST FOR INFORMATIONCONTRACTOR REQUEST FOR INFORMATION NO.[ ] OWNER: No. of Copies[ ] ENGINEER: No. of Copies[ ] ARCHITECT: No. of Copies[ ] CONTRACTOR: No. of Copies[ ] FIELD: No. of Copies[ ] OTHER: No. of CopiesPROJECT DATA:CONTRACT DATA:Name: Roadway Improvements Number:Location: Normandy Blvd, Section B Date:Owner: City of Deltona Drawing No.:Other:Spec. Section:QUESTION:BY:DATE:REPLY:BY:DATE:END OF SECTIONSection 00851 00851-1


SECTION 00853APPENDIX 2AIR TEST DATA SHEETOwner. ____________________________________________________ Test # ______________________________Identification of Pipe installation (Job name, location, contract number, etc) ___________________________________Field Test Data: (To be filled in by the Inspector)Date: Specified Maximum Pressure Drop: PsigIdentification of Pipe Material Installed:Pipe Under TestSpecificationField Test Operations DataUpstreamMH sta #DownstreamMH sta #Dia.D(in.)LengthL(ft)TimeRefer toUNI-B-6(min:sec)PressureInitiallyRaisedto (psig)TimeAllowed forPressure toStabilize(min)startTestPressure(psig)StopTestPressure(psig)ElapsedTime(min:sec)Passor FailP or FIf a section fails, the following items should be completed:Identify section(s) that failedLeak (was) (was not) located. Method used:Description of leakage found:Description of corrective action takenFor Test Results after repair refer to Test No: ______________________ Inspector.____________________________This data sheet may be used in conjunction with Recommended Practice UNI-B-6. The Uni-Bell PVC Pipe Association isinterest in evaluation the testing of sewer pipe installation with low=pressure air. The purpose of the "Air Test Data Sheet"is to assist in obtaining information from field testing of sewer pipes as well as to assist the community in evaluation thesewer ' s acceptability.Copies of the above "Air Test Data Sheet" are available free of charge upon request from Uni-Bell. The Uni-Bell PVC PipeAssociation suggest that one copy of the completed sheet be retained for your files and requests that one copy be sent to:Uni-Bell PVC Pipe Association, 2655 Villa Creek Drive, Suite 155, Dallas, TX 75234.DELTONA WATERSection 00853 00853- 1


DELTONA WATER255 ENTERPRISE RD.DELTONA, FL 32725PHONE (386) 575-2060FAX (386)574-0163PRESSURE TEST VERIFICATION SHEETPROJECT NAME:Date of Test: Start Time: End Time:Gauge No.:Starting Pressure:Ending Pressure:Gauge No.:Starting Pressure:Ending Pressure:Gauge No.:Starting Pressure:Ending Pressure:Gauge No.:Starting Pressure:Ending Pressure:Number of Joints in Section to be tested: _________________________________Nominal Diameter of Pipe to be tested: _____________________________Total Water Lost in Test (Gallons): ________________________________Length of Pipe in Section: _______________________________________PASSED:SYSTEM TEST:FAILED:Contractor: . ___________________Representative: ________________Signature: ____________________Project Engineer: _______________Representative: ________________Signature: _____________________Witness #1: _____________________ Signature: ____________________Witness #2: _____________________ Signature: ___________________In order for system to pass pressure test: system must maintain a minimum pressure of 150 psifor no less than 2 hours.Section 00853 00853- 2


DELTONA WATERPRESSURE TEST DATA SHEET(To Be Completed By Field Operations Personnel)Property Address: __________________________________________________________Commercial Property: Yes NoPlease circleProject Name: _____________________________________________________________Legal Description: __________________________________________________________Single Family Residence: YesNoPlease circleLegal Description:Lot _________ Block ______ Unit _______ SubdivisionField Test Operations DataPressure Initially Raised to (psig): _____________________________________________Time Allowed for Pressure to Stabilize (min): ____________________________________Start Test Pressure (psig): ____________________________________________________Elapsed Time (min:sec): _____________________________________________________PassPlease circleIf a section fails, the following items should be completed:Identify sections (s) that failed:________________________________________________Leak (was) (was not) located. Method used: _____________________________________Please circleDescription of leakage found: _________________________________________________Description of corrective action taken: __________________________________________Re-Inspection Required: Yes NoPlease circleDate: ____________________________________________________________________Inspected By: _____________________________________________________________Signature Deltona Water Operation PersonnelFailSection 00853 00853- 3


SECTION 00861WORK DIRECTIVE FORMWORK DIRECTIVE NO.[ ] OWNER: No. of Copies[ ] ENGINEER: No. of Copies[ ] ARCHITECT: No. of Copies[ ] CONTRACTOR: No. of Copies[ ] FIELD: No. of Copies[ ] OTHER: No. of CopiesPROJECT DATA:CONTRACT DATA:Name: Roadway Improvements Number:Location: Normandy Blvd, Section B Date:Owner: City of Deltona Drawing No.:Other:Spec. Section:To: (Contractor):You directed to proceed promptly with the following change(s):Description:Purpose of Work Directive Change:If a claim is made that the above change(s) have affected Contract Price or ContractTime, any claim for a Change Order based thereon will involve one of the followingmethods of determining the effect of the change(s).Method of determining changeIn Contract Price:Method of determining changein Contract Time:[ ] Time and materials [ ] Contractor’s records[ ] Unit prices [ ] Engineer’s records[ ] Cost plus fixed fee [ ] Other[ ] Other.Section 00861 00861-1


Estimated increase (decrease) in Contract Price. Estimated increase (decrease) inContract $Times.If the change involves an increase, the Substantial Completion days;Estimated amount is not to be exceeded Ready for final payment days.without further authorization. If the change involves anincrease, theestimated times are not to beexceeded without furtherauthorization.RECOMMENDED:AUTHORIZED:BY:EngineerBy:City of DeltonaAttachments (Listing of attached documents that support description):1. Contractor Request for Information (RFI) No.2. Request for Proposal for Proposed Change (RFP) No.3. _4. _5. _END OF SECTIONSection 00861 00861-2


CHANGE PROPOSAL SUMMARY NO.SECTION 00863CHANGE PROPOSAL SUMMARY FORM[ ] OWNER: No. of Copies[ ] ENGINEER: No. of Copies[ ] ARCHITECT: No. of Copies[ ] CONTRACTOR: No. of Copies[ ] FIELD: No. of Copies[ ] OTHER: No. of CopiesPROJECT DATA:CONTRACT DATA:Name: Roadway Improvements Number:Location: Normandy Blvd, Section B Date:Owner: City of Deltona Drawing No.:Other:Spec. Section:REFERENCE: Work Directive No. RFP No.Field Order No.OtherDESCRIPTION:PRICING INFORMATION:1. DIRECT LABOR Skill/Trade Manhours Rate Cost1.A Production Labor1.B Supervision[ ] Foreman[ ] Superintendent1.C Field Engineering1.D ExpensesSubtotal (1)Section 00863 00863-1


2. MATERIALS & EQUIPMENTDescription Quantity Unit Price Cost2.A Incorporated in Work2.B Consumed in Performance2.D Direct Costs2.E Bonds, InsuranceSubtotal (2)3. TOTAL LABOR, MATERIALS & EQUIPMENT+ =Subtotal (1) Subtotal (2) TotalEND OF SECTIONSection 00863 00863-2


SECTION 00864REQUEST FOR PROPOSAL FOR PROPOSED CHANGE FORMREQUEST FOR PROPOSAL FOR PROPOSED CHANGE (RFP) NO.[ ] OWNER: No. of Copies[ ] ENGINEER: No. of Copies[ ] ARCHITECT: No. of Copies[ ] CONTRACTOR: No. of Copies[ ] FIELD: No. of Copies[ ] OTHER: No. of CopiesPROJECT DATA:CONTRACT DATA:Name: Roadway Improvements Number:Location: Normandy Blvd, Section B Date:Owner: City of Deltona Drawing No.:Other:Spec. Section:TO:(Contractor)Provide the undersigned a proposal for the following change in the work within seven(7) calendar days after receipt of this request. The written proposal must clearlydelineate the scope of the proposed change in work providing an itemized estimate oftime and all material and labor (by trade), subcontract and overhead costs and fees.Any amount claimed for subcontracts must be similarly supported.Description of change in work:Section 00864 00864-1


Change Order Type: (Deletion) (Addition) (Revision)Constraints of Change:Initiated by:Proposal must be received by:(7 days from date below)Attachments (listing of attached documents that support description)1. Contractor Request for Information (RFI) No.2. _3. _4. _5. _Engineer:Issued by:Project No.Date:END OF SECTIONSection 00864 00864-2


SECTION 01000PROJECT REQUIREMENTS1.01 DESCRIPTIONA. Scope of Work: The Work to be done consists of the furnishing of alllabor, materials, and equipment, and the performance of all Work shownin the project plans and specifications. A summary of the Work ispresented in Section 01010: Summary of Project.B. Work Included:1. The Contractor shall furnish all labor, superintendence, materials,plant power, light, heat, fuel, water, tools, appliances, equipment,supplies, and means of construction necessary for properperformance and completion of the Work. The Contractor shallobtain and pay for all necessary local building permits. TheContractor shall perform and complete the Work in the manner bestcalculated to promote rapid construction consistent with safety oflife and property and to the satisfaction of the Engineer, and in strictaccordance with the Contract Documents. The Contractor shallclean up the Work and maintain it during and after construction,until accepted, and shall do all Work and pay all costs incidentalthereto. He shall repair or restore all structures and property thatmay be damaged or disturbed during performance of the Work.2. The cost of incidental work described in these ProjectRequirements, for which there are no specific Contract Items, shallbe considered as part of the general cost of doing the Work andshall be included in the prices for the various Contract Items. Noadditional payment will be made therefore.3. The Contractor shall provide and maintain such modern tools andequipment as may be necessary, in the opinion of the Engineer, toperform in a satisfactory and acceptable manner all the Workrequired by this Contract. Only equipment of established reputationand proven efficiency shall be used. The Contractor shall be solelyresponsible for the adequacy of his workmanship, materials, andequipment, prior approval of the Engineer notwithstanding.C. Public Utility Installations and Structures:1. Public utility installations and structures shall be understood toinclude all poles, tracks, pipes, wires, conduits, vaults, manholes,and all other appurtenances and facilities pertaining theretowhether owned or controlled by the Owner, other governmentalbodies, or privately owned by individuals, firms, or corporations,Section 01000 01000-1


used to serve the public with transportation, traffic control, gas,electricity, telephone, sewerage, drainage, water, or other public orprivate property which may be affected by the Work shall bedeemed included hereunder.2. The Contract Documents contain data relative to existing publicutility installations and structures above and below the groundsurface. These data are not guaranteed as to their completenessor accuracy and it is the responsibility of the Contractor to make hisown investigations to inform himself fully of the character, condition,and extent of all such installations and structures as may beencountered and as may affect the construction operations.3. The Contractor shall protect all public utility installations andstructures from damage during the Work. Access across anyburied public utility installation or structure shall be made to avoidany damage to these facilities. All required protective devices andconstruction shall be provided by the Contractor at his expense. Allexisting public utilities damaged by the Contractor shall be repairedby the Contractor, at his expense. No separate payment shall bemade for such protection or repairs to public utility installations orstructures.4. Public utility installations or structures owned or controlled by theOwner or other governmental body which are shown on theDrawings to be removed, relocated, replaced, or rebuilt by theContractor shall be considered as a part of the general cost ofdoing the Work and shall be included in the prices bid for thevarious Contract Items. No separate payment shall be madetherefore.5. Where public utility installations of structures owned or controlledby the Owner or other governmental body are encountered duringthe course of the Work, and are not indicated on the Drawings or inthe Specifications, and when, in the opinion of the Engineer,removal, relocation, replacement, or rebuilding is necessary tocomplete the Work under this Contract, such Work shall beaccomplished by the utility having jurisdiction, or such Work may beordered, in writing by the Engineer, for the Contractor toaccomplish. If such work is accomplished by the utility havingjurisdiction it will be carried out expeditiously, and the Contractorshall give full cooperation to permit the utility to complete theremoval, relocation, replacement, or rebuilding as required. If suchwork is accomplished by the Contractor, it will be paid for as extrawork as provided in the Agreement.6. The Contractor shall, at all times in performance of the Work,employ acceptable methods and exercise reasonable care and skillso as to avoid unnecessary delay, injury, damage, or destruction ofpublic utility installations and structures; and shall, at all times in theSection 01000 01000-2


performance of the Work, avoid unnecessary interference with, orinterruption of, public utility services, and shall cooperate fully withthe owners thereof to that end.7. The Contractor shall give written notice to Owner and othergovernmental utility departments and other owners of public utilitiesof the location of his proposed construction operations, at least 48-hours in advance of breaking ground in any area or on any unit ofthe Work.8. The maintenance, repair, removal, relocation, or rebuilding of publicutility installations and structures, when accomplished by theContractor as herein provided, shall be done by methods approvedby the owners of such utilities.1.02 DRAWINGS AND PROJECT MANUALA. Drawings: When obtaining data and information from the Drawings,figures shall be used in preference to scaled dimensions, and large-scaledrawings in preference to small-scale drawings.B. Supplementary Drawings:1. When, in the opinion of the Engineer, it becomes necessary toexplain more fully the Work to be done or to illustrate the Workfurther or to show any changes which may be required, drawingsknown as Supplementary Drawings, with specifications pertainingthereto, will be prepared by the Engineer, and the Contractor will befurnished one (1) complete set of reproducible mylar sepias (24inches by 36 inches) and one (1) reproducible copy of thespecifications.2. The Supplementary Drawings shall be binding upon the Contractorwith the same force as the Contract Drawings. Where suchSupplementary Drawings require either less or more than theestimated quantities of Work, credit to the Owner or compensationtherefore to the Contractor shall be subject to the terms of theAgreement.C. Contractor to Check Drawings and Data:1. The Contractor shall verify all dimensions, quantities, and detailsshown on the Drawings, Supplementary Drawings, schedules,Specifications, or other data received from the Engineer, and shallnotify him of all errors, omissions, conflicts, and discrepanciesfound therein. Failure to discover or correct errors, conflicts, ordiscrepancies shall not relieve the Contractor of full responsibilityfor unsatisfactory work, faulty construction, or improper operationresulting therefrom, nor from rectifying such conditions at his ownexpense. He will not be allowed to take advantage of any errors oromissions, as full instructions will be furnished by the Engineer,Section 01000 01000-3


should such errors or omissions be discovered.2. All schedules are given for the convenience of the Engineer and theContractor and are not guaranteed to be complete. The Contractorshall assume all responsibility or the making of estimates of thesize, kind, and quality of materials and equipment included in workto be done under the Contract.D. Specifications: The Technical Specifications consist of three (3) parts:General, Products, and Execution. The General part of a Specificationcontains General Requirements which govern the Work. The Productsand Execution parts modify and supplement the General Requirements bydetailed requirements for the Work and shall always govern wheneverthere appears to be a conflict.E. Intent:1. All Work called for in the Specifications applicable to this Contract,but not shown on the Drawings in their present form, or vice versa,shall be of like effect as if shown or mentioned in both. Work notspecified in either the Drawings or in the Specifications, butinvolved in carrying out their intent or in the complete and properexecution of the Work, is required and shall be performed by theContractor as though it were specifically delineated or described.2. The apparent silence of the Specifications as to any detail, or theapparent omission from them of a detailed description concerningany work to be done and materials to be furnished, shall beregarded as meaning that only the best general practice is toprevail and that only material and workmanship of the best qualityis to be used, the interpretation of these Specifications shall bemade upon that basis.1.03 MATERIALS AND EQUIPMENTA. Manufacturer:1. All transactions with the manufacturers or subcontractors shall bethrough the Contractor, unless the Contractor shall request and atthe Engineer's option, that the manufacturer or subcontractor dealdirectly with the Engineer. Any such transactions shall not in anyway release the Contractor from his full responsibility under thisContract.2. Any two (2) or more pieces of material or equipment of the samekind, type, or classification, and being used for identical types ofservice, shall be made by the same manufacturer.Section 01000 01000-4


B. Delivery:1. The Contractor shall deliver materials in ample quantities to ensurethe most speedy and uninterrupted progress of the Work so as tocomplete the Work within the allotted time.2. The Contractor shall also coordinate deliveries in order to avoiddelay in, or impediment of, the progress of the work of any relatedContractor.C. Tools and Accessories:1. The Contractor shall, unless otherwise stated in the ContractDocuments, furnish with each type, kind, or size of equipment, one(1) complete set of suitably marked high grade special tools andappliances which may be needed to adjust, operate, maintain, orrepair the equipment. Such tools and appliances shall befurnished in approved painted steel cases, properly labeled andequipped with good grade cylinder locks and duplicate keys.2. Spare parts shall be furnished as specified herein and asrecommended by the manufacturer necessary for the operation ofthe equipment, not including materials required for routinemaintenance.3. Each piece of equipment shall be provided with a substantialnameplate, securely fastened in place and clearly inscribed with themanufacturer's name, year of manufacture, serial number, weight,and principal rate data.D. Service of Manufacturer's Engineer:1. The Contract Prices for equipment shall include the cost offurnishing a competent and experienced engineer orsuperintendent who shall represent the manufacturer and shallassist the Contractor, when required, to install, adjust, test, andplace in operation, the equipment in conformity with the ContractDocuments.2. After the equipment is placed in permanent operation by theOwner, such engineer or superintendent shall make all adjustmentsand tests required by the Engineer to prove that such equipment isin proper and satisfactory operating condition, and shall instructsuch personnel as may be designated by the Owner in the properoperation and maintenance of such equipment.1.04 INSPECTION AND TESTINGSection 01000 01000-5


A. General:B. Costs:1. For tests specified to be made by the Contractor, the testingpersonnel shall make the necessary inspections and tests, and thereports thereof shall be in such form as will facilitate checking todetermine compliance with the Contract Documents. Five (5)copies of the reports shall be submitted, and authoritativecertification thereof must be furnished to the Engineer as aprerequisite for the acceptance of any material or equipment.2. If, in the making of any test of any material or equipment, it isascertained by the Engineer that the material or equipment doesnot comply with the Contract Documents, the Contractor will benotified thereof, and he will be directed to refrain from deliveringsaid material or equipment, or to remove it promptly from the site orfrom the Work and replace it with acceptable material, without costto the Owner.3. Tests of electrical and mechanical equipment and appliances shallbe conducted in accordance with the recognized test codes of theANSI, ASME, or the IEEE, except as may otherwise be statedherein.4. The Contractor shall be fully responsible for the proper operation ofequipment during testing and instruction periods and shall neitherhave nor make any claim for damage which may occur toequipment prior to the time when the Owner formally takes over theoperation thereof.1. All inspection and testing of materials furnished under this Contractwill be provided by the Contractor, unless otherwise expresslyspecified.2. The cost of shop and field tests of equipment and of certain othertests specifically called for in the Contract Documents shall beborne by the Contractor, and such costs shall be deemed to beincluded in the Contract Price.3. Materials and equipment submitted by the Contractor as theequivalent to those specifically named in the Contract may betested by the Owner for compliance. The Contractor shallreimburse the Owner for the expenditures incurred in making suchtests of materials and equipment which are rejected for noncompliance.C. Certificate of Manufacture:Section 01000 01000-6


1. Contractor shall furnish to Engineer authoritative evidence in theform of a certificate of manufacture that the materials to be used inthe Work have been manufactured and tested in conformity with theContract Documents.2. These certificates shall be notarized and shall include copies of theresults of physical tests and chemical analyses, where necessary,that have been made directly on the product or on similar productsof the manufacturer.D. Shop Tests:1. Each piece of equipment for which pressure, duty, capacity, rating,efficiency, performance, function, or special requirements arespecified shall be tested in the shop of the maker in a mannerwhich shall conclusively prove that its characteristics comply fullywith the requirements of the Contract Documents.2. Five (5) copies of the manufacturer's actual test data andinterpreted results thereof, accompanied by a certificate ofauthenticity sworn to by a responsible official of the manufacturingcompany and/or independent laboratory, shall be submitted to theEngineer for approval.3. The cost of shop tests and of furnishing manufacturer's preliminaryand shop test data of operating equipment shall be borne by theContractor.E. Start-up Tests:1. As soon as conditions permit, the Contractor shall furnish all labor,materials, and instruments and shall make start-up tests ofequipment.2. If the start-up tests disclose any equipment furnished under thisContract which does not comply with the requirements of theContract Documents, the Contractor shall, prior to demonstrationtests, make all changes, adjustments, and replacements required.The furnishing Contractor shall assist in the start-up tests asapplicable.F. Demonstration Tests:1. Prior to Contractor's request for a Substantial Completioninspection, all equipment and piping installed under this Contractshall be subjected to demonstration tests as specified or required toprove compliance with the Contract Documents.2. The Contractor shall furnish labor, fuel, energy, water, and all othermaterials, equipment, and instruments necessary for all demonstrationtests, at no additional cost to the Owner. ContractorSection 01000 01000-7


1.05 LINES AND GRADESA. Grade:shall assist in the demonstration tests as applicable.1. All work under this Contract shall be constructed in accordance withthe lines and grades shown on the Drawings, or as given by theEngineer. The full responsibility for keeping alignment and gradeshall rest upon the Contractor.2. The Engineer will establish bench marks and baseline controllingpoints. Reference marks for lines and grades as the Workprogresses will be located by the Contractor to cause as littleinconvenience to the prosecution of the Work as possible. TheContractor shall so place excavation and other materials as tocause no inconvenience in the use of the reference marksprovided. He shall remove any obstructions placed by him contraryto this provision.B. Surveys:1. The Contractor shall furnish and maintain, at his own expense,stakes and other such materials.2. The Contractor shall check such reference marks by such meansas he may deem necessary and, before using them, shall call theEngineer's attention to any inaccuracies.3. The Contractor shall, at his own expense, establish all working orconstruction lines and grades as required from the reference marksset by the Engineer, and shall be solely responsible for theaccuracy thereof. He shall, however, be subject to the check andreview by the Engineer.C. Safeguarding Marks:1. The Contractor shall safeguard all points, stakes, grade marks,monuments, and bench marks made or established on the Work,bear the cost of re-establishing them if disturbed, and bear theentire expense of rectifying work improperly installed due to notmaintaining or protecting or to removing without authorization suchestablished points, stakes, and marks.2. The Contractor shall safeguard all existing and known propertycorners, monuments, and marks adjacent to but not related to theWork and shall bear the cost of re-establishing them if disturbed ordestroyed.END OF SECTIONSection 01000 01000-8


SECTION 01010SUMMARY OF WORK1.01 WORK COVERED BY CONTRACT DOCUMENTSA. This Contract comprises the construction of the City of Deltona RoadwayImprovements on Normandy Boulevard (Section B) as illustrated on theDrawings and specified herein. The work consists of furnishing all labor,equipment and materials for the construction of the facilities consisting of,but not limited to, the following:Reconstruct approximately 0.60 miles of two-lane rural sectionroadway on Normandy Boulevard to three-lane urban section.Construct 2 drainage retention ponds.Construct approximately 2,912’ of 18” to 42” storm drainage pipeand approximately 35 drainage structures.Construct approximately 4,810’ of 4” to 16” water main.Striping, signage, signalization and temporary traffic controldevices.B. Construction Plans:1. Roadway Plans – Bowyer-Singleton & Associates, Inc.1 Key Sheet2 Drainage Map3 Typical Sections4 Project Layout5 General Notes6-12 Roadway Plan & Profile Sheets13 Driveway Details14 Drainage Structures15 Drainage Details16-17 Pond Details18 Soil Survey19-33 Roadway Cross Sections34 Stormwater Pollution Prevention Plan34A Erosion Control Plan35 Traffic Control Plan36-42 Utility Adjustments2. Signing & Pavement Marking Plans – Bowyer-Singleton & AssociatesS-1 Key SheetS-2 General NotesS-3 to S-9 Signing & Pavement Marking Plan Sheets3. Signalization Plans – Bowyer-Singleton & Associates, Inc.Section 01010 01010-1


T-1 Key SheetT-2 General and Pay Item NotesT-3 Signalization Plan SheetsT-4 Internally Illuminated Sign DetailsT-5 Strain Pole ScheduleT-6 Utility Plan Sheet4. Water Main Construction Plans – Tetra Tech, Inc.G-002 General Notes and Drawing IndexG-003 Legend and AbbreviationsG-004 Key MapC-101 to C-108 Plan & ProfilesC-501 to C-504 DetailsC. Project Manual / Construction Specifications1. Project Manual Division 0 – Bidding and Contract Requirements Division 1 – General Requirements Division 2 – Sitework City of Deltona Water Construction Specifications2. City of Deltona Specifications for Water Main Construction3. Florida Department of Transportation (FDOT) StandardSpecifications for Road and Bridge Construction4. FDOT Design Standards for Design, Construction,Maintenance and Utility Operations on the State HighwaySystem (Standard Index)1.02 PROJECT SEQUENCEA. The Contractor shall establish his work sequence based on the use ofcrews to facilitate completion of construction and testing within thespecified Contract Time.END OF SECTIONSection 01010 01010-2


SECTION 01025MEASUREMENT AND PAYMENT1.01 GENERALA. The Contractor shall receive and accept the compensation provided in theProposal and the Contract as full payment for furnishing all materials,labor, tools and equipment, for performing all operations necessary tocomplete the work under the Contract, and also in full payment for all lossor damages arising from the nature of the Work, or from any discrepancybetween the actual quantities of work and quantities herein estimated bythe Engineer, or from the action of the elements or from any unforeseendifficulties which may be encountered during the prosecution of the Workuntil the final acceptance by the Owner.B. The prices stated in the Proposal include all costs and expenses for taxes,labor, equipment, materials, commissions, transportation charges andexpenses, patent fees and royalties, labor for handling materials duringinspection, together with any and all other costs and expenses forperforming and completing the Work as shown on the Drawings andspecified herein. The basis of payment for an item at the unit price shownin the Proposal shall be in accordance with the description of that item inthis Section.C. The Contractor's attention is again called to the fact that the quotations forthe various items of work are intended to establish a total price forcompleting the work in its entirety. Should the Contractor think that thecost for any item of work has not been established by the Bid Form orPayment Items, he shall include the cost for that work in some otherapplicable bid item, so that his proposal for the Project does reflect histotal price for completing the Work in its entirety.1.02 MEASUREMENTA. The quantities for payment under this Contract shall be determined byactual measurement of the completed items, in place, ready for serviceand accepted by the Owner, in accordance with the applicable method ofmeasurement therefore contained herein.1.03 PAYMENT ITEMSA. The following will clarify the work included for bid items in the Pay ItemsSheet:1. Measurements for various items covered underMobilization, such as General Requirements, Bonds andPermits will not be made for payment, and all items shallbe included in the Contract Lump Sum price. PaymentSection 01025 01025-1


for Mobilization shall include all insurance requirementcosts, the cost of all bonds, permits and all administrativecosts associated with acquiring and maintaining thenecessary coverage as described in the ContractDocuments. This item will be paid upon each paymentrequest made by the Contractor. The Contractor shallattach with the pay request invoices to substantiate thatthe Contractor has obtained appropriate insurance andbonds.2. In consideration of the Contractor’s Indemnity Agreementas set out in the Contract Documents, the Ownerspecifically agrees to give the Contractor $1,000 andother good and valuable consideration, receipt of which isacknowledged upon signing of the Agreement.3. Measurement and Payment for items 102-1(Maintenance of Traffic) through 771-11 (PavementMarkings) is itemized in Division 02 of the ProjectManual.END OF SECTIONSection 01025 01025-2


SECTION 01027APPLICATIONS FOR PAYMENT1.01 DESCRIPTIONA. Scope of Work: Submit Applications for Payment to the Engineer inaccordance with schedule established by Conditions of the Contract andAgreement between Owner and Contractor. Contractor shall use theApplication and Certificate for Payment Form included in Section 00844 asthe official pay request form.B. Related Requirements Described Elsewhere:1. Agreement: Section 00500.2. Progress Payments, Retainages, and Final Payment: GeneralConditions: Section 00700 as amended by the SupplementaryConditions: Section 00800.3. Construction Progress Schedules: Section 01310.4. Schedule of Values: Section 01370.5. Color Audio-Video Pre-Construction Record: Section 01390.6. Contract Closeout: Section 01700.7. Project Record Documents: Section 01720.1.02 FORMAT REQUIREDA. Submit applications typed on the form provided in Division 0, Section00844: Application and Certificate for Payment Form, with itemized datatyped on 8-1/2 inch x 11 inch or white paper continuation sheets.B. Provide itemized data on continuation sheets of format, schedules, lineitems, and values specified on the Application and Certificate for PaymentForm. The Contractor shall use the item descriptions and contract valuesincluded in schedule of values, approved and accepted by the Engineer asa basis for preparation of the Application for Payment Form.1.03 PREPARATION OF APPLICATION FOR EACH PROGRESS PAYMENTA. Application Form:1. Fill in required information, including that for Change Ordersexecuted prior to date of submittal of application.Section 01027 01027-1


2. Fill in percent complete for each activity and dollar values to agreewith respective percents.3. Execute certification with signature of a responsible officer ofContractor.B. Continuation Sheets:1. Fill in total list of all scheduled component items of the Work, withitem number and scheduled dollar value for each item.2. Fill in dollar value in each column for each scheduled line itemwhen Work has been performed or products stored. Round offvalues to nearest dollar, or as specified for Schedule of Values.3. List each Change Order executed prior to date of submission, atthe end of the continuation sheets. List by Change Order Number,and description, as for an original component item of the Work.4. To receive approval for payment on component material stored onsite, submit copies of the original invoices with the Application andCertificate for Payment.5. As provided for in the Application and Certificate for Payment Form,the Contractor shall certify, for each current pay request, that allprevious progress payments received from the Owner, under thisContract, have been applied by the Contractor to discharge in full,all obligations of the Contractor in connection with Work covered byprior Applications for Payment, and all materials and equipmentincorporated into the Work are free and clear of all liens, claims,security interest, and encumbrances. Contractor shall attach toeach Application and Certificate for Payment like affidavits by allSubcontractors.1.04 SUBSTANTIATING DATA FOR PROGRESS PAYMENTSA. Contractor shall submit suitable information, with a cover letter identifying:1. Project.2. Application number and date.3. Detailed list of enclosures.4. For stored products:a. Item number and identification as shown on application.b. Description of specific material.Section 01027 01027-2


B. Submit one (1) copy of data and cover letter for each copy of application.C. The Contractor is to maintain an updated set of drawings to be used asrecord drawings in accordance with Section 01720: Project RecordDocuments. As a prerequisite for monthly progress payments, theContractor is to exhibit the updated record drawings for review by theOwner and the Engineer.D. Each monthly application for payment shall incorporate the corresponding"monthly progress status report" and updated construction schedule,prepared in accordance with the requirements of Section 01310:Construction Progress Schedules.E. As a prerequisite for payment, Contractor shall submit a duly executedletter from surety consenting to payment due and progress to date.F. Provide pre-construction video in accordance with Section 01390: ColorAudio-Video Pre-Construction Record.1.05 PREPARATION OF APPLICATION FOR FINAL PAYMENTA. Fill in application form as specified for progress payments. Provideinformation as required by the General Conditions and Section 01700:Contract Closeout.B. Furnish evidence of completed operations and insurance in accordancewith the General Conditions.C. Provide Contractor's Final Release of Lien (Section 00849) and otherclose-out submittals as required by the General Conditions.1.06 SUBMITTAL PROCEDUREA. Submit Applications for Payment to the Engineer between the first (1 st )and the tenth (10 th )day after the end of each calendar month for whichpayment is requested as stipulated in the Agreement. Review thepercents complete with the Engineer and resolve any conflicts ordiscrepancies.B. Number of copies for each Application for Payment: Five (5) copies plusadditional copies for Contractor's needs.C. When the Engineer finds the Application and Certificate for Payment Formis properly completed and correct, he will execute the Certificate forPayment and transmit the forms to the Owner, with a copy to theContractor.END OF SECTIONSection 01027 01027-3


SECTION 01041PROJECT COORDINATION1.01 PIPE LOCATIONSA. Storm drain lines shall be located substantially as indicated on theDrawings, but the Engineer reserves the right to make such modificationsin locations as may be found desirable to avoid interference or for otherreasons.1.02 OPEN EXCAVATIONSA. All open excavations shall be adequately safeguarded by providingtemporary barricades, caution signs, lights, and other means to preventaccidents to persons, and damage to property. The Contractor shall, athis own expense, provide suitable and safe bridges and other crossingsfor accommodating travel by workmen.1.03 TEST PITSA. Test pits for the purpose of locating underground pipelines in advance ofthe construction shall be excavated and backfilled by the Contractor. Testpits shall be backfilled immediately after their purpose has been satisfiedand maintained in a manner satisfactory to the Engineer. The costs forsuch test pits shall be borne by the Contractor.1.04 CARE AND PROTECTION OF PROPERTYA. The Contractor shall be responsible for the preservation of all public andprivate property, and shall use every precaution necessary to preventdamage thereto. If any direct or indirect damage is done to public orprivate property by or on account of any act, omission, neglect, ormisconduct in the execution of the Work on the part of the Contractor,such property shall be restored by the Contractor, at his expense, to acondition similar or equal to that existing before the damage was done, orhe shall make good the damage in other manner acceptable to theEngineer.1.05 COOPERATION WITHIN THIS CONTRACTA. Deltona Water: The Contractor shall, prior to interrupting a utility service(water or sewer) for the purpose of making cut-ins to the existing lines orfor any other purposes, contact the resident and make arrangements forthe interruption which will be satisfactory to the resident. Contractor willalso notify Deltona Water Department of any service interruptions.Section 01041 01041-1


B. Electric, Phone and Cable TV services: The Contractor shall, prior tointerrupting a utility service for any reason, contact the resident and makearrangements for the interruption which will be satisfactory to the resident.Contractor will coordinate with Bellsouth Telecommunications, Inc., FloridaPower & Light, Florida Public Utilities, Progress-Energy, Deltona Water,Century Link, AT&T, and Bright House Cable Network for any necessaryservice interruptions.1.06 COOPERATION WITH OTHER CONTRACTSA. This Contract may require a portion of the work to be connected to workdone under other contracts or work performed by the Owner. It will benecessary for the Contractor to plan his work and cooperate with otherContractors or Owner insofar as possible to prevent any interference anddelay.END OF SECTIONSection 01041 01041-2


SECTION 01050FIELD ENGINEERING1.01 DESCRIPTIONA. Scope of Work: Provide and pay for field engineering service for Project.1. Survey work required in execution of Work.2. Civil, structural, or other professional engineering services specifiedor required to execute Contractor's construction methods.3. The method of field staking for the construction of the Work shall beat the option of the Contractor. The Owner has provided theengineering survey necessary to establish reference points which inhis judgement are necessary to enable the Contractor to proceedwith his work.4. The accuracy of any method of staking shall be the responsibility ofthe Contractor. All engineering for vertical and horizontal controlshall be the responsibility of the Contractor.5. The Contractor shall be held responsible for the preservation of allstakes and marks. If any stakes or marks are carelessly or willfullydisturbed by the Contractor, the Contractor shall not proceed withany work until he has established such points, marks, lines, andelevations as may be necessary for the prosecution of the Work.6. The Contractor shall retain the services of a registered landsurveyor licensed in the State of Florida to identify existing controlpoints and maintain a survey during construction.B. Related Requirements Described Elsewhere:1. Conditions of the Contract.2. Summary of Project: Section 01010.3. Project Record Documents: Section 01720.1.02 QUALIFICATIONS OF SURVEYOR OR ENGINEERA. Qualified engineer or registered land surveyor, acceptable to the Ownerand the Engineer.B. Registered professional engineer of the discipline required for the specificservice on the Project, currently licensed in the State of Florida.Section 01050 01050-1


1.03 SURVEY REFERENCE POINTSA. Locate and protect control points prior to starting site work, and preserveall permanent reference points during construction.1. Make no changes or relocations without prior written notice to theEngineer.2. Report to the Engineer when any reference point is lost ordestroyed, or requires relocation because of necessary changes ingrades or locations.3. Require surveyor to replace Project control points which may belost or destroyed at no additional cost to the Owner. Establishreplacement based on original survey control.1.04 PROJECT SURVEY REQUIREMENTSA. Establish a minimum of two (2) permanent bench marks on site,referenced to data established by survey control points.1. Record locations, with horizontal and vertical data, on ProjectRecord Documents.B. Establish lines and levels, locate and lay out, by instrumentation andsimilar appropriate means:1. Site improvements:a. Stakes for grading, fill, and topsoil replacement.b. Utility slopes and invert elevations.2. Batter boards for structure.3. Building foundation, column locations, and floor levels.4. Controlling lines and levels required for mechanical and electricaltrades.C. From time to time, verify layouts by same methods.1.05 RECORDSA. Maintain a complete, accurate log of all control and survey work as itprogresses.B. At the end of the project, submit a certified site survey at 1 inch equals 20Section 01050 01050-2


feet scale on reproducible tracing sheets 24 inches by 36 inches,indicating the new building corners and location of all new structures.C. At the end of the project, submit a certified survey at the same scale asthe Engineer's line drawings indicating elevations and stationing at 100-foot pipe increments and at all valve and fitting locations.1.06 SUBMITTALSA. Submit name and address of surveyor and professional engineer to theEngineer.B. On request of the Engineer, submit documentation to verify accuracy offield engineering work.C. Submit certificate signed by a registered engineer or surveyor certifyingthat elevations and locations of improvements are in conformance with theContract Documents, or if not in conformance, certify as to variances fromthe Contract Documents.D. Submit drawings showing locations of all structures constructed. Thisdrawing shall be included with the Project Record Documents.END OF SECTIONSection 01050 01050-3


SECTION 01065PERMITS AND FEES1.01 DESCRIPTIONA. Scope of Work:1. The Contractor shall obtain and pay for federal, state and localpermits and licenses related to his work, including but not limited toVolusia County Right-of-Way Use Permit, as provided for in theGeneral and Supplementary Conditions except as otherwiseprovided herein.1.02 PERMITS BY OWNERA. The Owner, prior to the advertisement of the Project, has applied for orobtained permits listed in Table 01065-A.TABLE 01065-APERMITS OBTAINED BY OWNERConstruction PermitFDEP General Permit for Construction of anExtension to a Public Drinking Water DistributionSystemCity of Deltona Right-of-Way PermitSJRWMD ERP PermitSJRWMD NPDES Permit and NOIPermitNo.N/AIssueDateN/AB. The Owner will waive the required fee for issuance of the City of Deltonabuilding permit. This does not relieve the Contractor from any otherobligations required by the City of Deltona for obtaining the building permitand any other permits required by the Contractor for this project, except asotherwise provided herein.END OF SECTIONSection 01065 01065-1


SECTION 01070ABBREVIATIONS AND SYMBOLS1.01 STANDARDS AND ABBREVIATIONSA. Referenced Standards: Any reference to published specifications orstandards of any organization or association shall comply with therequirements of the specification or standard which is current on the dateof Advertisement for Bids. In case of a conflict between the referencedspecifications or standards, the one having the more stringentrequirements shall govern.In case of conflict between the referenced specifications or standards andthe Contract Documents, the Contract Documents shall govern.B. Abbreviations:AAAAAAABCAAMAAASHOABAABMAABPAACIACPAAEICAFBMAAGAAGCAGMAAHAAIAIAAIAAIEEAIMAAISCAISIAITCAMCAANSIAPAAPIAPWAAREASection 01070 01070-1Aluminum AssociationAmerican Arbitration AssociationAssociated Air Balance CouncilArchitectural Aluminum Manufacturers AssociationThe American Association of State Highway OfficialsAmerican Bar AssociationAmerican Boiler Manufacturers AssociationAcoustical and Board Products AssociationAmerican Concrete InstituteAmerican Concrete Pipe AssociationAssociation of Edison Illuminating CompaniesAnti-Friction Bearing Manufacturers AssociationAmerican Gas AssociationAssociated General Contractors of AmericaAmerican Gear Manufacturers AssociationAmerican Hardboard AssociationThe Asphalt InstituteAmerican Institute of ArchitectsAmerican Insurance AssociationAmerican Institute of Electrical Engineers (Now IEEE)Acoustical and Insulating Materials AssociationAmerican Institute of Steel ConstructionAmerican Iron and Steel InstituteAmerican Institute of Timber ConstructionAir Moving and Condition AssociationAmerican National Standard InstituteAmerican Plywood AssociationAmerican Petroleum InstituteAmerican Public Works AssociationAmerican Railway Engineering Association


ARI American Refrigeration InstituteASA American Standards Association (Now ANSI)ASAHC American Society of Architectural Hardware ConsultantsASCE American Society of Civil EngineersASHRAE American Society of Heating, Refrigerating and AirConditioning EngineersASME American Society of Mechanical EngineersASSCBC American Standard Safety Code for Building ConstructionASSHTO American Association of State Highway TransportationOfficialsASTM American Society for Testing and MaterialsAWG American Wire GaugeAWI Architectural Woodwork InstituteAWPA American Wood Preservers AssociationAWPB American Wood Preservers BureauAWPI American Wood Preservers InstituteAWS American Welding SocietyAWWA American Water Works AssociationBHMA Builders Hardware Manufacturers AssociationBIA Brick Institute of America (formerly SCPI)CDA Copper Development AssociationCFS Cubic Feet Per SecondCMAA Crane Manufacturers Association of AmericaCRSI Concrete Reinforcing Steel InstituteCS Commercial StandardDHI Door and Hardware InstituteDIPRA Ductile Iron Pipe Research AssociationDOT Spec Standard Specification for Road and Bridge ConstructionFlorida Department of Transportation, 1982E/A Engineer and/or ArchitectEDA Economic Development AssociationEEI Edison Electric InstituteEPA Environmental Protection AgencyFCI Fluid Control InstituteFDEP Florida Department of Environmental ProtectionFDOT Florida Department of TransportationFed Spec Federal SpecificationFPS Feet Per SecondFS Federal StandardsGPM Gallons Per MinuteHMI Hoist Manufacturers InstituteHP HorsepowerHSBII Hartford Steam Boiler Inspection and Insurance Co.IDInside DiameterIEEE Institute of Electrical and Electronic EngineersIFI Industrial Fasteners InstituteIPCEA Insulated Power Cable Engineers AssociationIPS Iron Pipe SizeMGD Million Gallons Per DaySection 01070 01070-2


MHIMMANBFUNBHANBSNCSANCSPANECNECANEMANFPANLANPCNPTNSCNSFODOSHAPCAPCIPSPSIPSIAPSIGRASRPMSAESDISJISJRWMDSMACNASSISSPCSSPCSTATDHTHUBCULUSASIWASMaterials Handling InstituteMonorail Manufacturers AssociationNational Board of Fire UnderwritersNational Builders' Hardware AssociationNational Bureau of StandardsNational Crushed Stone AssociationNational Corrugated Steel Pipe AssociationNational Electrical CodeNational Electrical Contractors' AssociationNational Electrical Manufacturers' AssociationNational Fire Protection AssociationNational Lime AssociationNational Plumbing CodeNational Pipe ThreadsNational Safety CouncilNational Sanitation FoundationOutside DiameterU.S. Department of Labor, Occupational Safety and HealthActPortland Cement AssociationPrestressed Concrete InstituteUnited States Products StandardsPounds per Square InchPounds per Square Inch AbsolutePounds per Square Inch GaugeReturn Activated SludgeRevolutions Per MinuteSociety of Automotive EngineersSteel Decks InstituteSteel Joists InstituteSt. Johns River Water Management DistrictSheet Metal and Air Conditioning Contractors' NationalAssociationScaffolding and Shoring InstituteSteel Structures Painting CouncilStructural Steel Painting CouncilStation (100 feet)Total Dynamic HeadTotal HeadUniform Building CodeUnderwriter's Laboratories, Inc.United States of America Standards InstituteWaste Activated SludgeC. Additional abbreviations and symbols are shown on the Drawings.END OF SECTIONSection 01070 01070-3


SECTION 01200PROJECT MEETINGS1.01 DESCRIPTIONA. Scope of Work:1. The Contractor shall cooperate and coordinate with the Engineer toschedule and administer the pre-construction meeting, periodicprogress meetings, and specifically called meetings throughout theprogress of the Work. The Contractor shall:a. Prepare agenda for meetings.b. Make physical arrangements for meetings.c. Preside at meetings.d. Take and distribute meeting minutes.2. Representatives of Contractor, subcontractors, and suppliersattending meetings shall be qualified and authorized to act onbehalf of the entity each represents.3. The Owner shall attend meetings to ascertain that the Work isexpedited consistent with Contract Documents and constructionschedules.4. The Contractor shall record the pre-construction meeting and eachprogress meeting in its entirety, and shall provide the Engineer witha regular cassette copy of such recording, having good quality andclarity, and a typed transcript of the minutes of each meeting. Acopy of the minutes of each progress meeting shall be availablefive business days after the meeting.B. Related Requirements Described Elsewhere:1. Construction Progress Schedules: Section 01310.2. Shop Drawings, Working Drawings, and Samples: Section 01340.3. Project Record Documents: Section 01720.1.02 PRE-CONSTRUCTION MEETINGA. Engineer will schedule a pre construction meeting no later than five (5)business days after date of Notice to Proceed. The meeting shall beSection 01200 01200-1


scheduled at the convenience of all parties.B. Location: A local site, convenient for all parties, designated by theEngineer.C. Attendance:1. Owner's representative.2. Engineer and his professional consultants.3. Contractor and his superintendent.4. Major subcontractors.5. Representatives of major suppliers and manufacturers asappropriate.6. Governmental representatives as appropriate.7. Others as requested by the Contractor, Owner, and Engineer.D. The Engineer shall preside at the pre-construction meeting. TheContractor shall provide for keeping minutes and distribution of minutes tothe Owner, Engineer and others. The purpose of the pre-constructionmeeting is to designate responsible personnel and establish a workingrelationship. Matters requiring coordination will be discussed andprocedures for handling such matters established.E. The suggested agenda for the pre-construction meeting would include thefollowing:1. Distribution and discussion of:a. List of major subcontractors and suppliers.b. Projected schedules.c. Schedule of Values.2. Critical work sequencing: Relationships and coordination with othercontracts and/or work.3. Major equipment deliveries and priorities.4. Project coordination: Designation and responsible personnel.5. Procedures and processing of:Section 01200 01200-2


a. Field decisions.b. Proposal requests.c. Request for Information.d. Submittals.e. Change Orders.f. Applications for Payment.6. Submittal of Shop Drawings, project data and samples.7. Adequacy of distribution of Contract Documents.8. Procedures for maintaining Record Documents9. Use of premises:a. Office, work, and storage areas.b. Owner's requirements.c. Access and traffic control.10. Construction facilities, controls, and construction aids.11. Temporary utilities.12. Safety and first aid procedures.13. Check of required Bond and Insurance certifications.14. Completion time for contract and liquidated damages.15. Request for extension of Contract Time.16. Procedures for periodic monthly (or whatever interval is deemedappropriate or necessary, however, a minimum of monthlymeetings will be required) progress meetings, for all involved.17. Security procedures.18. Procedures for making partial payments.19. Guarantees on completed work.20. Equipment to be used.Section 01200 01200-3


21. Project layout and staking of work.22. Project inspection.23. Labor requirements.24. Laboratory testing of material requirements.25. Provisions for material stored on site and monthly inventory ofmaterials stored.26. Requirements of other organizations such as utilities, railroads,highway departments, building departments.27. Rights-of-way and easements.28. Housekeeping procedures.29. Liquidated damages.30. Posting of signs and installation of Project Sign.31. Pay request submittal dates.32. Equal opportunity requirements.1.03 PROGRESS MEETINGSA. The Engineer shall schedule regular periodic meetings. The progressmeetings will be held a minimum of once every thirty (30) days and atother times as required by the progress of the Work. The first meetingshall be held within thirty (30) days after the pre-construction meeting orthirty (30) days or less after the date of Notice to Proceed.B. Hold called meetings as required by progress of the Work.C. Location of the meetings: A local site convenient for all parties.D. Attendance:1. Engineer and his professional Subconsultants as needed.2. Contractor and his Superintendent.3. Owner's representatives.4. Subcontractors (active on the site, as appropriate to the agenda).Section 01200 01200-4


5. Others as appropriate to the agenda (suppliers, manufacturers,other subcontractors, etc.).E. The Contractor shall preside at the meetings and provide for keepingminutes and distribution of the minutes to the Owner, Engineer, andothers. The purpose of the meetings will be to review the progress of theWork.F. The suggested agenda for the progress meetings will include but not belimited to the following:1. Review approval of minutes of previous meeting.2. Review of Work progress since previous meeting and Workscheduled (3-week look ahead schedule).3. Field observations, problems, conflicts.4. Problems which impede construction schedule.5. Review of off-site fabrication, delivery schedules.6. Corrective measures and procedures to regain projected schedule.7. Status of approved Construction Schedule and revisions to theConstruction Schedule as appropriate.8. Progress schedule during succeeding work period.9. Coordination of schedules.10. Review status of submittals and submittal schedule, expedite asrequired.11. Maintenance of quality standards.12. Pending changes and substitutions.13. Shop drawing problems.14. Review proposed changes for:a. Effect on Construction Schedule and on completion date.b. Effect on other contracts of the Project.15. Critical/long lead items.16. Other business.Section 01200 01200-5


G. The Contractor is to attend progress meetings and is to study previousmeeting minutes and current agenda items, and be prepared to discusspertinent topics and provide specific information including but not limitedto:1. Status of all submittals and what specifically is being done toexpedite them.2. Status of all activities behind schedule and what specifically will bedone to regain the schedule.3. Status of all material deliveries, latest contact with equipmentmanufacturer, and specific actions taken to expedite materials.4. Status of open deficiencies and what is being done to correct thesame.H. The Contractor is to provide a current submittal log at each progressmeeting in accordance with Section 01340: Shop Drawings, WorkingDrawings, and Samples.END OF SECTIONSection 01200 01200-6


SECTION 01310CONSTRUCTION PROGRESS SCHEDULES1.01 DESCRIPTIONA. Scope of Work:1. Promptly after award of the Contract, prepare and submit to theEngineer estimated construction progress schedules demonstratingcomplete fulfillment of all Contract requirements utilizing a CriticalPath Method (hereinafter referred to as CPM) in planning,coordinating, and performing the Work under this Contract(including all activities of subcontractors, equipment vendors, andsuppliers). The principles and definition of CPM terms used hereinshall be as set forth in the Associated General Contractors ofAmerica (AGC) publication, Construction Planning & SchedulingManual, Copyright 1984, but the provisions of this Specificationshall govern the planning, coordinating, and performance of theWork.2. Submit revised progress schedules on a monthly basis. No partialpayments shall be approved until there is an approved constructionprogress schedule on hand.B. Related Requirements Described Elsewhere:1.02 QUALIFICATIONS1. Conditions of the Contract.2. Summary of Project: Section 01010.3. Project Meetings: Section 01200.4. Applications for Payment: Section 010275. Shop Drawings, Working Drawings, and Samples: Section 01340.6. Schedule of Values: Section 01370.A. A statement of computerized CPM capability shall be submitted in writingprior to the award of the Contract and shall verify that either Contractor'sorganization has in-house capability to use the CPM technique or thatContractor will employ a CPM consultant who is so qualified.B. In-house capability shall be verified by description of construction projectsto which Contractor or Contractor's consultant has successfully appliedSection 01310 01310-1


computerized CPM and shall include at least two (2) projects valued atleast half the expected value of this project.1.03 FORM OF SCHEDULESA. Prepare schedules in the form of a horizontal bar chart.1. Provide a separate horizontal bar for each trade or operation withineach structure or item.2. Horizontal time scale:a. Show starting and completion dates for each activity in termsof the number of days after Notice to Proceed. Allcompletion dates shown shall be within the period specifiedfor contract completion.b. Identify the first work day of each month.3. Scale and Spacing: Sufficient to allow space for notations andfuture revisions.4. Maximum Sheet Size: 24 inches by 36 inches.B. Format of Listings: The chronological order of the start of each item ofwork for each structure.C. Identification of Listings: By major specification section numbers asapplicable and by structure.D. Construction Progress Schedules shall be computer generated usingsoftware equal to Primavera Project Planner for Windows by PrimaveraSystems, Inc., Bala Cynwyd, P.A., or approved equal.1.04 CONTENT OF SCHEDULESA. Construction Progress Schedule:1. Show the complete sequence of construction by activity and bystructure.2. Show the dates for the beginning and completion of each majorelement of construction in no more than a two (2) week incrementscale. Specifically list, but do not limit to:a. Shop Drawing Schedule.b. Maintenance of Traffic.Section 01310 01310-2


c. Clearing & Earthwork.d. Site utilities / relocation.e. Storm Drainage workf. Curb, Sidewalks, Walls.g. Subgrade, base, pavement.h. Signalization.i. Signage, striping.j. Grassing.k. Project completion / closeout / testing.3. Show projected percentage of completion for each item, as of thefirst day of each month.4. Show projected dollar cash flow requirements for each month ofconstruction and for each activity as indicated by the approvedSchedule of Values.B. Submittals for construction progress schedules shall be in accordancewith Section 01340: Shop Drawings, Work Drawings, and Samples.Indicate on the schedule the following:1. The dates for Contractor's submittals.2. The dates submittals will be required for Owner-furnished products,if applicable.3. The dates approved submittals will be required from the Engineer.C. A typewritten list of all long lead items (equipment, materials, etc.).D. To the extent that the progress schedule or any revised progress scheduleshows anything not jointly agreed upon or fails to show anything jointlyagreed upon, it shall not be deemed to have been approved by theEngineer. Failure to include any element of work required for theperformance of this Contract shall not excuse the Contractor fromcompleting all work required within any applicable completion date,notwithstanding the Engineer's approval of the progress schedule.E. Scheduling Constraints: The work within Owner's property must becompleted within the maximum number of days start to finish, as indicatedin the Contract. Additionally, work must proceed on a continuous basis,Section 01310 01310-3


without stoppages, except for nights and weekends. There shall be nolapses between phases of construction.1.05 PROGRESS REVISIONSA. Indicate progress of each activity to date of submission.B. Show changes occurring since previous submission of schedule:1. Major changes in scope.2. Activities modified since previous submission.3. Revised projections of progress and completion.4. Other identifiable changes.C. Provide a narrative report as needed to define:1. Problem areas, anticipated delays, and the impact on the schedule.2. Corrective action recommended, and its effect.3. The effect of changes on schedules of other prime contractors.D. If the Work falls behind the critical path schedule by two (2) weeks ormore, the Contractor shall prepare a recovery schedule.1.06 SUBMISSIONSA. Submittal Requirements.1. Logic network and/or time-phased bar chart, computer generated.2. Computerized network analysis:a. Sort by early startb. Sort by floatc. Sort by predecessor/successor3. Narrative description of the logic and reasoning of the schedule.B. Time of Submittals.Within ten (10) working days after Notice to Proceed, Contractor shallsubmit a network diagram describing the activities to be accomplished inthe project and their dependency relationships, (predecessor/successor)Section 01310 01310-4


as well as a tabulated schedule as herein defined. The total length of timeindicated on the initial CPM schedule shall equal the exact number of daysin the Contract Time as defined in Section 00500: Agreement. Theschedule produced and submitted shall also indicate calendar dates,including project starting and completion dates, based on the ContractCommencement and completion dates indicated in the Notice to Proceed.The Engineer will complete the review of the complete schedule withinfifteen (15) working days after receipt. During the review process, theEngineer may meet with a representative of Contractor to review theproposed plan and schedule to discuss any clarifications that may benecessary.C. Within ten (10) working days after the conclusion of the Engineer's reviewperiod, Contractor shall revise the network diagram as required andresubmit the network diagram and a tabulated schedule producedtherefrom. The revised network diagram and tabulated schedule shall bereviewed and accepted or rejected by the Engineer within fifteen (15)working days after receipt. The network diagram and tabulated schedule,when accepted by the Engineer, shall constitute the project work scheduleunless a revised schedule is required due to substantial changes in theWork, a change in Contract Time or a recovery schedule is required andrequested.D. Acceptance. The finalized schedule will be acceptable to the Engineerwhen, in the opinion of the Engineer, it demonstrates an orderlyprogression of the Work to completion in accordance with the ContractDocuments. Such acceptance will neither impose on the Engineerresponsibility for the progress or scheduling of the Work nor relieveContractor from full responsibility therefore. The finalized schedule ofshop drawing submittals will be acceptable to the Engineer when, in theopinion of the Engineer, it demonstrates a workable arrangement forprocessing the submittals in accordance with the requirements. Thefinalized Schedule of Values (lump sum price breakdown), as applicable,will be acceptable to the Engineer as to form and content when, in theopinion of the Engineer, it demonstrates a substantial basis for equitablydistributing the Contract Price. When the network diagram and tabulatedschedule have been accepted, the Contractor shall submit to the Engineersix (6) copies of the time-scaled network diagram, six (6) copies of acomputerized tabulated schedule in which the activities have beensequenced by numbers, six (6) copies of a computerized tabulatedschedule in which the activities have been sequenced by early startingdate, and six (6) copies of a computerized, tabulated schedule in whichactivities have been sequenced by total float, and six (6) copies sorted bypredecessor/successor.E. Revised Work Schedules. Contractor, if requested by the Engineer, shallprovide a revised work schedule if, at any time, the Engineer considers thecompletion date to be in jeopardy because of "activities behind schedule."The revised work schedule shall include a new diagram and tabulatedSection 01310 01310-5


schedule conforming to the requirements of Paragraph 1.09 herein,designed to show how Contractor intends to accomplish the Work to meetthe completion date. The form and method employed by Contractor shallbe the same as for the original work schedule. No payment will be made ifactivities fall more than two (2) weeks behind schedule and a revised workschedule is not furnished.F. Schedule Revisions. The Engineer may require Contractor to modify anyportions of the work schedule that become infeasible because of "activitiesbehind schedule" or for any other valid reason. An activity that cannot becompleted by its original latest completion date shall be deemed to bebehind schedule. No change may be made to the sequence, duration, orrelationships of any activity without approval of the Engineer.1.07 DISTRIBUTIONA. Distribute copies of the reviewed schedules to:1. Engineer.2. Jobsite file.3. Subcontractors.4. Other concerned parties.5. Owner (two copies).B. Instruct recipients to report promptly to the Contractor, in writing, anyproblems anticipated by the projections shown in the schedules.1.08 CHANGE ORDERSA. Upon approval of a change order, the approved changes shall be reflectedin the next scheduled revision or update submittal of the constructionprogress schedule by the Contractor.1.09 CPM STANDARDSA. CPM, as required by this Section, shall be interpreted to be generally asoutlined in the Associated General Contractor's (AGC) publication,Construction Planning & Scheduling Manual, Copyright 1984.B. Work schedules shall include a graphic network and computerized,tabulated schedules as described below. To be acceptable the schedulemust demonstrate the following:1. A logical succession of work from start to finish.Section 01310 01310-6


2. Definition of each activity. Activities shall be identified by majorspecification section numbers, as applicable, and by majorstructure.3. A logical flow of work crews/equipment (crews are to be defined bymanpower category and man-hours; equipment by type and hours).4. Show all work activities and interfaces including submittals as wellas major material and equipment deliveries.C. Networks.1. The CPM network, or diagram, shall be in the form of a time-scaleddiagram of the customary activity-on-type and may be divided into anumber of separate pages with suitable notation relating theinterface points among the pages. Notation on each activity lineshall include a brief work description and a duration, as describedin Paragraph 1.09, D. herein.2. All construction activities and procurement shall be indicted in atime-scaled format, and a calendar shall be shown on all sheetsalong the entire sheet length. Each activity arrow shall be plottedso the beginning and completion dates of said activity can bedetermined graphically by comparison with the calendar scale. Allactivities shall be shown using the symbols that clearly distinguishbetween critical path activities, non-critical path activities, and floatfor each non-critical activity. All non-critical path activities shallshow estimated performances time and float time in scaled form.D. The duration indicated for each activity shall be in calendar days and shallrepresent the single best time considering the scope of the work andresources planned for the activity including time for inclement weather.Except for certain non-labor activities, such as curing concrete ordelivering materials, activity durations shall not exceed fourteen (14) daysnor be less than one (1) day unless otherwise accepted by the Engineer.E. Tabulated Schedules. The initial schedule shall include the followingminimum data for each activity.1. Activity Beginning and Ending Numbers (i-j numbers) (singleactivity numbers may be used).2. Duration.3. Activity Description.4. Early Start Date (Calendar Dated).5. Late Start Date (Calendar Dated).Section 01310 01310-7


6. Early Finish Date (Calendar Dated).7. Late Finish Date (Calendar Dated).8. Identified Critical Path.9. Total Float (Note: No activity may show more than 20 days float).10. Cost of Activity.11. Equipment Hours, by type; Man-Power Hours, by crew or trade.F. Project Information. Each tabulation shall be prefaced with the followingsummary data.1. Project Name.2. Contractor.3. Type of Tabulation (Initial or Updated).4. Project Duration.5. Project Scheduled Completion Date.6. Effective or Starting Date of the Schedule.7. New Project Completion Date and Project Status (if an updated orrevised schedule).8. Actual Start Date and Actual Finish Date (for all updatedschedules.)1.10 SCHEDULE MONITORINGA. At not less than monthly intervals or when specifically requested byEngineer, Contractor shall submit to the Engineer a computer printout ofan updated schedule for those activities that remain to be completed.Typically, the updated schedule will be submitted with the application forpayment as specified below.B. The updated schedule shall be submitted in the form, sequence, andnumber of copies requested for the initial schedule.1.11 PROGRESS MEETINGSFor the monthly progress meeting, Contractor shall submit a revised CPMschedule and a three-week look-ahead schedule, showing all activitiesSection 01310 01310-8


completed, in progress, uncompleted, or scheduled to be worked during theweeks. The three weeks include the current week plus the next two weeks. Allactivities shall be from the approved CPM and must be as shown on the CPMunless behind or ahead of schedule. One copy of the revised CPM scheduleshall be submitted with each copy of that month's application for payment, six (6)copies minimum.END OF SECTIONSection 01310 01310-9


SECTION 01340SHOP DRAWINGS, WORKING DRAWINGS, AND SAMPLES1.01 DESCRIPTIONA. Scope of Work:1. The Contractor shall submit to the Engineer for review andapproval, such Shop Drawings, Test Reports, and Product Data onmaterials and equipment (hereinafter in this Section called Data),and material samples (hereinafter in this Section called Samples)as are required for the proper control of work, including but notlimited to those Shop Drawings, Data, and Samples for materialsand equipment specified elsewhere in the Specifications and in theDrawings.2. Within fourteen (14) calendar days after the Notice to Proceed, theContractor shall submit to the Engineer a complete list ofpreliminary Data on items for which Shop Drawings are to besubmitted. Included in this list shall be the names of all proposedmanufacturers furnishing specified items. Review of this list by theEngineer shall in no way expressed or implied relieve theContractor from submitting complete Shop Drawings and providingmaterials, equipment, etc., fully in accordance with the ContractDocuments. This procedure is required in order to expedite finalreview of Shop Drawings.3. The Contractor is to maintain an accurate updated submittal logand will bring this log to each scheduled progress meeting with theOwner and the Engineer. This log should include the followingitems:a. Submittal description and number assigned.b. Date to Engineer.c. Date returned to Contractor (from Engineer).d. Status of submittal (Approved, Approved as Noted, Amendand Resubmit, and Rejected).e. Date of resubmittal and return (as applicable).f. Date material release (for fabrication).g. Projected date of fabrication.Section 01340 01340-1


h. Projected date of delivery to site.i. Status of O&M manuals submittal.j. Specification Section.k. Drawings sheet number.B. Related Requirements Described Elsewhere:1. General Conditions: Section 00700.2. Shop Drawing Submittal Form: Section 00847.3. Construction Progress Schedules: Section 01310.4. Material and Equipment: Section 01600.5. Project Record Documents: Section 01720.1.02 CONTRACTOR'S RESPONSIBILITYA. It is the responsibility of the Contractor to check all drawings, data andsamples prepared before submitting them to the Engineer for review.Each and every copy of the Drawings and data shall bear the Contractor'sstamp showing that they have been so checked. Shop drawingssubmitted to the Engineer without the Contractor's stamp will be returnedto the Contractor for conformance with this requirement. Shop drawingsshall indicate any deviations in the submittal from requirements of theContract Documents. If the Contractor takes exception to thespecifications, the Contractor shall note the exception in the letter oftransmittal to the Engineer.B. Determine and verify:1. Field measurements.2. Field construction criteria3. Catalog numbers and similar data.4. Conformance with Specifications.C. The Contractor shall furnish the Engineer a schedule of Shop Drawingsubmittals fixing the respective dates for the submission of shop andworking drawings, the beginning and ending of manufacture, testing, andinstallation of materials, supplies, and equipment. This schedule shallindicate those that are critical to the progress schedule.Section 01340 01340-2


D. The Contractor shall not begin any of the work covered by a ShopDrawing, Data, or a Sample returned for correction until a revision orcorrection thereof has been reviewed and returned to him, by theEngineer, with approval.E. The Contractor shall submit to the Engineer all drawings and schedulessufficiently in advance of construction requirements to provide no lessthan thirty (30) calendar days for checking and appropriate action from thetime the Engineer receives them.F. All submittals shall be accompanied with a transmittal letter prepared induplicate containing the following information:1. Date.2. Project Title and Number.3. Contractor's name and address.4. The number of each Shop Drawings, Project Data, and Samplesubmitted.5. Notification of Deviations from Contract Documents.a. The Contractor shall indicate in bold type at the top of thecover sheet of submittal of shop drawing if there is adeviation from the Drawings, Specifications, or referencedspecifications or codes.b. The Contractor shall also list any deviations from theDrawings, Specifications, or referenced specifications orcodes and identify in green ink prominently on the applicableShop Drawings.6. Submittal Log Number conforming to Specification Section Number.G. The Contractor shall submit seven (7) copies of descriptive or productdata information and Shop Drawings to the Engineer plus the number ofcopies which the Contractor requires returned. All blueprint ShopDrawings shall be submitted with one (l) set of mylar reproducibles andthe same number of prints as Shop Drawings, plus the number of copieswhich the Contractor requires returned. The Engineer will review theblueprints and return to the Contractor the set of marked-up mylarreproducibles with appropriate review comments.H. The Contractor shall be responsible for and bear all costs of damageswhich may result from the ordering of any material or from proceeding withany part of Work prior to the completion of the review by the Engineer ofSection 01340 01340-3


the necessary Shop Drawings.I. The Contractor shall be fully responsible for observing the need for andmaking any changes in the arrangement of piping, connections, wiring,manner of installation, etc., which may be required by thematerials/equipment he proposes to supply both as pertains to his ownwork and any work affected under other parts, headings, or divisions ofthe Drawings and Specifications.J. The Contractor shall not use Shop Drawings as a means of proposingalternate items to demonstrate compliance with the Drawings andSpecifications.K. Each submittal will bear a stamp indicating that Contractor has satisfiedContractor's obligations under the Contract Documents with respect toContractor's review and approval of that submittal as illustrated below.(OWNER'S NAME)(PROJECT NAME)(PROJECT NUMBER)SHOP DRAWING NO.:SPECIFICATION SECTION:DRAWING NO._______WITH RESPECT TO THIS SHOP DRAWING OR SAMPLE, I HAVE DETERMINED ANDVERIFIED ALL QUANTITIES, DIMENSIONS, SPECIFIED PERFORMANCE CRITERIA,INSTALLATION REQUIREMENTS, MATERIALS, CATALOG NUMBERS, AND SIMILARDATA WITH RESPECT THERETO AND REVIEWED OR COORDINATED THIS SHOPDRAWING OR SAMPLE WITH OTHER SHOP DRAWINGS AND SAMPLES AND WITHTHE REQUIREMENTS OF THE WORK AND THE CONTRACT DOCUMENTS.NO VARIATION FROM CONTRACT DOCUMENTSVARIATION FROM CONTRACT DOCUMENTS AS SHOWN(CONTRACTOR'S NAME)(CONTRACTOR'S ADDRESS)BY:___________________________________________________DATE:____________AUTHORIZED SIGNATUREL. Drawings and schedules shall be checked and coordinated with the workof all trades and sub-contractors involved, before they are submitted forreview by the Engineer and shall bear the Contractor's stamp of approvalas evidence of such checking and coordination. Drawings or schedulessubmitted without this stamp of approval shall be returned to theContractor for resubmission.1.03 ENGINEER'S REVIEW OF SHOP DRAWINGSA. The Engineer's review of Shop Drawings, Data, and Samples assubmitted by the Contractor will be to determine if the items(s) generallySection 01340 01340-4


conforms to the information in the Contract Documents and is compatiblewith the design concept. The Engineer's review and exceptions, if any,will not constitute an approval of dimensions, connections, quantities, anddetails of the material, equipment, device, or item shown.B. The review of drawings and schedules will be general, and shall not beconstrued:1. As permitting any departure from the Contract Documents.2. As relieving the Contractor of responsibility for any errors, includingdetails, dimensions, and materials.3. As approving departures from details furnished by the Engineer,except as otherwise provided herein.C. If the drawings or schedules as submitted describe variations and show adeparture from the Contract Documents which the Engineer finds to be inthe interest of the Owner and to be so minor as not to involve a change inContract Price or contract time, the Engineer may return the revieweddrawings without noting an exception.D. "Approved As Noted" - Contractor shall incorporate Engineer's commentsinto the submittal before release to manufacturer. The Contractor shallsend a letter to the Engineer acknowledging the comments and theirincorporation into the Shop Drawing.E. "Amend And Resubmit" - Contractor shall resubmit the Shop Drawing tothe Engineer. The resubmittal shall incorporate the Engineer's commentshighlighted on the Shop Drawing.F. "Rejected" - Contractor shall correct, revise and resubmit Shop Drawingfor review by Engineer.G. Resubmittals will be handled in the same manner as first submittals. Onresubmittals the Contractor shall direct specific attention, in writing or onresubmitted Shop Drawings, to revisions other than the correctionsrequested by the Engineer on previous submissions. The Contractor shallmake any corrections required by the Engineer.H. If the Contractor considers any correction indicated on the drawings toconstitute a change to the Drawings or Specifications, the Contractor shallgive written notice thereof to the Engineer.I. When the Shop Drawings have been completed to the satisfaction of theEngineer, the Contractor shall carry out the construction in accordancetherewith and shall make no further changes therein except upon writteninstructions from the Engineer.Section 01340 01340-5


J. No partial submittals will be reviewed. Submittals not deemed completewill be stamped "Rejected" and returned to the Contractor for resubmittal.Unless otherwise specifically permitted by the Engineer, make allsubmittals in groups containing all associated items for:1. Systems.2. Processes.3. As indicated in specific Specifications Sections.All drawings, schematics, manufacturer's product Data, certifications, andother Shop Drawing submittals required by a system specification shall besubmitted at one time as a package to facilitate interface review.K. Only the Engineer shall utilize the color "red" in marking Shop Drawingsubmittals.L. Shop drawing and submittal data shall be reviewed by the Engineer foreach original submittal and first resubmittal; thereafter review time forsubsequent resubmittals shall be charged to the Contractor and theContractor shall reimburse the Owner for services rendered by theEngineer as specified in the Supplementary Conditions.1.04 SHOP DRAWINGSA. When used in the Contract Documents, the term "Shop Drawing" shall beconsidered to mean Contractor's plans for materials and equipment whichbecome an integral part of the Project. Shop Drawings shall be completeand detailed and shall consist of fabrication, erection, setting and scheduledrawings, manufacturer's scale drawings, and wiring and controldiagrams. Catalogs cuts, catalogs, pamphlets, descriptive literature, andperformance and test data shall be considered only as supportiveinformation to required Shop Drawings as defined above. As used herein,the term "manufactured" applies to standard units usually mass-produced;and "fabricated" means items specifically assembled or made out ofselected materials to meet individual design requirements.B. Manufacturer's catalog sheets, brochures, diagrams, illustrations, andother standard descriptive data shall be clearly marked to identify pertinentmaterials, products, or models. Delete information which is not applicableto the Work by striking or cross-hatching.C. Each Shop Drawing shall be submitted with an 8-1/2" by 11" cover sheetwhich shall include a title block for the submittal. Each Shop Drawingcover sheet shall have a blank area 3-1/2 inches high by 4-1/2 incheswide, located adjacent to the title block. The title block/cover sheet shalldisplay the following:Section 01340 01340-6


1. Project Title and Number.2. Name of project building or structure.3. Number and title of the Shop Drawing.4. Date of Shop Drawing or revision.5. Name of Contractor and subcontractor submitting drawing.6. Supplier/manufacturer.7. Separate detailer when pertinent.8. Specification title and Section number.9. Applicable Drawing number.D. Data on materials and equipment shall include, without limitation,materials and equipment lists, catalog data sheets, catalog cuts,performance curves, diagrams, verification of conformance with applicablestandards or codes, materials of construction, and similar descriptivematerial. Materials and equipment lists shall give, for each item thereon,the name and location of the supplier or manufacturer, trade name,catalog reference, size, finish, and all other pertinent Data.E. For all mechanical and electrical equipment furnished, the Contractor shallprovide a list including the equipment name, and address, and telephonenumber of the manufacturer's representative and service company so thatservice and/or spare parts can be readily obtained.F. If drawings show variations from Contract requirements because ofstandard shop practice or for other reasons, the Contractor shall describesuch variations in his letter of transmittal. If acceptable, proper adjustmentin the Contract shall be implemented where appropriate. If the Contractorfails to describe such variations, he shall not be relieved of theresponsibility for executing the Work in accordance with the Contract,even though such drawings have been reviewed.G. All manufacturers or equipment suppliers who propose to furnishequipment or products shall submit an installation list to the Engineeralong with the required shop drawings. The installation list shall include atleast five (5) installations where identical equipment has been installedand has been in operation for a period of at least two (2) years unlessspecified otherwise in the Specification Section applicable.1.05 WORKING DRAWINGSA. When used in the Contract Documents, the term "Working Drawings" shallSection 01340 01340-7


e considered to mean the Contractor's plan for temporary structures suchas temporary bulkheads, support of open cut excavation, support ofutilities, ground water control systems, forming and false work forunderpinning, and for such other work as may be required for constructionbut does not become an integral part of the Project.B. Copies of working drawings as noted in paragraph 1.05 A. above, shall besubmitted to the Engineer where required by the Contract Documents orrequested by the Engineer, and shall be submitted at least thirty (30)calendar days (unless otherwise specified by the Engineer) in advance oftheir being required for the Work.C. Working Drawings shall be signed by a registered Professional Engineer,currently licensed to practice in the State of Florida, and shall convey, orbe accompanied by, calculation or other sufficient information tocompletely explain the structure, machine, or system described and itsintended manner of use. Prior to commencing such work, workingdrawings must have been reviewed without specific exceptions by theEngineer, which review will be for general conformance and will not relievethe Contractor in any way from his responsibility with regard to thefulfillment of the terms of the Contract. All risks to new or existing workare assumed by the Contractor; the Owner and Engineer shall have noresponsibility therefore.1.06 SAMPLESA. The Contractor shall furnish, for the approval of the Engineer, samplesrequired by the Contract Documents or requested by the Engineer.Samples shall be delivered to the Engineer as specified or directed. TheContractor shall prepay all shipping charges on samples. Materials orequipment for which samples are required shall not be used in the Workuntil approved by the Engineer.B. Samples shall be of sufficient size and quantity to clearly illustrate:1. Functional characteristics of the product, with integrally relatedparts and attachment devices.2. Full range of color, texture, and pattern.3. A minimum of three (3) samples of each item shall be submitted.C. Each sample shall have a label indicating:1. Name of Project.2. Name of Contractor and subcontractor.3. Material or equipment represented.Section 01340 01340-8


4. Place of origin.5. Name of producer/supplier and brand (if any).6. Location in Project.7. Submittal and specification numbers.(Samples of finished materials shall have additional marking that willidentify them under the finished schedules.)D. The Contractor shall prepare a transmittal letter and a description sheetfor each shipment of samples. The description sheet shall contain theinformation required in Paragraphs 1.06B and C above. He shall enclosea copy of the letter and description sheet with the shipment and send acopy of the letter and description sheet to the Engineer. Approval of asample shall be only for the characteristics or use named in such approvaland shall not be construed to change or modify any Contractrequirements.E. Approved samples not destroyed in testing shall be sent to the Engineeror stored at the site of the Work. Approved Samples of the hardware ingood condition will be marked for identification and may be used in theWork. Materials and equipment incorporated in the Work shall match theapproved Samples. Samples which failed testing or were not approvedwill be returned to the Contractor at his expense, if so requested at time ofsubmission.END OF SECTIONSection 01340 01340-9


SECTION 01370SCHEDULE OF VALUES1.01 DESCRIPTIONA. Scope of Work:1. Submit to the Engineer a Schedule of Values allocated to thevarious lump sum portions of the Work, at the Pre-ConstructionMeeting, and as otherwise specified or requested to be submittedearlier as evidence of the Apparent Low Bidder's qualifications.2. Upon request of the Engineer support the values with data whichwill substantiate their correctness. The data shall include, but notbe limited to quantity of materials, all sub-elements of the activity,and their units of measure.3. The Schedule of Values shall establish the actual value for eachactivity of the Work to be completed taken from the approvedCritical Path Method (CPM) Construction Schedule, and shall beused as the basis for the Contractor's Applications for Payment.B. Related Requirements Described Elsewhere:1. Conditions of the Construction Contract.1.02 FORM AND CONTENT OF SCHEDULE OF VALUESA. Type schedule on 8-1/2 inch x 11 inch white paper. Contractor's standardforms and computer printouts may be considered for approval by theEngineer upon Contractor's request. Identify schedule with:1. Title of project and location.2. Owner and purchase order number.3. Engineer and project number.4. Name and address of Contractor.5. Contract designation.6. Date of submission.B. Schedule shall list the installed value of the component parts of the Workin sufficient detail to serve as a basis for computing item prices forprogress payments during construction.Section 01370 01370-1


C. Identify each line item with the number and the title of the respectivesection of the Specifications.D. For each major item of the Work, list sub-values of major products oroperations under the major item.E. For the various portions of the Work:1. The amount for each item shall reflect a total installed costincluding a directly proportional amount of the Contractor'soverhead and profit.2. For items on which progress payments will be requested for storedmaterials, break down the value into:a. The cost of the materials, delivered and unloaded, with taxespaid. Paid invoices are required for materials. Payment formaterials shall be limited to the invoiced amount only.b. The total installed value.F. Round off figures to nearest dollar amount.G. The sum of the costs of all items listed in the schedule shall equal the totalContract Price.H. For each item which has an installed value of more than $15,000, providea breakdown of costs to list major products or operations under each item.I. The form of the Schedule of Values shall parallel the form presented inTable 01370-1. As a minimum, the Contractor shall provide a contractvalue for all of the items listed in Table 01370-1. The Contractor may addadditional items for convenience of pay request approvals.1.03 SUBSCHEDULE OF UNIT MATERIAL VALUESA. Submit a separate schedule of unit prices for materials to be stored on siteand for those materials incorporated into the Work for which progresspayments will be requested.B. Format shall parallel that shown in Section 00846: Materials Stored OnSite Form and Section 00845: Schedule of Values Form.C. The unit values for the materials shall be broken down into:1. Cost of the material, delivered and unloaded at the site, with taxespaid.Section 01370 01370-2


2. Copies of paid invoices for component material shall be includedwith the payment request in which the material first appears.D. Only materials unique to the project may be billed when stored on site.Materials of standard use such as conduit, wire, small-diameter pipe,steel, etc., shall not be accepted for payment.E. The installed unit value multiplied by the quantity listed shall equal the costof that item in the Schedule of Values.1.04 REVIEW AND RESUBMITTALA. After review by Engineer, revise and resubmit Schedule of Values andSchedule of Unit Material Values as required.B. Resubmit revised schedules in same manner.END OF SECTIONSection 01370 01370-3


SECTION 01390COLOR AUDIO-VIDEOPRE-CONSTRUCTION RECORD1.01 DESCRIPTIONA. Scope of Work: Prior to commencing work, the Contractor shall have acontinuous color audio-video tape recording taken along the entire lengthof the Project and at all proposed construction sites within the Project areato serve as a record of pre-construction conditions.1.02 APPROVALA. No construction shall begin prior to review and approval of the tapecovering the construction area by the Owner and Engineer. The Engineershall have the authority to reject all or any portion of a video tape notconforming to Specifications and order that it be redone at no additionalcharge.B. The Contract shall reschedule unacceptable coverage within five (5) daysafter being notified. The Engineer shall designate those areas, if any, tobe omitted from or added to the audio-video coverage.C. Tape recordings shall not be made more than ninety (90) days prior toconstruction in any area. All tapes and written records shall becomeproperty of the Owner.1.03 PROFESSIONAL ELECTROGRAPHERSA. The Contractor shall engage the services of a professional electrographer.The color audio-video tapes shall be prepared by a responsiblecommercial firm known to be skilled and regularly engaged in the businessof pre-construction color audio-video tape documentation.B. The electrographer shall furnish to the Engineer a list of all equipment tobe used for the audio-video taping, i.e., manufacturer’s name, modelnumber, specifications and other pertinent information.C. Additional information to be furnished by the electrographer is the namesand addresses of two (2) references that the electrographer hasperformed color audio-video taping for on projects of a similar nature, one(1) within the last twelve (12) months.2.01 AUDIO-VIDEO TAPESA. Audio-video tapes shall be new. Reprocessed tapes will not beacceptable. The tapes shall be one-half inch high energy, extended stillSection 01390 01390-1


3.01 EQUIPMENTframe capable, video cassette, Scotch Camera EXG grade or equal.A. All equipment, accessories, materials and labor to perform this serviceshall be furnished by the Contractor.B. The total audio-video system shall reproduce bright, sharp, clear picturewith accurate colors and shall be free from distortion, tearing, rolls or anyother form of imperfection. The audio portion of the recording shallreproduce the commentary of the camera operator with proper volume,clarity, and be free from distortion and interruptions.C. When conventional wheeled vehicles are used, the distance from thecamera lens to the ground shall not be more than ten (10) feet. In someinstances, audio-video tape coverage may be required in areas notaccessible by conventional wheeled vehicles. Such coverage shall beobtained by walking or special conveyance provided by the Engineer.D. The color video camera used in the recording system shall have ahorizontal resolution of 350 lines at center, a luminance signal to noiseratio of 45 dB and a minimum illumination requirement of one (1) footcandle.3.02 RECORDED INFORMATION – AUDIOA. Each tape shall begin with the current date, project name and municipalityand be followed by the general location, i.e., viewing side and direction ofprogress. The audio track shall consist of an original live recording. Therecording shall contain the narrative commentary of the electrographer,recorded simultaneously with his fixed elevation video record of the zoneof influence of construction.B. The Owner and Engineer reserve the right to supplement the audio portionof the taping as deemed necessary. A representative of the Owner orEngineer shall be selected to provide such narrative.3.03 RECORDED INFORMATION – VIDEOA. All video recordings shall, by electronic means, display on the screen thetime of day, the month, day and year of the recording. This time and dateinformation must be continuously and simultaneously generated with theactual recording.B. Each video tape shall have a log of that video tape’s contents. The logshall describe the various segments of coverage contained on that videotape in terms of the names of streets or easements, coverage beginningand end, directions of coverage, video unit counter numbers, engineeringstationing numbers and the date.Section 01390 01390-2


3.04 LIGHTINGA. All taping shall be done during time of good visibility. No taping shall bedone during precipitation, mist or fog. The recording shall be done onlywhen sufficient sunlight is present to properly illuminate the subjects ofrecording and to produce bright, sharp video recordings of those subjects.3.05 SPEED OF TRAVELA. The rate of speed in the general direction of travel of the vehicle usedduring taping shall not exceed 44 feet per minute. Panning, zoom-in andzoom-out rates shall be sufficiently controlled to maintain a clear view ofthe object.3.06 AREA OF COVERAGEA. Tape coverage shall include all surface features located within the zone ofinfluence of construction supported by appropriate audio coverage. Suchcoverage shall include, but not be limited to, existing driveways,pavements, equipment, concrete pads, and structures within the areacovered.END OF SECTIONSection 01390 01390-3


SECTION 01410TESTING AND TESTING LABORATORY SERVICES1.01 DESCRIPTIONA. Scope of Work:1. The City will employ and pay for services of an IndependentTesting Laboratory to perform testing specifically indicated in theContract Documents or specified in the Specifications and may atany other time elect to have materials and equipment tested forconformity with the Contract Documents. Additional charges for retestingor waiting will be billed to the Contractor.2. Contractor shall cooperate with the laboratory to facilitate theexecution of its required services.3. The Contractor shall provide Engineer with all test results hereinwithin five (5) days of receipt.B. Related Requirements Described Elsewhere:1. Conditions of the Contract.2. Respective section of the Specifications: Certification of products.3. Each Specification section listed: Laboratory tests required, andstandards for testing.4. Testing laboratory inspection, sampling and testing is required for,but not limited to the following:a. Excavating, Backfilling and Compacting: Section 02 120Section 01410 01410-1


C. The following schedule defines the responsibilities of various tests.Test Notes Paid for BySoil CompactionConcreteSamplingBase InspectionPipe Work: every 300 ft.at each lift of compactionminimum.Beneath Structures: each500 SF each lift ofcompaction minimum.Concrete Cylinder Breaksfor Walls, Curb andSidewalk.Contractor*Contractor*Contractor*Asphalt Paving Asphalt Cores Contractor*Asphalt Plant Quality Assurance Contractor*Contractor* pays for re-tests only.1.02 LABORATORY DUTIES: LIMITATIONS OF AUTHORITYA. Cooperate with Engineer and Contractor; provide qualified personnelpromptly on notice.B. Perform specified inspections, sampling and testing of materials andmethods of construction:1. Comply with specific standards; ASTM, other recognizedauthorities, and as specified.2. Determine and report on compliance with requirements of ContractDocuments.C. Promptly notify the Engineer and Contractor of material or operationswhich do not meet the specifications.D. Promptly submit five (5) copies of reports of inspections and tests to theEngineer including:1. Date issued.2. Project title and Engineer's job number.3. Testing Laboratory name and address.4. Name and signature of inspector.Section 01410 01410-2


5. Date of inspection or sampling.6. Record of temperature and weather.7. Date of test.8. Identification of product and Specification section.9. Location in project.10. Type of inspection or test.11. Compliance or non-compliance with Contract Documents.E. Perform additional services as required by Owner.F. Laboratory is not authorized to:1. Release, revoke, alter, or expand on requirements of ContractDocuments.2. Approve or reject any portion of work.3. Perform any duties of the Contractor.1.03 CONTRACTOR'S RESPONSIBILITIESA. Cooperate with laboratory personnel. Provide access to Work andmanufacturer's operations.B. Secure and deliver to the laboratory adequate representational samples ofmaterials proposed to be use and which require testing.C. Provide to the laboratory the preliminary design mix proposed to be usedfor concrete, and other materials mixes which require control by thetesting laboratory.D. Materials and equipment used in the performance of work under thisContract are subject to inspection and testing at the point of manufactureror fabrication. Standard specifications for quality and workmanship areindicated in the Contract Documents. The Engineer may require theContractor to provide statements or certificates from the manufacturersand fabricators that the materials and equipment provided by them aremanufactured or fabricated in full accordance with the standardspecifications for quality and workmanship indicated in the ContractDocuments. All costs of providing statements and certificates shall be asubsidiary obligation of the Contractor, and no extra charge to the Ownershall be allowed on account of such testing and certification.Section 01410 01410-3


E. Furnish incidental labor and facilities:1. To provide access to Work to be tested.2. To obtain and handle samples as the Project site or at the source ofthe product to be tested.3. To facilitate inspections and tests.4. For storage and curing of test samples.F. Notify laboratory sufficiently in advance of operations to allow forlaboratory assignment of personnel and scheduling of tests.END OF SECTIONSection 01410 01410-4


SECTION 01500CONSTRUCTION FACILITIES AND TEMPORARY CONTROLS1.01 CONSTRUCTION UTILITIESA. The Contractor shall arrange with the power and telephone companies, ifnecessary, to obtain temporary electrical service for constructionpurposes.B. The Contractor shall pay all power and telephone company installationand use charges for the telephone service and electrical energy utilized fortemporary power and light.C. The Contractor shall make his own arrangements at his own expense forobtaining the water supply and sanitary facilities necessary forconstruction purposes, and he shall acquire and pay for all waterconsumed during construction.1.02 TEMPORARY BUILDINGSA. The Contractor shall not build or move onto the site temporary buildings orother structures for storing (tools or machinery and supplies).1.03 CLEAN-UPA. Upon completion of the work, all excess material and rubbish shall beremoved from the job site, and any off-site locations used, and disposed ofin a lawful manner and in accordance with the Contract Documents. Thesurrounding construction area, easements, and any other affectedgrounds shall be left in a condition as good or better than existed prior toconstruction. Any remedial actions, measures or reconstruction ofdamaged properties shall be accomplished at the Contractor's expense.1.04 USE OF PREMISESA. The Contractor shall confine his apparatus, the storage of materials andthe operations of his workers to the limits defined by laws, ordinances,permits, or directions of the ENGINEER and shall not unduly encumberthe premises with his materials.B. The Contractor shall enforce the instructions of the ENGINEER regardingsigns, advertisements, fire, and safety.1.05 SOIL EROSIONA. The Contractor shall take all required and necessary actions as outlined inSection 01568, to minimize siltation and soil erosion during construction.1.06 ACCESS ROADSA. Streets, roads, and drives used by the Contractor for access to and fromthe site of the work shall be protected from damage. Any such damagedone shall be repaired and left in good condition at the end of theSection 01500 01500-1


construction period. Upon completion of construction, access areas andtemporary easements shall be restored to the pre-construction condition atno additional cost to the OWNER.1.07 MAINTENANCE DURING CONSTRUCTIONA. The Contractor shall maintain, at his expense, the work duringconstruction and until final acceptance of all work under the contract.B. In the event the Contractor fails to remedy any unsatisfactory situationwithin twenty-four (24) hours after receipt of written notice from theENGINEER describing the unsatisfactory conditions, the OWNER mayimmediately proceed with adequate forces and equipment to maintain theproject, and the entire cost of this maintenance will be deducted from themonies otherwise due the Contractor under the Contract.C. As an alternative to the above specified maintenance, the cost of all of theitems that are not properly maintained may be deducted at the ContractPrices from the current partial payment request even if such items havebeen paid for in previous estimates.1.08 SANITARY FACILITIESA. The Contractor shall provide and maintain temporary sanitaryaccommodations for the use of his employees, the ENGINEER, and thoseof his subcontractors as may be necessary to comply with healthrequirements and regulations and as directed by the ENGINEER. Nonuisance will be permitted from these accommodations.1.09 POTABLE WATER FACILITIESA. The Contractor shall provide and maintain temporary potable wateraccommodations for the use of his employees, the ENGINEER, and thoseof his subcontractors as may be necessary to comply with healthrequirements and regulations and as directed by the ENGINEER. Nonuisance will be permitted from these accommodations.END OF SECTIONSection 01500 01500-2


SECTION 01505MOBILIZATION1.01 DEFINITION AND SCOPEA. Mobilization shall include the costs of obtaining all permits, insurance andbonds, moving onto the site of all plant and equipment; furnishing anderecting plants, temporary buildings, and other construction facilities; all asrequired for the proper performance and completion of the Work.Mobilization shall include, but not be limited to, the following principalitems.1.02 DEMOBILIZATION1. Move onto the site all Contractor's plant and equipment required forfirst month operations.2. Install temporary construction power, wiring, and lighting facilities.3. Establish fire protection plan and safety program.4. Secure construction water supply.5. Arrange for and erect Contractor's work and storage yard andemployee's parking facilities.6. Submit all required insurance certificates and bonds.7. Obtain all required permits.8. Post all OSHA, EPA, Department of Labor, and all other requirednotices.9. Have Contractor's superintendent at the job site full time.10. Submit a detailed construction CPM schedule acceptable to theEngineer as specified.11. Submit a Schedule of Values of the Work.12. Submit a schedule of submittals.A. Demobilization is the timely and proper removal of all contractor-ownedmaterial, equipment or plant, from the job site and the proper restorationor completion of work necessary to bring the site into full compliance withthe contract documents.Section 01505 01505-1


1.03 PAYMENT FOR MOBILIZATION/DEMOBILIZATIONA. The Contractor's attention is directed to the condition that payment formobilization or any part thereof, shall not exceed five percent (5%) of thetotal Contract Price.END OF SECTIONSection 01505 01505-2


1.01 DESCRIPTIONSECTION 01568TEMPORARY EROSION AND SEDIMENTATION CONTROLA. Scope of Work:1. The Work specified in this Section consists of designing, providing,maintaining and removing temporary erosion and sedimentationcontrols as required by Rules and Regulations and Permitconditions.2. Temporary erosion controls include, but are not limited to, grassing,mulching, setting, watering and reseeding on-site surfaces and soiland borrow area surfaces and providing interceptor ditches at endsof berms and at those locations which will ensure that erosionduring construction will be either eliminated or maintained withinacceptable limits as established by the Owner.3. Temporary sedimentation controls include, but are not limited to, siltdams, traps, barriers, and appurtenances at the foot of slopedsurfaces which will ensure that sedimentation pollution will be eithereliminated or maintained within acceptable limits as established bythe Owner.4. Contractor is responsible for providing effective temporary erosionand sediment control measures during construction or until finalcontrols become effective.B. Related Work Described Elsewhere:1. Excavating, Backfilling, and Compacting: Section 02 1202. Seeding and Sodding: Sections 02 570 and 02 5752.01 EROSION CONTROLA. Sodding is specified in Section 02 575.B. Netting shall be fabricated of material acceptable to the Owner.2.02 SEDIMENTATION CONTROLA. Bales shall be clean, seed-free cereal hay type.B. Netting shall be fabricated of material acceptable to the Owner.C. Filter stone shall be crushed stone which conforms to Florida DepartmentSection 01568 01568-1


of Transportation (FDOT) specifications.D. Concrete block shall be hollow, non-load bearing type.E. Concrete shall be exterior grade not less than 1-inch thick.3.01 EROSION CONTROLA. Minimum procedures for grassing are:1. Scarify slopes to a depth of not less than 6 inches and removelarge clods, rock, stumps, roots larger than 1/2 inch in diameter anddebris.2. Sow seed within 24 hours after the ground is scarified with eithermechanical seed drills or rotary hand seeders.3. Apply mulch loosely and to a thickness of between 3/4 inch and 1-1/2 inches.4. Apply netting over mulched areas on sloped surfaces.5. Roll and water seeded areas in a manner which will encouragesprouting of seeds and growing of grass. Reseed areas whichexhibit unsatisfactory growth. Backfill and seed eroded areas.3.02 SEDIMENTATION CONTROLA. Install and maintain silt dams, traps, barriers, and appurtenances asshown on the approved descriptions and working drawings. Hay baleswhich deteriorate and filter stone which is dislodged shall be replaced.3.03 PERFORMANCEA. Should any of the temporary erosion and sediment control measuresemployed by the Contractor fail to produce results which comply with therequirements of the State of Florida, the Owner or Engineer, theContractor shall immediately take whatever steps are necessary to correctthe deficiency at his own expense.END OF SECTIONSection 01568 01568-2


SECTION 01600MATERIAL AND EQUIPMENT1.01 DESCRIPTIONA. Scope of Work: Material and equipment incorporated into the Work:1. Manufactured and fabricated products:a. Design, fabricate and assemble in accord with the bestengineering and shop practices.b. Manufacture like parts of duplicate units to standard sizesand gauges, to be interchangeable.c. Two (2) or more items of the same kind shall be identical, bythe same manufacturer.d. Products shall be suitable for service conditions.e. Equipment capacities, sizes and dimensions shown orspecified shall be adhered to unless variations arespecifically approved in writing.2. Do not use material or equipment for any purpose other than thatfor which it is designed or specified.1.02 MANUFACTURER'S INSTRUCTIONS FOR INSTALLATIONA. When Contract Documents require that installation of work shall complywith manufacturer's printed instructions, obtain and distribute copies ofsuch instructions to parties involved in the installation, including fivecopies of the Engineer.1. Maintain one (1) set of complete instructions at the job site duringinstallation and until completion.B. Handle, install, connect, clean, condition and adjust products in strictaccord with such instructions and in conformity with specifiedrequirements.1. Should job conditions or specified requirements conflict withmanufacturer's instructions, consult with Engineer for furtherinstructions.2. Do not proceed with work without clear instructions.Section 01600 01600-1


C. Perform work in accordance with manufacturer's instructions. Do not omitany preparatory step or installation procedure unless specifically modifiedor exempted by Contract Documents.1.03 TRANSPORTATION AND HANDLINGA. Arrange deliveries of products in accordance with progress schedules,coordinate to avoid conflict with work and conditions at the site.1. Deliver products in undamaged condition, in manufacturer's originalcontainers or packaging, with identifying labels intact and legible.2. Immediately on delivery, inspect shipments to assure compliancewith requirements of Contract Documents and approved submittals,and that products are properly protected and undamaged.B. Provide equipment and personnel to handle products by methods toprevent soiling or damage to products or packaging.1.04 STORAGE AND PROTECTIONA. The Contractor shall furnish a covered, weather-protected storagestructure providing a clean, dry, noncorrosive environment for allmechanical equipment, valves, architectural items, electrical andinstrumentation equipment, and special equipment to be incorporated intothis Project. Storage or equipment shall be in strict accordance with the"instructions for storage" of each equipment supplier and manufacturerincluding connection of heaters, placing of storage lubricants inequipment, etc. Corroded, damaged or deteriorated equipment and partsshall be replaced before acceptance of the project. Equipment andmaterials not properly stored will not be included in a payment estimate.B. Store products in accord with manufacturer's instructions, with seals andlabels intact and legible.1. Store products subject to damage by the elements in weather-tightenclosures.2. Maintain temperature and humidity within the ranges required bymanufacturer's instructions.3. Store fabricated products above the ground, on blocking or skids,prevent soiling or staining. Cover products which are subject todeterioration with impervious sheet coverings, provide adequateventilation to avoid condensation.4. Store loose granular materials in a well-drained area on solidsurfaces to prevent mixing with foreign matter.Section 01600 01600-2


C. All materials and equipment to be incorporated in the work shall behandled and stored by the Contractor before, during and after shipment ina manner to prevent warping, twisting, bending, breaking, chipping,rusting, and any injury, theft or damage of any kind whatsoever to thematerial or equipment.D. Cement, sand and lime shall be stored under a roof and off the groundand shall be kept completely dry at all times. All structural andmiscellaneous steel, and reinforcing steel shall be stored off the ground orotherwise to prevent accumulations of dirt or grease, and in a position toprevent accumulations of standing water and to minimize rusting.E. All materials, which, in the opinion of the Engineer, have become sodamaged as to be unfit for the use intended or specified shall be promptlyremoved from the site of the work, and the Contractor shall receive nocompensation for the damaged material or its removal.F. Arrange storage in a manner to provide easy access for inspection. Makeperiodic inspections of stored products to assure that products aremaintained under specified conditions, and free from damage ordeterioration.G. Protection After Installation: Provide substantial coverings as necessaryto protect installed products from damage from traffic and subsequentconstruction operations. Remove covering when no longer needed.H. The Contractor shall be responsible for all material, equipment andsupplies sold and delivered to the Owner under this Contract until finalinspection of the work and acceptance thereof by the Owner. In the eventany such material, equipment and supplies are lost, stolen, damaged ordestroyed prior to final inspection and acceptance, the Contractor shallreplace same without additional cost to the Owner.I. Should the Contractor fail to take proper action on storage and handling ofequipment supplied under this Contract within seven (7) days after writtennotice to do so has been given, the Owner retains the right to correct alldeficiencies noted in previously transmitted written notice and deduct thecost associated with these corrections from the Contractor's Contract.These costs may be comprised of expenditures for labor, equipmentusage, administrative, clerical, engineering and any other costs associatedwith making the necessary corrections.1.05 STORAGE AND HANDLING OF EQUIPMENT ON SITEA. Because of the long period allowed for construction, special attention shallbe given to the storage and handling of equipment on site. As a minimum,the procedure outlined below shall be followed:1. Materials shall not be shipped until approved by the Engineer. TheSection 01600 01600-3


intent of this requirement is to avoid unnecessary delivery ofunapproved materials and to reduce on-site storage time prior toinstallation and/or operation. Under no circumstances shall majorequipment or finish products be delivered to the site more than onemonth prior to installation without written authorization from theEngineer. Materials shipped to the site, or temporarily stored offsitein approved locations, shall be stored in accordance withParagraph 1.04, herein.2. All equipment having moving parts such as gears, electric motors,etc. and/or instruments shall be stored in a temperature andhumidity controlled building approved by the Engineer, until suchtime as the equipment is to be installed.3. All equipment shall be stored fully lubricated with oil, grease, etc.unless otherwise instructed by the manufacturer.4. Manufacturer's storage instructions shall be carefully studied by theContractor and reviewed with the Engineer by him. Theseinstructions shall be carefully followed and a written record of thiskept by the Contractor.5. Moving parts shall be rotated a minimum of once weekly to insureproper lubrication and to avoid metal-to-metal "welding". Uponinstallation of the equipment, the Contractor shall start theequipment, at least half the load, once weekly for an adequateperiod of time to insure that the equipment does not deterioratefrom lack of use.6. Lubricants shall be changed upon completion of installation and asfrequently as required thereafter during the period betweeninstallation and acceptance. Mechanical equipment to be used inthe work, if stored for longer than ninety (90) days, shall have thebearings cleaned, flushed and lubricated prior to testing andstartup, at no extra cost to the Owner.7. Prior to acceptance of the equipment, the Contractor shall have themanufacturer inspect the equipment and certify that its conditionhas not been detrimentally affected by the long storage period.Such certifications by the manufacturer shall be deemed to meanthat the equipment is judged by the manufacturer to be in acondition equal to that of equipment that has been shipped,installed, tested and accepted in a minimum time period. As such,the manufacturer will guarantee the equipment equally in bothinstances. If such a certification is not given, the equipment shallbe judged to be defective. It shall be removed and replaced at theContractor's expense.Section 01600 01600-4


1.06 SPARE PARTSA. Spare parts for certain equipment provided under Division 15: Mechanicalhave been specified in the pertinent sections of the Specifications. TheContractor shall collect and store all spare parts so required in an area tobe designated by the Engineer. In addition, the Contractor shall furnish tothe Engineer an inventory listing all spare parts, the equipment they areassociated with, the name and address of the supplier, and the deliveredcost of each item. Copies of actual invoices for each item shall befurnished with the inventory to substantiate the delivered cost.1.07 GREASE, OIL AND FUELA. All grease, oil and fuel required for testing of equipment shall be furnishedwith the respective equipment. The Owner shall be furnished with a year'ssupply of required lubricants including grease and oil of the typerecommended by the manufacturer with each item of equipment supplied.B. The Contractor shall be responsible for changing the oil in all drives andintermediate drives of each mechanical equipment after initial break-in ofthe equipment, which in no event shall be any longer than three (3) weeksof operation.END OF SECTIONSection 01600 01600-5


SECTION 01700CONTRACT CLOSEOUT1.01 DESCRIPTIONA. Scope of Work: Comply with requirements stated in Conditions of theContract and in the Specifications for administrative procedures in closingout the Work.B. Related Requirements Described Elsewhere:1. Conditions of the Contract. Fiscal provisions, legal submittals andadditional administrative requirements.2. Project Record Documents: Section 01720.3. Warranties and Bonds: Section 01740.4. The respective sections of the Specifications: Closeout SubmittalsRequired of Trades.1.02 SUBSTANTIAL COMPLETIONA. When Contractor considers the Work as substantially complete, theContractor shall submit to the Engineer:1. A written notice that the Work, or designated portion thereof, issubstantially complete.2. A list of items to be completed or corrected.B. Within a reasonable time after receipt of such notice, the Engineer willmake an inspection to determine the status of completion.C. Should the Engineer determine that the Work is not substantiallycomplete:1. The Engineer will promptly notify the Contractor in writing, givingthe reasons therefor.2. The Contractor shall remedy the deficiencies in the Work and senda second written notice of substantial completion to the Engineer.3. The Engineer will re-inspect the Work.D. When the Engineer finds that the Work is substantially complete, theEngineer will:Section 01700 01700-1


1. Prepare a tentative Certificate of Substantial Completion on theform provided herein, with a tentative list of items to be completedor corrected before final payment.2. After consideration of any objections made by the Engineer, asprovided in Conditions of the Contract, and when the Engineerconsiders the Work substantially complete, the Engineer willexecute and deliver to the Contractor a Certificate of SubstantialCompletion with a revised tentative list of items to be completed orcorrected.1.03 FINAL INSPECTIONA. When Contractor considers the Work is complete, he shall submit writtencertification that:1. The Contract Documents have been reviewed.2. The Work has been inspected for compliance with the ContractDocuments.3. The Work has been completed in accordance with the ContractDocuments.4. The equipment and systems have been tested in the presence ofthe Owner's representative and are operational.5. The Work is completed and ready for final inspection.B. The Engineer will make an inspection to verify the status of completionwith reasonable promptness after receipt of such certification.C. Should the Engineer consider that the Work is incomplete or defective:1. The Engineer will promptly notify the Contractor in writing, listingthe incomplete or defective work.2. The Contractor shall take immediate steps to remedy the stateddeficiencies and send a second written certification to the Engineerthat the Work is complete.3. The Engineer will re-inspect the Work.1.04 REINSPECTION FEESA. Should the Engineer perform re-inspections due to failure of the Work tocomply with the claims of the status of completion made by the Contractor:1. Owner will deduct the cost of such re-inspections from the finalSection 01700 01700-2


payment to the Contractor.1.05 CONTRACTOR'S CLOSEOUT SUBMITTALS TO THE OWNERA. Project Record Documents: To requirements of Section 01720.B. Warranties and Bonds: To requirements of Section 01740.C. Evidence of Payment and Release of Liens: To requirements of Generaland Supplementary Conditions.D. Certificate of Insurance for Products and Completed Operations.1.06 FINAL ADJUSTMENT OF ACCOUNTSA. Submit a final statement of accounting to the Owner.B. The final statement shall reflect all adjustments to the Contract Sum:1. The original Contract Price.2. Additions and deductions resulting from:a. Change Ordersb. Allowancesc. Unit pricesd. Deductions for uncorrected worke. Penalties and bonusesf. Deductions for liquidated damagesg. Deductions for re-inspection paymentsh. Other adjustments3. Total Contract Price, as adjusted.4. Previous payments.5. Amount remaining due.C. The Engineer will prepare a final Change Order reflecting approvedadjustments to the Contract Price which were not made by previous ChangeOrders.Section 01700 01700-3


1.07 FINAL APPLICATION FOR PAYMENTA. Contractor shall submit the final Application and Certification for Paymentin accordance with procedures and requirements stated in the Conditionsof the Contract.B. When the Engineer has approved the final Application and Certification forPayment, the Contractor shall execute the Final Releases of Lien prior tothe Contractor receiving the final payment.END OF SECTIONSection 01700 01700-4


SECTION 01710CLEANING1.01 DESCRIPTIONA. Scope of Work: Execute cleaning, during progress of the Work and atcompletion of the Work.1.02 DISPOSAL REQUIREMENTSA. Conduct cleaning and disposal operations to comply with codes,ordinances, regulations, and anti-pollution laws.2.01 MATERIALSA. Use only those cleaning materials which will not create hazards to healthor property and which will not damage surfaces.B. Use only those cleaning materials and methods recommended bymanufacturer of the surface material to be cleaned.C. Use cleaning materials only on surfaces recommended by cleaningmaterial manufacturer.3.01 DURING CONSTRUCTIONA. Execute daily cleaning to keep the Work, the site and adjacent propertiesfree from accumulations of waste materials, rubbish and windblowndebris, resulting from construction operations or personal activities.B. Provide on-site containers for the collection of waste materials, debris andrubbish.C. Remove waste materials, debris and rubbish from the site periodically, oras directed by the Owner, and dispose of at legal disposal areas awayfrom the site.Section 01710 01710-1


3.02 DUST CONTROLA. The Contractor shall employ construction techniques that minimize theproduction and distribution of dust.B. Clean interior spaces prior to the start of finish painting and continuecleaning on an as-needed basis until painting is finished.C. Schedule operations so that dust and other contaminants resulting fromcleaning process will not fall on wet or newly-coated surfaces.3.03 FINAL CLEANINGA. Employ skilled workmen for final cleaning.B. Remove grease, mastic, adhesives, dust, dirt, stains, fingerprints, labels,and other foreign materials from sight-exposed interior and exteriorsurfaces.C. Prior to final completion, or Owner occupancy, Contractor shall conduct aninspection of sight-exposed interior and exterior surfaces and all workareas, to verify that the entire Work is clean.END OF SECTIONSection 01710 01710-2


SECTION 01720PROJECT RECORD DOCUMENTS1.01 DESCRIPTIONA. Scope of Work: Maintain at the site for the Owner one (l) record copy of:1. Drawings.2. Specifications.3. Addenda.4. Change Orders and other modifications of the Contract.5. Engineer's Field Orders or written instructions.6. Approved Shop Drawings, Working Drawings and Samples.7. Field Test records.8. Color Audio-Video Pre-Construction Record: Section 01390.B. Related Requirements Described Elsewhere:1. Field Engineering: Section 01050.2. Shop Drawings, Working Drawings and Samples: Section 01340.3. Color Audio-Video Pre-Construction Record: Section 01390.1.02 MAINTENANCE OF DOCUMENTS AND SAMPLESA. Store documents and samples in Contractor's field office apart fromdocuments used for construction.1. Provide files and racks for storage of documents.2. Provide locked cabinet or secure storage space for storage ofsamples.B. File documents and samples in accordance with CSI format with sectionnumbers as provided herein.C. Maintain documents in a clean, dry, legible, condition and in good order.Do not use record documents for construction purposes.Section 01720 01720-1


D. Make documents and samples available at all times for inspection by theEngineer or the Owner.E. As a prerequisite for monthly Progress payments, the Contractor is toexhibit the currently updated "Record Documents" for review by theEngineer and Owner. Payment may be withheld if record documents arenot satisfactorily maintained.1.03 MARKING DEVICESA. Provide felt tip marking pens for recording information in the color codedesignated by the Engineer.1.04 RECORDINGA. Label each document "PROJECT RECORD" with a rubber stamp havingone (1) inch high letters.B. Record information concurrently with construction progress.1. Do not conceal any work until required information is recorded.C. Drawings: Legibly and clearly mark, to scale, each drawing to recordactual construction:1. Depths of various elements of foundation in relation to finish firstfloor datum.2. All underground piping with elevations and dimensions. Changesto piping location. Horizontal and vertical locations of undergroundutilities and appurtenances, referenced to permanent surfaceimprovements. Actual installed pipe material, class, etc.3. Location of internal utilities and appurtenances concealed in theconstruction, referenced to visible and accessible features of thestructure.4. Field changes of dimension and detail.5. Changes made by Field Order or by Change Order.6. Details not on original Contract Drawings.7. Equipment and piping relocations.8. Major architectural and structural changes including relocation ofdoors, windows, etc.9. Architectural schedule changes according to Contractor's recordsSection 01720 01720-2


and shop drawings.D. Specifications and Addenda: Legibly mark each section to record:1. Manufacturer, trade name, catalog number of Supplier of eachproduct and item of equipment actually installed.2. Changes made by Field Order or by Change Order.E. Shop Drawings (after final review and approval): Provide six (6) sets ofrecord shop drawings within the Operation and Maintenance Manual, foreach process equipment, piping, electrical system and instrumentationsystem (see Section 01730).1.05 SUBMITTALA. At Contract closeout, deliver Record Documents to the Engineer for theOwner.B. Accompany submittal with transmittal letter in duplicate, containing:1. Date.2. Project title and number.3. Contractor's name and address.4. Title and number of each Record Document.5. Signature of Contractor or his authorized representative.END OF SECTIONSection 01720 01720-3


SECTION 01740WARRANTIES AND BONDS1.01 DESCRIPTIONA. Scope of Work:1. Compile specified warranties and bonds, as in Article 5 and 13 ofSection 00700: General Conditions and as specified in theseSpecifications.B. Related Work Described Elsewhere:1. General Conditions: Section 00700.2. Contract Closeout: Section 01700.1.02 SUBMITTAL REQUIREMENTSA. Assemble warranties, bonds and service and maintenance contracts,executed by each of the respective manufacturers, suppliers, andsubcontractors.B. Number of original signed copies required: Two (2) each.C. Table of Contents: Neatly typed, in orderly sequence. Provide completeinformation for each item.1. Product of work item.2. Firm, with name of principal, address and telephone number.3. Scope.4. Date of beginning of warranty, bond or service and maintenancecontract.5. Duration of warranty, bond or service maintenance contract.6. Provide information for Owner's personnel:a. Proper procedure in case of failure.b. Instances which might affect the validity or warranty or bond.7. Contractor, name of responsible principal, address and telephonenumber.Section 01740 01740-1


1.03 FORM OF SUBMITTALSA. Prepare in duplicate packets.B. Format:1. Size 8-1/2 inches by 11 inches, punch sheets for standard three (3)ring binder.a. Fold larger sheets to fit into binders.2. Cover: Identify each packet with typed or printed title"WARRANTIES AND BONDS". List:a. Title of Project.b. Name of Contractor.C. Binders: Commercial quality, three (3) D-ring type binders with durableand cleanable white plastic covers and maximum D-ring width of two (2)inches. Binders shall be presentation type with clear vinyl covers on front,back, and spine. Binders shall include two sheet lifters and two horizontalinside pockets.1.04 WARRANTY SUBMITTALS REQUIREMENTSA. For all major pieces of equipment, submit a warranty from the equipmentmanufacturer. The manufacturer's warranty period shall be concurrentwith the Contractor's for one (1) year, unless otherwise specified,commencing at the time of final acceptance by the Owner.B. The Contractor shall be responsible for obtaining certificates forequipment warranty for all major equipment specified under Division 15:Mechanical and which has at least a 1 hp motor or which lists for morethan $1,000. The Engineer reserves the right to request warranties forequipment not classified as major. The Contractor shall still warrantequipment not considered to be "major" in the Contractor's one-yearwarranty period even though certificates of warranty may not be required.C. In the event that the equipment manufacturer or supplier is unwilling toprovide a one (1) year warranty commencing at the start of the CorrectionPeriod, the Contractor shall obtain from the manufacturer a two (2) yearwarranty commencing at the time of equipment delivery to the job site.This two (2) year warranty from the manufacturer shall not relieve theContractor of the one (1) year warranty, starting at the time of Owner'sacceptance of the equipment.D. The Owner shall incur no labor or equipment cost during the guaranteeSection 01740 01740-2


period.E. Guarantee shall cover all necessary labor, equipment, materials, andreplacement parts resulting from faulty or inadequate equipment design,improper assembly or erection, defective workmanship and materials,leakage, breakage or other failure of all equipment and componentsfurnished by the manufacturer or the Contractor.END OF SECTIONSection 01740 01740-3


1.01 DESCRIPTIONA. Scope of Work:2.01 MATERIALSSECTION 01800MISCELLANEOUS WORK AND CLEANUP1. This Section includes operations which cannot be specified in detailas separate items but can be sufficiently described as to the kindand extent to work involved. The Contractor shall furnish all labor,materials, equipment and incidentals to complete the work underthis Section.2. The work of this Section includes, but is not limited to, the following:a. Restoring of fences.b. Cleaning up.c. Incidental work.A. Materials required for this Section shall be of the same quality as materialsthat are to be restored. Where possible, the Contractor shall reuseexisting materials that are removed and then replaced.3.01 RESTORING OF FENCESA. The Contractor shall remove, store and replace existing fences duringconstruction. Only the sections directed by the Engineer shall beremoved. If any section of fence is damaged due to the Contractor'snegligence, it shall be replaced with fencing equal to or better than thatdamaged, and the work shall be satisfactory to the Engineer.3.02 CLEAN UPA. The Contractor shall remove all construction material, buildings,equipment and other debris remaining on the job as the result ofconstruction operations and shall render the site of the work in a neat andorderly condition. All suitable excess excavated material shall remain onsite.3.03 INCIDENTAL WORKA. Do all incidental work not otherwise specified, but obviously necessary forthe proper completion of the contract as specified and as shown on theDrawings.END OF SECTIONSection 01800 01800-1


SECTION 00100INSTRUCTIONS TO BIDDERSARTICLE 1 - DEFINED TERMS1.1 Terms used in these Instructions to Bidders which are defined in the GeneralConditions have the meanings assigned to them in the General Conditions, assupplemented. The term "Apparent Low Bidder" means the Bidder submittingthe lowest Bid at the Bid opening without correction of numerical discrepancies ordetermination of responsiveness and responsibility. The term "SuccessfulBidder" means the Bidder to whom City awards or expects to award the Contract.Bidding Documents consist of the Project Manual and Drawings, both as may bemodified by Addenda.ARTICLE 2 – CONTACT2.1 All prospective bidders are hereby instructed not to contact any member of theCity of Deltona Commissioners, City Manager, City of Deltona Staff members orEngineers contracted by the City for this project, other than the noted contactperson regarding this Invitation to Bid at any time during the bid process. Anysuch contact shall be cause for rejection of your bid.ARTICLE 3 - COPIES OF BIDDING DOCUMENTS3.1 Bidding Documents shall be obtained by contacting Purchasing Agent for the Cityof Deltona, Public Works Division at 386-878-8955 or email attcinefro@deltonafl.gov3.2 Complete sets of full size Bidding Documents shall be used in preparing Bids;neither City nor Engineer assume any responsibility for errors ormisinterpretations resulting from the use of incomplete sets of BiddingDocuments.3.3 City and Engineer, in making copies of Bidding Documents available on theabove terms, do so only for the purpose of obtaining Bids on the Work and do notconfer a license or grant for any other use.ARTICLE 4 – DELAYS4.1 The City, at its sole discretion, may delay the scheduled due dates indicatedabove if it is to the advantage of the City to do so. The City will notify bidders ofall changes in scheduled due dates by written addendum.ARTICLE 5 - QUALIFICATIONS OF BIDDERS5.1 Each Bid must contain Bidder's license number to do business in the State ofFlorida.Section 00100 00100- 3


5.2 To demonstrate qualifications to perform the Work, each Bidder must beprepared to submit, within seven (7) calendar days after Bid opening, informationincluding, but not limited to, the qualifications submittals set forth in Article 24 ofthese Instructions to Bidders, evidence of authority to conduct business in thejurisdiction where the Project is located. Submittals requested pursuant to thisparagraph shall be referred to as the Qualifications Submittals and are in additionto those required elsewhere.5.3 Bidders will be evaluated with respect to having successfully completed projectsof a similar size, nature and time frame.ARTICLE 6 - EXAMINATION OF CONTRACT DOCUMENTS AND SITE6.1 It is the responsibility of each Bidder before submitting a Bid:6.1.1 To obtain a set of Bidding Documents and register as a document holderwith the Purchasing Agent for the City of Deltona, Public Works Division.6.1.2 To examine thoroughly the Contract Documents and other related dataidentified in the Bidding Documents (including "technical data" referred tobelow);6.1.3 To visit the site to become familiar with and satisfy Bidder as to thegeneral, local and site conditions that may affect cost, progress,performance or furnishing of the Work;6.1.4 To consider federal, state and local Laws and Regulations that may affectcost, progress, performance or furnishing of the Work;6.1.5 To study and carefully correlate Bidder's knowledge and observations withthe Contract Documents and such other related data; and6.1.6 To promptly notify the City of all conflicts, errors, ambiguities ordiscrepancies which Bidder has discovered in or between the ContractDocuments and such other related documents.6.2 Reference is made to the Supplementary Conditions for identification of:6.2.1 Those reports of explorations and tests of subsurface conditions at orcontiguous to the site which have been utilized by Engineer in preparationof the Contract Documents. Bidder may rely upon the general accuracy ofthe "technical data" contained in such reports but not upon other data,interpretation, opinions or information contained in such reports orotherwise relating to the subsurface conditions at the site, nor upon thecompleteness thereof for the purposes of bidding or construction.6.2.2 Those drawings of physical conditions in or relating to existing surface andsubsurface structures (except Underground Facilities) which are at orcontiguous to the site that have been utilized by Engineer in preparation ofSection 00100 00100- 4


the Contract Documents. Bidder may rely upon the general accuracy ofthe "technical data" contained in such drawings but not upon other data,interpretations, opinions or information shown or indicated in suchdrawings or otherwise relating to such structures, nor upon thecompleteness thereof for the purposes of bidding or construction.Copies of such reports and drawings will be made available by City to anyBidder on request. Those reports and drawings are not part of theContract Documents, but the "technical data" contained therein uponwhich Bidder is entitled to rely as provided in Paragraph 4.2 of the GeneralConditions has been identified and established in Paragraph SC-4.2.1 ofthe Supplementary Conditions. Bidder is responsible for any interpretationor conclusion drawn from any "technical data" or any such data,interpretations, opinions or information.6.3 Information and data shown or indicated in the Contract Documents with respectto existing Underground Facilities at or contiguous to the site is based uponinformation and data furnished to the Engineer by the City, and City andEngineer do not assume responsibility for the accuracy or completeness thereofunless it is expressly provided otherwise in the Supplementary Conditions.6.4 Provisions concerning responsibilities for the adequacy of data furnished toprospective Bidders with respect to subsurface conditions, other physicalconditions and Underground Facilities, and possible changes in the ContractDocuments due to differing or unanticipated conditions appear in Paragraphs 4.2and 4.3 of the General Conditions.6.5 Before submitting a Bid each Bidder will be responsible to obtain such additionalor supplementary examinations, investigations, explorations, tests, studies anddata concerning conditions (surface, subsurface and Underground Facilities) ator contiguous to the site or otherwise, which may affect cost, progress,performance or furnishing of the Work or which relate to any aspect of themeans, methods, techniques, sequences or procedures of construction to beemployed by Bidder and safety precautions and programs incident thereto orwhich Bidder deems necessary to determine its Bid for performing and furnishingthe Work in accordance with the time, price and other terms and conditions of theContract Documents.6.6 On request, City will provide each Bidder access to the site to conduct suchexaminations, investigations, explorations, tests and studies as each Bidderdeems necessary for submission of a Bid. Bidder must fill all holes and clean upand restore the site to its former conditions upon completion of such explorations,investigations, tests and studies.6.7 Reference is made to the Supplementary Conditions for the identification of thegeneral nature of work that is to be performed at the site by City or others (suchas utilities and other prime contractors) that relates to the work for which a Bid isto be submitted. On request, City will provide to each Bidder for examinationSection 00100 00100- 5


access to or copies of Contract Documents (other than portions thereof related toprice) for such work.6.8 The submission of a Bid will constitute an incontrovertible representation byBidder that Bidder has complied with every requirement of this Article 4, thatwithout exception the Bid is premised upon performing and furnishing the Workrequired by the Contract Documents and applying the specific means, methods,techniques, sequences or procedures of construction (if any) that may be shownor indicated or expressly required by the Contract Documents, that Bidder hasgiven Engineer written notice of all conflicts, errors, ambiguities anddiscrepancies that Bidder has discovered in the Contract Documents and thewritten resolutions thereof by Engineer is acceptable to Bidder, and that theContract Documents are generally sufficient to indicate and conveyunderstanding of all terms and conditions for performing and furnishing the Work.ARTICLE 7 - ADDENDA AND INTERPRETATIONS7.1 All Bidders shall carefully examine the Bid Documents. Bidders shall promptlynotify the City in writing prior to the opening of Bids of any ambiguity,inconsistency, or error which they may discover upon examination of the BiddingDocuments or the site. Failure to do so, on the part of the Bidder, will constitutean acceptance by the Bidder of any subsequent decision,.7.2 All questions about the meaning or intent of the Bidding Documents shall besubmitted to Brian Boehs, Purchasing Agent for the City of Deltona, in writing toemail address; tcinefro@deltonafl.gov or via facsimile to (386) 878-8971 andmust be received seven (7) calendar days prior to the bid due date. Repliesconsidered necessary will be issued through Addenda on DemandStar. Afacsimile will be sent to all parties recorded by Purchasing Agent as havingreceived complete sets of Bidding Documents up to forty eight (48) hours beforebid time, notifying bidders that an addenda is available for download. Briefaddenda may be issued between forty eight (48) hours and twenty-four (24)hours before bid time by facsimile to all parties recorded by Purchasing Agent ashaving received complete sets of Bidding Documents only. Questions receivedless than seven (7) calendar days prior to the date for opening of Bids will not beanswered. Only questions answered by formal written Addenda will be binding.Oral and other interpretations or clarifications will be without legal effect and maynot be relied upon by Bidders in submitting their bids. Failure of any Bidder toreceive any such addendum or interpretation shall not relieve such Bidder fromits terms and requirements. Receipt of all addenda shall be acknowledged bythe Bidders by signing and enclosing said addenda or addendumacknowledgement with their bid.7.3 The City will record its responses to inquiries, any supplemental instructions,and/or necessary revisions to Bid Documents, in the form of a written addendum.Should revisions to the Bid Documents become necessary, the City will post awritten addendum to the DemandStar website which will go out to all Bidderswho received a bid package through DemandStar. All addenda are posted to theDemandStar website and current planholders are notified that an addendum hasSection 00100 00100- 6


een issued. Bidders who obtain Bid Documents from other sources mustofficially register with the City's Purchasing Agent in order to be placed on theDemandStar website as a bid holder in order to receive any forthcoming addendaor other official communications. Failure to register as a prospective Bidder maycause your bid to be rejected as non-responsive if you have failed to submit a bidwithout an addendum acknowledgment for the most current addendum. It is thevendor’s responsibility to check the DemandStar website atwww.demandstar.com in order to be sure latest addendum and any prioraddendum have been received.ARTICLE 8 - BID SECURITY8.1 Bid Security will be submitted and shall be made payable to City, in an amount ofnot less than five percent (5%) of the Bidder's Contract Price and in the form of acertified or cashier's check or a Bid Bond issued by a Surety meeting therequirements of Article 5 of the General Conditions as amended by theSupplementary Conditions. The Bid Bond shall be issued by a company havinga registered agent in the State of Florida. Personal checks are not acceptable.8.2 The Bid Security of the Successful Bidder will be retained until such Bidder hasexecuted the Agreement and furnished the required payment and performancebonds, whereupon the Bid Security will be returned. If the Successful Bidder failsto furnish the qualifications submittals or fails to execute and deliver theAgreement and furnish the required Bonds within ten (10) days of the Notice ofAward, City may annul the Notice of Award and the Bid Security of that Bidderwill be forfeited. The Bid Security of any Bidder whom City believes to have areasonable chance of receiving the award may be retained by City until theninety-first (91) day after the Bid opening. Bid Security of other Bidders will bereturned approximately seven (7) days after the Bid opening.ARTICLE 9 - CONTRACT TIME9.1 The number of consecutive calendar days within which, or the date by which, theWork is to be completed (the Contract Time) is set forth in the SupplementalConditions.ARTICLE 10 - LIQUIDATED DAMAGES AND INDEMNITY10.1 Provisions for liquidated damages and incentive payments (if any) are set forth inthe General Conditions.10.2 All Bidders must state in the Bid Form the amount of consideration required bythe Bidder in return for the Bidder's promise of indemnity contained in Paragraph6.18 of the General Conditions and 725.06 of Florida Statutes. The amount to bestated shall be no less than $1,000.10.3 The Bidder, without exemption, shall indemnify and save harmless, the City, itsemployees and/or any of its Commissioners from liability of any nature or kind,including cost and expenses for or on account of any copyrighted, patented, orSection 00100 00100- 7


unpatented invention, process, or item manufactured by the Bidder. Further, ifsuch a claim is made, or is pending, the Bidder may, at its option and expense,procure for the City the right to use, replace or modify the item to render it noninfringing.If none of the alternatives are reasonably available, the City agrees toreturn the article on request to the Bidder and receive reimbursement. If theBidder used any design, device, or materials covered by letters, patent orcopyright, it is mutually agreed and understood, without exception, that the bidprices shall include all royalties or cost arising from the use of such design,device, or materials in any way involved in the work.ARTICLE 11 - SUBSTITUTE MATERIAL AND EQUIPMENT11.1 The Contract, if awarded, will be awarded on the basis of material and equipmentillustrated and described on the Drawings or specified in the Specifications.Substitutions or "or equal" items will not be considered when determining theApparent Low Bidder. The Bidder shall base his Bid on providing one of thelisted manufacturers. Whenever it is indicated in the Drawings or specified in theSpecifications that a substitution or "or equal" item of material or equipment maybe furnished or used by Contractor if acceptable to Engineer, application for suchacceptance will not be considered by Engineer until after the "Effective Date ofthe Agreement" and only for such items identified on the Bid Form at the time ofbid. The procedure for submittal of any such application by Contractor andconsideration by Engineer is set forth in the General Conditions, as may besupplemented in Division 1, General Requirements. If a substitution list isprovided as part of the prescribed Bid Form, Bidders must identify proposedsubstitute materials and equipment at time of Bid submission. These substitutematerials and equipment shall be evaluated after "Effective Date of theAgreement." Only the proposed substitutions or "or equal" items listed on theSubstitution List will be evaluated by the Engineer in accordance with theGeneral Conditions. The cost of changes in related work, additional drawingswhich may be required to illustrate or define the substitute equipment and itsrelationship to the other parts or portions of the Work shall be paid by theContractor. No change will be made in the amount of time in which to completethe Work or in the liquidated damages. If the proposed substituted material orequipment is found to be unacceptable to the Engineer as an "or equal" item,then the material or equipment named in the Specifications or the Bid Form(circled item) shall be furnished by the Contractor. If Bidder fails to circle one ofthe listed manufacturer's then the manufacturer identified as "A" shall befurnished.ARTICLE 12 - SUBCONTRACTORS, ETC.12.1 Bidder shall submit with the bid, all Sub Contractors and Affiliates utilized (formattached) for this project, including those who are to furnish the principal items ofmaterial and equipment as indicated in the principal items of material andequipment as indicated in Questionnaire. This list shall include the name andaddress of the Subcontractor, person or organization, a description of theservices, materials or equipment to be supplied, estimated time required forpreparation and submittal of shop drawings, and estimated lead times requiredSection 00100 00100- 8


for the fabrication of any long lead items and concurrence thereof. Such list shallbe accompanied by a statement of experience with pertinent information as tosimilar projects and other evidence of qualification for each such Subcontractor,person or organization. If City or Engineer has a reasonable objection to anyproposed Subcontractor, other person or organization, either may, before theNotice or Award, request the Apparent Low Bidder to submit an acceptablesubstitute without an increase in Bid price. If Apparent Low Bidder declines tomake any such substitution, the City may elect not to award the Contract to suchBidder. A Bidder's declining to make any such substitution will not constituentgrounds for sacrificing his Bid Security. Failure to provide this information withthe bid may result in bid being declared non-responsive.12.2 Procedures for approval of other Subcontractors after execution of theAgreement are described in the General and Supplementary Conditions.ARTICLE 13 - BID FORM13.1 The Bid Form is Section 00300 of the Contract Documents.13.2 Bid form must contain a manual signature, in ink, of an authorized representative,who has the legal ability to bind the Bidder in contractual obligations in the spaceprovided on the Bid Response Form. Failure to properly sign the Bid shallinvalidate same, and it shall not be considered for award. Bid must be typed orlegibly printed in ink. Use of erasable ink is not permitted. All corrections madeby Bidder to any part of the bid document must be initialed in ink. The originalbid conditions and specifications cannot be changed or altered in any way.Altered bids will not be considered. Clarification of bids submitted shall be inletter form, signed by bidders and attached to the bid. Bidder shall complete the“Corporate Authority”, “Joint Venture”, “Sole Proprietorship”, or “Partnership”portion of the Bidder Information Sheet, whichever part applies, and include withtheir bid submittal.13.3 Bids by corporations must be executed in the corporate name by the president ora vice president (or other corporate officer accompanied by evidence of authorityto sign) and the corporate seal must be affixed and attested by the secretary oran assistant secretary. The corporate address and state of incorporation mustbe shown below the signature. If requested, the person signing a Bid for acorporation or partnership must produce evidence satisfactory to the City of theperson's authority to bind the corporation or partnership. If the Bidder is acorporation, and if the Bid is executed by someone other than the president orvice president of the corporation, attach to the Bid a certified copy of corporateresolutions of the board of directors of the corporation authorizing the person toexecute the Bid on behalf of the corporation.13.4 Bids by partnerships must be executed in the partnership name and signed by apartner, whose title must appear under the signature and the official address ofthe partnership must be shown below the signature.Section 00100 00100- 9


13.5 Bids submitted by firms under "joint venture" arrangements or other multi-partyagreements must submit a power of attorney delegating authority to one principalwith authority to negotiate and execute any/all contract documents resulting fromnegotiations/award of this Invitation to Bid.13.6 All names and titles must be typed or printed in black ink below the signature.13.7 The Bid shall contain an acknowledgment of receipt of all Addenda (the numbersof which shall be filled in on the Bid Form).13.8 The address in which communication regarding the Bid are to be directed mustbe shown.13.9 The business name of bidder shall be clearly typed, printed or stamped at the topof each page of the Bid Form.13.10 If not submitting a bid, respond by returning only the Statement of No Bid, andgive the reason in the space provided. Failure to respond three (3) times insuccession without justification may be cause for removal of the Bidders namefrom the mailing list.13.11 A Bidder must have at the time of bid opening, a company in operation, (ifapplicable) or be a fully authorized agent or representative of the product bid,and capable of producing or providing the items bid, and follow-up parts andservice, including any warranty services as applicable, and so provide suchcertification upon request.13.12 The City reserves the right to inspect the Bidder's facilities at any reasonabletime, during normal working hours, to determine that Bidder has a bona fideplace of business, and is a responsible Bidder.ARTICLE 14 - SUBMISSION OF BIDS14.1 Bids shall be submitted before the time and at the place indicated in theAnnouncement and Bid Documents, and shall be submitted in an opaque sealedenvelope. The envelope shall be marked on the exterior "BID NORMANDYBOULEVARD SECTION “B”, BID NO. ITB # PW 13-05” with the name, addressand Florida Contractor's License Number of the Bidder and accompanied by theBid Security and other required documents. If the Bid is sent through the mail orother delivery system, the sealed envelope shall be enclosed in a separateenvelope with the notation "SEALED BID ENVELOPE ENCLOSED" on the facethereof. The City will in no way be responsible for delays caused by the UnitedStates Postal Service or for delays caused by any other occurrence or deliveryservice. Mailed bids shall be sent to the attention of Brian Boehs, PurchasingAgent for the City of Deltona.14.2 Each Bid must contain one (1) original and two (2) copies of the followingdocuments in completed form:Section 00100 00100- 10


1. Bid Response Forms (Bidding Documents, entire Section 00300).2. Bidders Contact and Information Form (Section 00301).3. References (Section 00301-A).4. Questionaire Form (Section00301-B)5. Sub-Contractors and Affiliates Form (Section 00301-C)6. Bid Bond or security (surety bond or cashier's check). (Section 00410).7. Power of Attorney (for surety bond only).8. Corporate Resolution (any corporate employee other than president orvice-president, Section 00420).9 Sworn Statement Pursuant to Section 287.133(3)(a), Florida Statutes onPublic Entity Crimes (Section 00470)10. Non-collusion Affidavit (Section 00480).11. Trench Safety Affidavit (Section 00490).14.3 More than one (1) Bid received for the same work from an individual, firm orpartnership, a Corporation or Association under the same or different names willnot be considered. Reasonable grounds for believing that any Bidder isinterested in more than one (1) Bid for the same work will cause the rejection ofall such Bids in which the Bidder is interested. If there are reasonable groundsfor believing that collusion exists among the Bidders, the Bids of participants insuch collusion will not be considered. Bids in which the prices obviously areunbalanced will be subject to rejection.14.4 Neither the City nor its representatives shall be liable for any expenses incurredin connection with preparation of a response to this Invitation to Bid. Biddersshould prepare their bids simply and economically, providing all information andprices as required.ARTICLE 15 - MODIFICATIONS AND WITHDRAWAL OF BIDS15.1 Bids may only be modified or withdrawn by an appropriate document dulyexecuted (in the manner that a Bid must be executed) and delivered to the placewhere Bids are to be submitted at any time prior to the deadline for submittingBids. A request for withdrawal or a modification must be in writing and signed bya person duly authorized to do so; and, in case signed by a deputy orsubordinate, the principals proper written authority to such deputy or subordinatemust accompany the request for withdrawal or modifications. Withdrawal of aBid will not prejudice the rights of a Bidder to submit a new Bid prior to the BidDate and Time. After expiration of the period for receiving Bids, no Bid may bewithdrawn, modified, or explained.15.2 If within twenty-four (24) hours after Bids are opened, any Bidder files a dulysigned written notice with City and within forty-eight (48) hours thereafterdemonstrates to the reasonable satisfaction of the City that: a) there has been amaterial and substantial mistake in the preparation of the Bid; b) the mistake is ofsuch great consequence that to enforce the Contact would be unconscionable;and c) the mistake occurred notwithstanding the exercise of reasonable care inthe preparation of the Bid; the Bidder may withdraw its Bid, and the Bid SecuritySection 00100 00100- 11


will be returned provided that the City is not seriously prejudiced, except for theloss of its bargain.ARTICLE 16 – ACCEPTANCE/REJECTION16.1 The City reserves the right to accept or reject any or all bids and to make theaward to that Bidder, who in the opinion of the City will be in the best interest ofand/or the most advantageous to the City. The City also reserves the right toreject the bid of any vendor who has previously failed in the proper performanceof an award or to deliver on time contracts of a similar nature or who, in the City'sopinion, is not in a position to perform properly under this award. The Cityreserves the right to inspect all facilities of bidders in order to make adetermination as to the foregoing. The City reserves the right to waive anyirregularities, informalities, and technicalities in offers received, and may, at itsdiscretion, request a re-bid, or abandon the project/procurement in its entirety.ARTICLE 17 - OPENING OF BIDS17.1 Shall be public, at the above address, on the date and at the time specifiedabove. The bid time shall be scrupulously observed. Under no circumstancesshall bids delivered after the time specified be considered; such bids will bereturned unopened. The City will not be responsible for late deliveries or delayedmail. The time/date stamp clock located in the Public Works Division serves asthe official authority to determine lateness of any bid. It is the Bidders soleresponsibility to assure that his/her bid is complete and delivered at the propertime and place of the bid opening. Bids which for any reason are not sodelivered will not be considered. Offers by facsimile, telegram or telephone arenot acceptable. A bid may NOT be altered by the Bidder after opening of thebids. Bid tabulations will be furnished upon written request which includes a selfaddressed,stamped envelope.Persons with disabilities needing assistance to participate in the Public BidOpening should contact the Tom Cinefro at least 48 hours in advance of themeeting at 386-878-8955.ARTICLE 18 - BIDS TO REMAIN OPEN18.1 All Bids shall remain open for delivery by the City of the Notice of Award forninety (90) calendar days after the day of the Bid opening, but City may, at itssole discretion, release any Bid and return the Bid Security prior to that date.18.2 Extensions of time when Bids shall remain open beyond the ninety (90) dayperiod may be made only by mutual agreement between City, the Apparent LowBidder, and the surety, if any, for the Apparent Low Bidder.ARTICLE 19 – CERTIFICATES, DISCOUNTS, MISTAKES19.1 The City reserves the right to require proof that the bidder is an establishedbusiness and is abiding by the Ordinances, Regulations, and Laws of theirSection 00100 00100- 12


Community and the State of Florida such as but not limited to: OccupationalLicenses, Business Licenses, Florida Sales Tax Registration, Federal EmployeeIdentification Number.ARTICLE 20 – DISCOUNTS20.1 Cash discounts for prompt payment shall not be considered in determining thelowest net cost for bid evaluation purposes.ARTICLE 21 – MISTAKES21.1 Bidders are expected to examine the terms and conditions, specifications,delivery schedule, bid prices, extensions and all instructions pertaining tosupplies and services. FAILURE TO DO SO WILL BE AT BIDDER'S RISK. Inthe event of extension error(s), the unit price will prevail and the Bidder's totaloffer will be corrected accordingly. Written amounts shall take precedence overnumerical amounts. In the event of addition errors(s), the unit price, andextension thereof, will prevail and the Bidder's total offer will be correctedaccordingly. Bids having erasures or corrections must be initialed in ink by theBidder.ARTICLE 22 - AWARD OF CONTRACT22.1 City reserves the right to reject any and all Bids, to waive any and all informalitiesand reserve the right to disregard all non-conforming, non-responsive orconditional Bids. Bids may be considered irregular and subject to rejection if inthe opinion of the City, they show serious omission, unauthorized alternations ofform, unauthorized alternate Bids, incomplete or unbalanced unit prices, orirregularities of any kind. The City may reject, as non-responsive, any or all Bidswhere Bidders fail to acknowledge receipt of addenda as prescribed.Discrepancies between words and figures will be resolved in favor of words.Discrepancies between the indicated sum of any column of figures and thecorrect sum thereof will be resolved in favor of the correct sum. Errors in themultiplication of unit prices by the number of units will be resolved in favor of thecorrect product.22.2 If the Contract is to be awarded, it will be awarded to the most responsive,responsible, and lowest Bidder. Substitutions or "or equal" items listed in Section00300 - Schedule of Manufacturers/Suppliers will not be considered whendetermining the lowest responsive bidder.22.3 The City in its sole discretion, reserves the right to reject any and all bids and towaive any informality concerning Bids whenever such rejection or waiver is in thebest interest of the City. The ability of a Bidder to obtain a performance andpayment bond shall not be regarded as the sole test of such Bidder'scompetency or responsibility. Nothing contained herein shall place a duty uponSection 00100 00100- 13


the City to reject Bids or award the contract based upon anything other than itssole discretion as described herein.22.4 City may consider the qualifications and experience of Bidders and other personsand organizations (including those who are to furnish the principal items ofmaterials or equipment) proposed for those portions of the Work as to which theidentity of Subcontractors and other persons and organizations must besubmitted as provided in Article 12 of these Instructions to Bidders.22.5 City may conduct such investigations and require supplemental information as hedeems necessary to assist in the evaluation of any Bid and to establish theresponsibility, qualifications and financial ability of the Bidders, proposedSubcontractors and other persons and organizations to do the Work inaccordance with the Contract Documents to the City's satisfaction within theprescribed time. City reserves the right to reject the Bid of any Bidder who doesnot pass any such evaluation to City's satisfaction.22.6 One (1) Contract for the Work will be awarded, if award is made, to the lowestresponsible, responsive Bidder. The Apparent Low Bidder who is awarded theContract will be required to perform the Work as a Prime Contractor. Noassignment of the Contract will be allowed without written permission of the City.22.7 The Apparent Low Bidder shall submit, upon request of the City, documentationevidencing its capability to perform classes of work contemplated, and thenecessary plant and sufficient capital to execute the work properly within the timespecified. Operating costs, maintenance considerations, performance data andguarantees of materials and equipment may considered by the City.22.8 Recommendation for award will be posted for review by interested parties onDemandStar. Failure to file a protest to Purchasing within the time prescribed inthe City’s Purchasing Manual, shall constitute a waiver of proceedings.22.9 If the Contract is to be awarded, the City will give the Apparent Low Bidder aNotice of Award within ninety (90) days after the date of the bid opening subjectto the conditions in Article 22 of these Instruction to Bidders.22.10 As the best interest of the City may require, the right is reserved to makeaward(s) by individual item, group of items, "All or None", or a combinationthereof; with one or more suppliers; to reject any or all bids, or waive any minorirregularity or technicality in bids received, award or eliminate an portion of thebid, and may, at it's sole discretion, request a re-bid, or abandon the project init's entirety. Bidders are cautioned to make no assumption until the City hasentered into a contract or issued a purchase order.22.11 Upon award recommendation or ten (10) days after opening, whichever is earlier,bids become "public records" and shall be subject to public disclosure consistentwith Chapter 119.07(3)(o), Florida Statutes. Bidders must invoke the exemptionsto disclosure provided by law in the response to the Bid, and must identify thedata or other materials to be protected, and must state the reasons why suchSection 00100 00100- 14


exclusion from public disclosure is necessary. Bids may be reviewed at PublicWorks Division, 255 Enterprise Road, Deltona, FL 32725.ARTICLE 23 – ADDITIONAL TERMS AND CONDITIONS23.1 Unless expressly accepted by the City, the following conditions shall apply: Noadditional terms and conditions included with the bid response shall beconsidered. Any and all such additional terms and conditions shall have no forceand effect, and are inapplicable to this bid if submitted either purposely throughintent or design, or inadvertently appearing separately in transmittal letters,specifications, literature, price lists or warranties. It is understood and agreedthat the general and/or any special conditions in these Bid Documents are theonly conditions applicable to this bid and the Bidder's authorized signature on theBid Response Form attests to this. Exceptions to the terms and conditions willnot be accepted.ARTICLE 24 - QUALIFICATIONS SUBMITTALS24.1 It is the intention of the City to award this contract to a Bidder competent toperform and complete the Work in a satisfactory manner. Accordingly, City willrequire the Apparent Low Bidder to submit, within seven (7) days after bidopening, information including, but not limited to, the following, l) evidence ofBidder's certification and license to perform the Work and services; 2) experiencewith references; 3) financial statement; 4) subcontractor listing; 5) PreliminaryProgress Schedule; and 6) Preliminary Schedule of Values all as set forth below,to allow City to conduct qualifications investigations.24.2 The experience and financial statement shall provide data additional to thatinformation provided in the Bid Form pertaining to Contractor's financialresources, adequacy of plant and equipment, manpower, organization, and priorexperience with references and a list of all previous or on-going constructioncontracts over the last five (5) years. Said information shall be certified by aCertified Public Accountant, and shall be submitted on the Associated GeneralContractors of America Form "Standard Questionnaires and Financial Statementfor Bidders," available from AGC, 1975 "E" Street, NW Washington, DC 20006.The City at its discretion may require any or all of the above listed informationfrom any other Bidder.24.3 The Preliminary Progress Schedule shall consist of three (3) copies of a diagramand a narrative in accordance with appropriate formats set forth in Section01310; Progress Schedules, incorporated by reference herein. Activities in thediagram shall show the order in which the Apparent Low Bidder proposes toperform the Work within the constraints and sequencing conditions set forth inthe specifications and shall indicate starting and completion dates for keymilestones and work pertaining to each Division of the Specifications within eachmajor structure or geographical area of work. Activities shall further identifysignificant submittals/approvals, major equipment deliveries, equipment testing,City's responsibilities, and those of affected utilities and other similarity involvedthird parties.Section 00100 00100- 15


24.4 The Preliminary Schedule of Values shall match the Bid Items in Section 00300Bid Response Form.24.5 The Apparent Low Bidder and his surety, if any, hereby agree that any delayswithin Bidder's control in the delivery of these Qualifications Submittals willrequire a written request by Bidder for an extension of the time during which theBid shall remain open for the City's acceptance. Should City agree to suchextension, Bidder will be required to comply with this Submittal Requirementwithin five (5) additional calendar days. At the City's option, failure by theApparent Low Bidder to deliver these Qualifications Submittals within theextended period will void evaluation of the Bid and will constitute proof that theApparent Bidder has abandoned his Bid; his Bid Security shall be declaredforfeited to the City as liquidated damages, and the Work shall be awarded toanother Bidder.24.6 If upon receipt and evaluation of the submittals the Apparent Low Bidder doesnot pass the evaluations to City's satisfaction, City reserves the right to reject theBid.ARTICLE 25 - BONDS AND INSURANCE25.1 The General Conditions as amended by the Supplementary Conditions sets forthCity's requirements as to Bonds and Insurance. When the Successful Bidderdelivers the executed Agreement to City, it shall be accompanied by the requiredBonds, Insurance Certificates and Endorsements.ARTICLE 26 -SIGNING OF AGREEMENT26.1 The contents of this Bid and all provisions of the successful bid deemed pertinentby the City may be incorporated into a contract and become legally binding. Aseparate contract document, other than the purchase order, may not be issued.Any and all legal action necessary to enforce a contract or purchase order will beinterpreted according to the laws of Florida. The venue shall be County ofVolusia, Florida.26.2 When City gives a Notice of Award to the Apparent Low Bidder, it will beaccompanied by at least two (2) unsigned counterparts of the Agreement and allother Contract Documents. Within the (10) days of receipt thereafter, ApparentLow Bidder shall sign and deliver at least two (2) counterparts of the Agreementto the City together with the documents required in Article 14 above. Within ten(10) days of receipt of the properly executed and completed submittals, City willdeliver a fully signed counterpart to Bidder.26.3 Failure by a Successful Bidder, to whom the Contract is awarded, to execute theAgreement or to furnish the required Bonds or insurance certificates andendorsements shall be just cause for the annulment of the award and theforfeiture of the Bid Security.Section 00100 00100- 16


26.4 A Successful Bidder who is awarded the Contract and fails to execute theAgreement or furnish the required Bonds or insurance certificates andendorsements within the period specified in Article 22 above, shall be liable tothe City for all damages resulting therefrom including reasonable engineer's andattorney's fees and costs, and engineer's and attorney's fees and costs onappeal. The Bid Security forfeited shall not be a limitation thereon.ARTICLE 27 - AVAILABILITY OF LANDS FOR WORK27.1 The lands upon which the Work is to be performed, rights-of-way and easementsfor access thereto and other lands designated for use by Contractor inperforming the Work are identified in the Contract Documents. All additionallands and access thereto required for temporary construction facilities,construction equipment or storage of materials and equipment to be incorporatedin the Work are to be obtained and paid for by Contractor. Easements forpermanent structures or permanent changes in existing facilities are to beobtained and paid for by City unless otherwise provided in the ContractDocuments.ARTICLE 28 - TAXES AND FEES28.1 The City is exempt from Federal Excise and State Sales Taxes on directpurchases of tangible personal property. The City's exemption numbers are onthe face of the purchase order. If requested, the Purchasing Agent will providean exemption certificate to the awarded Bidder. Vendors/contractors doingbusiness with the City shall not be exempted from paying sales tax to theirsuppliers for materials to fulfill contractual obligations with the City nor shall anyVendor/Contractor be authorized to use the City's Tax Exemption Number insecuring such materials.28.2 The Contractor shall pay all applicable sales, consumer, use and other similartaxes required by law. The Contractor is responsible for reviewing the pertinentState statutes involving the sales tax and complying with all requirements.ARTICLE 29 - RELATED WORK UNDER SEPARATE CONTRACTS29.1 The Bidder's attention is directed to the fact that the Work to be done under thiscontract is part of an overall system. The success of the Project is dependentupon the completion of the Work under this contract and the work to be done byothers.ARTICLE 30 - ORGANIZATION OF DRAWINGS AND PROJECT MANUAL30.1 Drawings and Project Manual for the Work are incorporated as follows:The Project Manual has been organized and bound into one (1) volume asfollows:Division 0 - Bidding and Contract RequirementsSection 00100 00100- 17


Division 1 - General RequirementsDivision 2 - SiteworkRoadway Plans – Bowyer-Singleton & Associates, Inc.Utility Plans - Tetra TechARTICLE 31 - REQUIRED DISCLOSURE31.1 With its Bid submission, Bidder shall disclose all material facts pertaining to anyfelony conviction or any pending felony charges in the last three (3) years in thisState or any other state of the United States against (i) Bidder, (ii) any businessentity related to or affiliated with Bidder, or (iii) any present or former executiveemployee, officer, director, stockholder, partner or owner of Bidder or of any suchrelated or affiliated entity. This disclosure shall not apply to any person or entitywhich is only a stockholder, which person or entity owns 20 percent (20%) or lessof the outstanding share of a Bidder whose stock is publicly owned and traded.31.2 At its sole discretion, the City may reject any Bidder it finds to lack, or whosepresent or former executive employees, officers, directors, stockholders, partnersor owners are found by the City to lack honesty, integrity, or moral responsibility.The discretion of the City may be exercised based on the disclosure requiredherein, the City's own investigation, public records, or any other reliable sourcesof information. The City may also reject any Bidder failing to make the disclosurerequired herein. By submitting a Bid, Bidder recognizes and accepts that the Citymay reject the Bid based upon the exercise of its sole discretion and Bidderwaives any claim it might have for damages or other relief resulting from therejection of its Bid based on these grounds.ARTICLE 32 - COMPLIANCE WITH OCCUPATION SAFETY AND HEALTH ACT(O.S.H.A.)32.1 Bidder certifies that all material, equipment, etc., contained in his/her bid meetsall applicable O.S.H.A. requirements. Bidder further certifies that, if he/she is thesuccessful Bidder, and the material, equipment, etc., delivered is subsequentlyfound to be defective in any applicable O.S.H.A. requirement in effect on the dateof delivery, all costs necessary to comply with the requirements shall be borne bythe Bidder. The Bidders signature upon the Bid Response Form (Section 00300)is considered Certification of Conformance to such requirements.ARTICLE 33 - PROTESTS33.1 Any Bidder who disputes the bid selection or contract award recommendationshall file such protest according to the bid protest procedures. These proceduresare available upon request from the City.ARTICLE 34 – CONFLICT OF INTEREST34.1 All Bidders must disclose with their bid the name of any officer, director, or agentwho is also an employee of the City. All Bidders must disclose the name of anySection 00100 00100- 18


City employee who owns, directly or indirectly, an interest of five percent (5%) ormore in the Bidder's firm or any of its branches.ARTICLE 35 – LEGAL REQUIREMENTS35.1 Bidders are required to comply with all provisions of Federal, State, City and locallaws and ordinances, rules and regulations, that are applicable to the items beingbid. Lack of knowledge by the Bidder shall in no way be a cause for relief fromresponsibility, or constitute a cognizable defense against the legal effect thereof.ARTICLE 36 – DRUG-FREE WORKPLACE36.1 Preference shall be given to business with Drug-Free Work Place (DFW)programs. Whenever two or more bids which are equal with respect to price,quality, and service are received by the City for the procurement of commoditiesor contractual services, a bid received from a business that completes theattached DFW form certifying that it is a DFW shall be given preference in theaward process.ARTICLE 37 – EEO STATEMENT37.1 The City is committed to assuring equal opportunity in the award of contracts,and, therefore complies with all laws prohibiting discrimination on the basis ofrace, color, religion, national origin, age or sex.ARTICLE 38 – GOVERNMENTAL RESTRICTIONS38.1 In the event that any governmental restrictions are imposed which wouldnecessitate alteration of the material quality, workmanship or performance of theitems offered on this bid prior to their delivery, it shall be the responsibility of theBidder to notify Purchasing at once, indicating in his/her letter the specificregulation which required an alteration, including any price adjustmentsoccasioned thereby. The City reserves the right to accept such alteration or tocancel the contract or purchase order at no further expense to the City.ARTICLE 39 – ADVERTISING39.1 In submitting a bid, Bidder agrees not to use the results therefrom as a part ofany commercial advertising, without the express written approval, by theappropriate level of authority within the City.ARTICLE 40 – ASSIGNMENT40.1 Any purchase order or contract issued pursuant to this Invitation to Bid and themonies which may become due hereunder are not assignable except with theprior written approval of the City, through the Finance Department.Section 00100 00100- 19


ARTICLE 41 – ADJUSTMENTS / CHANGES / DEVIATIONS41.1 No adjustments, changes or deviations shall be accepted on any item unlessconditions or specifications of a bid expressly so provide. Any other adjustments,changes or deviations shall require prior written approval, and shall be bindingONLY if issued by the City's Finance Department. The Bidder shall bear soleresponsibility for any and all costs of claims arising from any adjustments,changes or deviations not properly executed as required hereinARTICLE 42 – PURCHASING AGREEMENTS WITH OTHER GOVERNMENTAGENCIES42.1 All Bidders submitting a response to this Invitation to Bid agree that suchresponse also constitutes a bid to all governmental agencies, under the sameconditions, for the same contract price, and for the same effective period as thebid, should the Bidder feel it is in their best interest to do so. Each governmentalagency shall be responsible for its own purchases and each shall be liable onlyfor materials and/or services ordered and received by it, and no agency assumesany liability by virtue of this bid. This agreement in no way restricts or interfereswith the right of any governmental agency to rebid any or all items.ARTICLE 43 – CERTIFICATES, LICENSES, REGISTRATIONS43.1 Proof of Vendor’s State of Florida, Department of Business RegulationCertification shall be provided with their bid submittal. The work shall beperformed under a Florida Contractor’s License and shall not be awarded unlessproof of valid license(s) is provided. The City reserves the right to require proofthat the bidder is an established business and is abiding by the Ordinances,Regulations, and Laws of their Community and the State of Florida such as butnot limited to: Occupational Licenses, Business Licenses, Florida Sales TaxRegistration, and Federal Employee Identification Number.ARTICLE 44 – REFERENCES44.1 Bidder shall submit with the bid, eight (8) references (form attached) for projectsof similar scope. Failure to provide this information with the bid may result in bidbeing declared non-responsive.ARTICLE 45 – SUBMITTALS45.1 All submittals are REQUIRED and shall be submitted with the bid package at thetime of the bid opening to be considered a responsive bidder. Faxed orElectronically submitted Bids shall not be accepted. Bidding companies shallsubmit four (4) COMPLETE SETS (one [1] original, two [2] copies and one [1]electronic copy [CD] of their submittal. The CD shall be an exact duplicate of thehard copies and should be one complete file (PDF preferred) not a series of files.These documents constitute the complete set of terms and conditions,specification requirements, and bid forms. All bid sheets and attachments mustbe executed and submitted in a sealed envelope. Bids not submitted on theSection 00100 00100- 20


enclosed Bid Form shall be rejected. SUBMITTAL OF A BID IN RESPONSE TOTHIS INVITATION TO BID CONSTITUTES AN OFFER BY THE BIDDER. Bidswhich do not comply with these requirements may be rejected at the option of theCity.ARTICLE 46 – UNUSUAL CIRCUMSTANCES46.1 If during a contract term where costs to the City are to remain firm or adjustmentsare restricted by a percentage or CPI cap, unusual circumstances that could nothave been foreseen by either party to the contract occur, and thosecircumstances significantly affect the Seller’s cost in providing the required itemsor services, then the Seller may request adjustments to the costs to the City toreflect the changed circumstances. The circumstances must be beyond thecontrol of the Seller, and the requested adjustments must be fullydocumented. The City may, after examination, refuse to accept the adjustedcosts if they are not properly documented, increases are considered to beexcessive, or decreases are considered to be insufficient. In the event the Citydoes not wish to accept the adjusted costs and the matter cannot be resolved tothe satisfaction of the City, the City will reserve the following options:46.2 The contract can be canceled by the City upon giving thirty (30) days writtennotice to the Seller with no penalty to the City or Seller. The Seller shall fill allCity requirements submitted to the Seller until the termination date contained inthe notice.46.3 The City requires the Seller to continue to provide the items and services at thefirm fixed (non-adjusted) cost until the termination of the contract term then ineffect.46.4 If the City, in its interest and in its sole opinion, determines that the Seller in acapricious manner attempted to use this section of the contract to relievethemselves of a legitimate obligation under the contract, and no unusualcircumstances had occurred, the City reserves the right to take any and all actionunder law or equity. Such action shall include, but not be limited to, declaring theSeller in default and disqualifying him for receiving any business from the City fora state period of time.46.5 If the City does agree to adjusted costs, these adjusted costs shall not beinvoiced to the City until the Seller receives notice in writing signed by a personauthorized to bind the City in such matters.ARTICLE 47 - INVOICING AND PAYMENTSection 00100 00100- 21


47.1 Payment for any and all invoice(s) that may arise as a result of a contract orpurchase order issued pursuant to this bid specification shall minimally meet thefollowing conditions to be considered as a valid payment request:47.2 A timely submission of a properly certified invoice(s), in strict accordance with theprice(s) and delivery elements as stipulated in the contract or purchase orderdocument, and be submitted to the Finance Department at the address asstipulated on the Purchase Order.47.3 All invoices submitted shall consist of an original and one (1) copy; clearlyreference the subject contract or purchase order number; provide a sufficientsalient description to identify goods or service for which payment is requested;contain date of delivery; original or legible copy of signed delivery receipt includingboth manual signature and printed name of a designated City employee orauthorized Agent; be clearly marked as invoice.47.4 The invoice shall contain the Bidder's Federal Employer Identification Number(F.E.I.N.).47.5 The City's terms are "Net 30 Days" after acceptance of goods or services andreceipt of an acceptable invoice as described herein. Any discounts must beoffered on the Bid Response Form.ARTICLE 48 - POSTING OF BID AWARD48.1 Recommendation for award will be posted for review by interested parties onDemandStar. Failure to file a protest with the Purchasing Department within thetime prescribed in the CITY's Purchasing Manual, shall constitute a waiver ofproceedings.48.2 Recommendation for award will be posted for review by interested parties onDemandStar. Failure to file a protest with the Purchasing Department within thetime prescribed in the CITY's Purchasing Manual, shall constitute a waiver ofproceedings.ARTICLE 49 – PERMITS, LICENSES AND FEES49.1 Any permits, licenses, or fees required will be paid for by the Contractor and theresponsibility of the Contractor, no separate or additional payment will be made.Adherence to all applicable code regulations (Federal, State, City, City) are theresponsibility of the Contractor.ARTICLE 50 – ASSIGNMENTSection 00100 00100- 22


50.1 Any purchase order or contract issued pursuant to this Invitation to Bid and themonies which may become due hereunder are not assignable except with the priorwritten approval of the City, through the Finance Department.ARTICLE 51 – FACILITIES51.1 The City reserves the right to inspect the Bidder's facilities at any reasonable time,during normal working hours, to determine that Bidder has a bona fide place ofbusiness, and is a responsible Bidder.ARTICLE 52 - BID PREPARATION COSTS52.1 Neither the CITY nor its representatives shall be liable for any expenses incurredin connection with preparation of a response to this Invitation to Bid. Biddersshould prepare their bids simply and economically, providing all information andprices as required.ARTICLE 53 – ADDITIONAL TERMS AND CONDITIONS53.1 Unless expressly accepted by the City, the following conditions shall apply: Noadditional terms and conditions included with the bid response shall beconsidered. Any and all such additional terms and conditions shall have no forceand effect, and are inapplicable to this bid if submitted either purposely throughintent or design, or inadvertently appearing separately in transmittal letters,specifications, literature, price lists or warranties. It is understood and agreedthat the general and/or any special conditions in these Bid Documents are theonly conditions applicable to this bid and the Bidder's authorized signature on theBid Response Form attests to this. Exceptions to the terms and conditionswillnot be accepted.END OF SECTIONSection 00100 00100- 23


Division 02TECHNICAL SPECIFICATIONS02-101MOBILIZATIONMobilization shall include all items detailed in Article 101 of the “Florida Departmentof Transportation Standard Specifications for Road and Bridge Construction”, theSupplemental Conditions and on the plans, except as directed by the Engineer.Basis of PaymentThe work and incidental costs covered under Mobilization will be paid for at thecontract lump sum price and will be paid in partial payments in accordance withArticle 101-2.2. Mobilization will be limited to 10% of the Roadway ConstructionSubtotal Bid. Roadway Construction Subtotal Bid is defined as the total of all lineitems, exclusive of any alternatives or options, and exclusive of the Mobilization lineitem. Any remaining amount will be paid upon completion of all work on the project.GENERAL REQUIREMENTS, BONDS, PERMITSGeneral RequirementsBid BondsPerformance BondsPermitsINDEMNIFICATIONThe Contractor shall indemnify, defend, and hold harmless the CITY and all its officers,agents, and employees, from all claims, losses, damages, costs, charges, or expensesarising out of any acts, action, neglect, or omission by the Contractor during theperformance of the Contract, whether direct or indirect, and whether to any person orproperty to which the CITY or said parties may be subject, except that neither theContractor nor any of its subcontractors are liable under this Section for damagesarising out of the injury or damage to persons or property directly caused or resultingfrom the sole negligence of the CITY or any of its officers, agents, or employees.Payment shall be made under:Item No. 101-1 Mobilization Lump SumSection 02-101 02-101-1


Division 02TECHNICAL SPECIFICATIONS02-102MAINTENANCE OF TRAFFICAll Maintenance of Traffic work shall conform to the requirements of Section 102 of the"Standard Specifications", the plans, and/or as herein modified, except as directed by theEngineer.The road shall be kept open to local traffic on a paved surface during construction. TheContractor will not be permitted to isolate residences or places of business. Access shall beprovided to all residences and all places of business whenever construction interferes with theexisting means of access. Prior to the end of the workday, any drop-off occurring as a result ofconstruction shall be treated using the optional shoulder treatment shown on FDOT StandardIndex 600.The Contractor shall furnish, erect and maintain all necessary traffic control devices, includingflagmen and pilot cars, in accordance with the “Design Standards” dated 2006 Index 600 Seriesand the "Manual of Uniform Traffic Control Devices for Streets and Highways" published by theU.S. Department of Transportation, Federal Highway Administration. The Contractor shallprovide and maintain in a safe condition temporary approaches, crossings, and intersectionswith trails, roads, streets, business parking lots, residences and garages. The Contractor shalltake all necessary precautions for the protection of the work and the safety of the public inaccordance with Section 102.Contractor shall maintain access to all side streets and driveways within the work zone at alltimes.Work shall take place during daytime hours only – 8:30 AM to 4:30 PM Monday through Friday.The contractor shall utilize applicable FDOT Index 600 Series for all work.The Contractor shall present his Maintenance of Traffic Plan to the Engineer at thepreconstruction conference as required by Article 01200,102-E.10.Basis of PaymentAll materials, work and incidental costs related to Maintenance of Traffic will be paid for at thecontract lump sum price. All material, labor and equipment necessary for the construction andmaintenance of temporary driving lanes, side streets, and driveway connections as may bedirected by the Engineer shall be included in the contract price.Payment will be made under:Item No. 102-1 Maintenance of TrafficItem No. 102-3 Commercial Material for Driveway MaintenanceLump SumPer Cubic YardSection 02-102 02-102-1


Division 02TECHNICAL SPECIFICATIONS02-104EROSION CONTROLErosion Control shall include all items detailed in Article 104 of the “StandardSpecifications”, the Special Provisions and on the plans, except as directed bythe Engineer.Basis of PaymentAll materials, work and incidental costs related to Erosion Control will be paid forat the Contract Unit Price.Payment shall be made under:Item No. 104-10 Synthetic Bales Per Lineal FootItem No. 104-11 Floating Turbidity Barrier Per Lineal FootItem No. 104-12 Staked Turbidity Barrier Per Lineal FootItem No. 104-13 Silt Fence Staked (Type III) Per Lineal FootItem No. 104-16 Rock Bags Per EachSetion 02-104 02-104-1


Division 02TECHNICAL SPECIFICATIONS02-104EROSION CONTROLErosion Control shall include all items detailed in Article 104 of the “StandardSpecifications”, the Special Provisions and on the plans, except as directed bythe Engineer.Basis of PaymentAll materials, work and incidental costs related to Erosion Control will be paid forat the Contract Unit Price.Payment shall be made under:Item No. 104-10 Synthetic Bales Per Lineal FootItem No. 104-11 Floating Turbidity Barrier Per Lineal FootItem No. 104-12 Staked Turbidity Barrier Per Lineal FootItem No. 104-13 Silt Fence Staked (Type III) Per Lineal FootItem No. 104-16 Rock Bags Per EachSetion 02-104 02-104-1


Division 02TECHNICAL SPECIFICATIONS02-110CLEARING AND GRUBBINGAll clearing and grubbing shall be performed in accordance with the requirements ofSection 110 of the "Standard Specifications", except as directed by the Engineer.BASIS OF PAYMENTAll work and incidental costs required to perform clearing and grubbing as hereinspecified will be paid for at the contract unit prices.Payment shall be made under:Item No. 110-1-1 Clearing and Grubbing AcreItem No. 110-7-1 Mailbox, F&I, Single EachSection 02-110 02-110-1


Division 02TECHNICAL SPECIFICATIONS02-120EXCAVATION, EMBANKMENT AND GRADINGAll excavation, embankment and grading work shall conform to the requirements ofSection 120 of the "Standard Specifications" and the provisions of this section, exceptas directed by the Engineer.Basis of PaymentExcavation, Embankment and Grading will be paid for at the contract unit price.Payment shall constitute full compensation for all work described herein and in theSpecial Provisions and shall include grading of shoulders, graded road connections,slopes, compaction, final dressing, subsoil excavation and replacement material, and allwork required for completing the project that is not paid for under the other pay items.Also included are removal and off-site disposal or on-site utilization of all materials,structures, abandoned utilities and obstructions as directed by the Engineer.Payment shall be made under:Item No. 120-1 Regular Excavation Lump SumItem No. 120-6 Embankment Lump SumSection 02-120 02-120 1


Division 02TECHNICAL SPECIFICATIONS02-160STABILIZED SUBGRADEAll work shall be performed in accordance with the requirements of Section 160 of the"Standard Specifications" and shall be constructed to the limits, thickness, andspecified limerock bearing ratio as shown on the plans, except as directed by theEngineer.Method of MeasurementQuantities of stabilized subgrade measured for payment under this Section shall be theactual area in square yards of satisfactorily installed stabilized subgrade.Basis of PaymentStabilized subgrade will be paid for at the contract unit price per square yard installedand accepted and shall include the cost of furnishing and hauling additional stabilizingmaterials required, and all mixing, shaping and compacting of the stabilized area. Theincreased thickness of the Type B stabilization under curb and gutter sections shall beconsidered incidental and included in the contract unit price.Payment shall be made under:Item No. 160-4Type B Stabilization (12”) (Min LBR 40) Per Square YardSection 02-160 02-160-1


Division 02TECHNICALSPECIFICATIONS02-331TYPE S ASPHALT CONCRETEWork specified in this Section consists of applying of Type S Asphalt Surface Courseproperly laid upon a prepared base. The plant, operations and methods andequipment shall conform to Section 220; general construction requirements shall be asspecified in Section 230; and, materials and compositions shall conform to Section 231of the "Standard Specifications", except as directed by the Engineer.Minimum stability of S Asphaltic concrete shall be 1,500 pounds as determinedby the Marshall Stability Test.The following shall be added to Article 330-9.2.2, Thickness of Layers:"Type S Asphaltic Concrete Structural Course greater than 2 inches thick shall beconstructed in 2 layers. The tack coat to be applied between the layers shall beincluded in the cost of the asphalt.Article 331-4.3, Job Mix Formula, shall be amended to read:"The Job Mix Design shall be submitted to and approved by the Engineer prior toconstructing the Asphaltic Concrete Pavement."Method of MeasurementQuantities measured for payment under this Section shall be the actual area insquare yards of asphaltic concrete installed within the limits of the contract.Basis of PaymentType S Asphaltic Concrete will be paid for at the contract unit price per squareyard completed and accepted. No additional payment will be made for thicknessgreater than indicated on the plans nor for pavement of unauthorized areas.Payment shall constitute full compensation for all labor, equipment, andmaterials, including bituminous material (plant mix), and all other incidental costsnecessary to complete the work as specified.Payment shall be made under:Item No. 331-72-20 Type S Asphaltic Concrete (2”), (Traffic Level B)(including tack coat)Square YardPerSection 02-331 02-331-1


Division 02TECHNICAL SPECIFICATIONS02-425INLETS, MANHOLES, AND JUNCTION BOXESConstruction of Inlets, Manholes and Junction Boxes shall conform to the requirements ofSection 425 of the "Standard Specifications" and applicable FDOT Design Standards andDetails contained in the plans, except as directed by the Engineer.Method of MeasurementThe quantities measured for payment under this Section shall be the number of inlets,manholes, junction boxes, yard drains, special end walls, and shallow ditch drains satisfactorilycompleted and accepted, including drainage structure under drains where required.Basis of PaymentStructures included in this Section will be paid for at the contract unit price each, completed andaccepted. Payments shall constitute full compensation for furnishing all materials andcompleting all work described herein or shown on the plans, including all excavation;dewatering; subsoil excavation and replacement material; backfilling and compacting aroundstructures; disposal of surplus material; and furnishing and placing of all concrete; reinforcingsteel; gratings; frames; covers, and any other necessary fittings as shown in the plans, requiredfor acceptable construction, or as directed by the Engineer. Where required, drainage structureunderdrains shall be included in the unit price for inlets and manholes. If pre-cast structures areused, any alteration of pipe grades up to one (1) foot to clear utilities shall be made andconnections to structures made at no additional cost to the City or utility.Payment shall be made under:Item No. 425-1-311 Inlet (Curb)(Type P-1)(


Division 02TECHNICAL SPECIFICATIONS02-430PIPE CULVERTS AND STORM SEWERSConstructing pipe culverts and storm sewers shall conform to the requirements of Section430 of the "Standard Specifications," except as directed by the Engineer. All pipes shall besteel reinforced. Lifting holes in reinforced concrete pipe are prohibited.Proposed storm sewer pipe to be connected to existing structures shall have openings cutinto the existing structure without permanently damaging the structure. The openings shallbe grouted watertight after pipe installation, and the structure shall be restored as approvedby the Engineer.The cost of connections to existing structures shall be included in the price bid for the pipe.All culverts and storm sewer pipes shall be inspected and approved by the Engineer prior tofinal paving.Concrete Pipe JointsEach joint in the concrete pipe culverts and storm sewers shall be wrapped on the exterior ofthe pipe with a band of filter fabric. The band shall be 3 feet wide centered on the joint andshall be lapped a minimum of 2 feet. The plastic filter fabric shall meet the requirements ofSection 985 of the "Standard Specifications." These costs shall be included in the per linearfoot price for the pipe.Method of MeasurementQuantities measured for payment under this Section shall be the length in linear feet of pipeculvert and storm sewer measured in place, completed and accepted. Measurements shallbe from inside face of structure wall to inside face of structure wall.Basis of PaymentPipe Culverts and Storm Sewers will be paid for at the contract unit price, completed andaccepted. The unit price shall include the integral risers, connection of proposed pipes toexisting structures and replacement of pavement and base course removed for pipetrenching. Payments shall be full compensation for all work and materials described herein,including excavation (in whatever material is encountered), dewatering, removing unsuitablematerial and replacing with select bedding material, backfilling, compacting around thepiping, furnishing and laying the pipe culverts, disposing of surplus materials, and otherworks as may be required for an acceptable installation.Payment shall be made under:Item No. 430-175-118 Pipe Culv (Opt Matl)(Round)(18” SS) Per LFItem No. 430-175-124 Pipe Culv (Opt Matl)(Round)(24” SS) Per LFItem No. 430-175-130 Pipe Culv (Opt Matl)(Round)(30” SS) Per LFItem No. 430-175-118 Pipe Culv (Opt Matl)(Elliptical)(42” SS) Per LFItem No. 430-982-125 Mitered End Section, Optional Round, 18” CDPer EAItem No. 430-982-133 Mitered End Section, Optional Round, 30” CDPer EASection 02-430 02-430- 1


Division 02TECHNICAL SPECIFICATIONS02-515PIPE HANDRAILConstruction of the aluminum pipe handrail construction shall conform to the requirements ofFDOT “Standard Specifications”, FDOT Index 860, and this Technical Provision, except asdirected by the Engineer.Method of MeasurementQuantities measured for payment under this Section shall be the linear feet of 42”Pedestrian/Bicycle Picket Railing measured in place along the length of the top rail.Basis of PaymentPipe Handrail will be paid for at the contract unit price linear foot completed and accepted.Payment shall be made under:Item No. 515-2-301 Pedestrian/Bicycle Railing, 42” Picket Railing Per FootSection 02-515 02-515-1


Division 02TECHNICAL SPECIFICATIONS02-520CONCRETE GUTTER, CURB ELEMENTS, AND TRAFFIC SEPARATORConstruction of concrete curb and gutter, concrete traffic separator, and concrete valley guttershall conform to the requirements of Section 520 of the "Standard Specifications," except asdirected by the EngineerFoundationFoundation material upon which the concrete is placed by slip forming shall be compacted asspecified and shall be moist at the time of placement. For poured in place concrete, thefoundation material shall meet the specified densities and shall be thoroughly wetted but free ofstanding water just prior to placing concrete.Contraction JointsFor machine placed items, contraction joints shall be sawed to a minimum depth of 1 1/2 inches.Sawing shall begin as soon as the concrete has hardened to the degree that excessive ravelingwill not occur. Sawing shall progress in the same direction and sequence as the concreteplacement. Every third joint shall be sawed first, then saw intermediate joints.For concrete placed before noon, all joints shall be sawed the same day of placement. Forconcrete placed after noon, all third joints shall be sawed the day of placement; all other jointsprior to noon the following day.CuringConcrete shall be cured as provided in Section 520-8, except as modified herein. Curingmaterial shall be applied to the concrete surfaces after finishing as soon as the concrete hashardened sufficiently to prevent marring the surface or within one hour after finishing iscompleted, whichever occurs first. Applying curing materials shall not be held up due to otheractivities on the project. Contractor shall schedule and provide manpower necessary to conformto these requirements.If the Contractor chooses to use membrane curing compound, it shall be Type 2,white-pigmented, meeting AASHTO M 180 requirements. Curing compound shall bethoroughly agitated before pouring from original container and periodically agitated duringapplication to prevent settlement of pigment.Spraying equipment, including spray tip and nozzle, shall be as recommended by manufacturers'printed literature, or an acceptable equal. Suggested equivalent spraying equipment are:Pump Sprayer: Model No. 1949, Chapin Mfg., (800) 444-3140Drum Pump Sprayer: 12 Volt DC # 6061, Chapin Mfg.Equipment shall be maintained and nozzles replaced as required to provide consistent uniformspray pattern.Section 02-520 02-520-1


Division 02TECHNICAL SPECIFICATIONS02-520A uniform coating meeting the manufacturer's recommended minimum application rate shall beapplied. Areas appearing to have insufficient curing compound, as determined solely by theEngineer, shall be re-coated immediately to provide required uniform coverage.Storage containers greater than five gallon capacity may be utilized only with prior approval bythe Engineer. Contractor shall submit the manufacturer's descriptive literature describing theplacement, storage and mixing requirements for storage containers exceeding five gallons.Contractor shall provide and utilize mechanical mixers for all containers larger than five gallons.The mixers shall be equivalent to the manufacture's requirements. Contractor shall conform toall storage, mixing and application requirements.RepairsWhere replacement is necessary, complete sections between contraction joints shall be removedand replaced. New Joints between initially installed contraction joints are not acceptable.Method of MeasurementQuantities to be measured for payment shall be the actual length in feet of items covered by thisSection completed and accepted.Basis of PaymentItems covered by this Section will be paid for at the contract unit price. Payment shall constitutefull compensation for all work described herein, including all labor, equipment, materials andincidentals necessary to complete each item of work.Payment shall be made under:Item No. 520-1-10 Concrete Curb & Gutter, Type F Per Linear FootSection 02-520 02-520-2


Division 02TECHNICAL SPECIFICATIONS02-522CONCRETE SIDEWALKS, 4 INCHES AND 6 INCHES THICKNESSConstruction of 4-inch and 6-inch thick concrete sidewalk shall conform to the requirements ofSection 522 of the "Standard Specifications", except as directed by the Engineer.FoundationFoundation material shall meet the specified densities and shall be thoroughly wetted but free ofstanding water just prior to placing concrete.Contraction JointsContraction joints shall be sawed. All joints shall be straight lines oriented at 90 degrees to theedge of sidewalk, radially if in a curve, or as directed otherwise. Minimum depth of joints shallbe 1 1/2 inches or 1/4 the nominal thickness of concrete placed, whichever is greater.Joint installation shall proceed in the same direction and sequence as the concrete placement.Sawing shall begin as soon as the concrete has hardened to the degree that excessive ravelingwill not occur. Every third transverse joint and all longitudinal joint shall be installed within 8hours after finishing. Remaining transverse joints, shall be installed by noon the following day.Construction JointsConstruction joints shall be constructed at the end of all pours and at other locations where theconcrete placement operations are stopped for as long as 30 minutes. They shall be placed atleast 10 feet from any other transverse construction joint or end of pavement section.Metal keyways shall be installed at all construction joints in sidewalks 6-inches and greater inthickness. Concrete thickness shall be increased by 2-inches for a minimum distance of 6-incheseither side of construction joints.CuringConcrete shall be cured as provided in Section 520-8, except as modified herein. Curingmaterial shall be applied to the concrete surfaces after finishing as soon as the concrete hashardened sufficiently to prevent marring the surface or within one hour after finishing iscompleted, whichever occurs first. Applying curing materials shall not be held up due to otheractivities on the project. Contractor shall schedule and provide manpower necessary to conformto these requirements.If Contractor chooses to use membrane-curing compound, it shall be Type 2, white-pigmented,meeting AASHTO M 180 requirements. Curing compound shall be thoroughly agitated beforepouring from original container and periodically agitated during application to prevent settlementof pigment.Section 02-522 02-522- 1


Division 02TECHNICAL SPECIFICATIONS02-522Spraying equipment, including spray tip and nozzle, shall be as recommended by manufacturers'printed literature, or an acceptable equal. Suggested equivalent spraying equipment are :Pump Sprayer: Model No. 1949, Chapin Mfg., (8900) 444-3140Drum Pump Sprayer: 12 Volt DC # 6061, Chapin Mfg.Equipment shall be maintained and nozzles replaced as required to provide consistent uniformspray pattern.A uniform coating meeting the manufacturer's recommended minimum application rate shall beapplied. Areas appearing to have insufficient curing compound, as determined solely by theCounty, shall be re-coated immediately to provide required uniform coverage.Storage containers greater than five gallon capacity may be utilized only with prior approval bythe Engineer. Contractor shall submit the manufacturer's descriptive literature describing theplacement, storage and mixing requirements for storage exceeding five gallons. Contractor shallprovide and utilize mechanical mixers for all containers larger than five gallons. The mixersshall be equivalent to or exceed the manufacture's requirements. Contractor shall conform to allstorage, mixing and application requirements.ReplacementWhere 6-inch concrete has to be replaced due to cracks, it shall be replaced with a uniformthickness of 8-inch concrete covering no less than 40 square feet and extending to existing sawedcontraction joints. Replacement concrete shall extend at least 3-inches beneath existing concreteat a minimum thickness of 3-inches.Method of MeasurementQuantities measured for payment under this Section shall be the actual area in square yards ofconcrete constructed in place.Basis of PaymentConcrete Sidewalk will be paid for at the contract unit prices, completed and accepted. Paymentshall constitute full compensation for all work described herein, and shall include all labor,equipment, materials, grading, compaction, and all incidentals necessary to complete the work tothe lines, grades, and thicknesses indicated on the plans.Subgrade preparation and additional concrete required for thickened slabs as indicated on theplans or as directed by the Engineer shall be included in the contract unit price for 6 inchconcrete sidewalk (driveway).Payment shall be made under:Item No. 522-1 Concrete Sidewalk, 4" Thick (including compaction) Per Square YardItem No. 522-2 Concrete Sidewalk, 6" Thick (including compaction) Per Square YardSection 02-522 02-522- 2


Division 02TECHNICAL SPECIFICATIONS02-524CONCRETE DITCH AND SLOPE PAVEMENTWork specified in this Section consists of the construction of concrete pavement in the flowchange of drainage ditches and on slopes in accordance with the notes and details shown in theplans, which shall conform to the requirements of Section 524 of the "Standard Specifications",except as directed by the Engineer.MaterialsProvide concrete in accordance with Section 347, performed expansion joint material inaccordance with Section 932 and filter fabric in accordance with Section 985.Method of MeasurementThe quantities to be paid for under this Section shall be the square yard of concrete ditch andslope pavement completed and accepted. No deduction shall be made for any areas occupied bymanholes, inlets, or other drainage structures or by public utility appurtenances within thepavement area.Payments shall constitute full compensation for furnishing all materials and completing all workdescribed herein or shown on the plans, and any other necessary fittings as shown in the plans foracceptable construction, or as directed by the Engineer.Basis of PaymentPayment shall be made under:Item No. 524-1-29Concrete Ditch Pavement (Reinforced) (4”) Per Square YardSection 02-524 02-524-1


Division 02TECHNICAL SPECIFICATIONS02-530RIPRAPWork specified in this Section consists of the construction of Sand-Cement or rubble Rip-Rapslope protection, which shall conform to the requirements of Section 530 of the "StandardSpecifications", except as directed by the Engineer.MaterialsPortland Cement shall be from an approved source. Fine aggregate shall be per requirements ofSection 902-3.3. Provide sacks made of jute, cotton, or scrim reinforced paper capable ofholding the sand-cement mixture without leakage. Provide sacks of uniform size and dimension,in order to provide uniformity of lines in the completed work.Method of MeasurementThe quantities to be paid for under this Section shall be the cubic yard volume of Rip-Rapcompleted and accepted. No deduction shall be made for any areas occupied by manholes,inlets, or other drainage structures or by public utility appurtenances within the pavement area.Payments shall constitute full compensation for furnishing all materials and completing all workdescribed herein or shown on the plans, and any other necessary fittings as shown in the plans foracceptable construction, or as directed by the Engineer.Basis of PaymentPayment shall be made under:Item No. 530-1 Rip-Rap, Sand-Cement Per Cubic YardSection 02-530 02-530-1


Division 02TECHNICAL SPECIFICATIONS02-570PERFORMANCE TURFEstablishing a growing, healthy turf over all areas called for on the plans by furnishing andinstalling seed, sod, fertilizer, water, and maintaining the turf areas shall be in accordance withSection 570 of the "Standard Specifications", except as directed by the Engineer.In established areas, replacement sod shall be of the same type as the existing sod, unlessotherwise approved by the Engineer.Sod at pond slopes and median areas to be Bahia sod. Sod at back of sidewalks to beBahia or match existing sod.The Contractor shall mow sodded areas twice monthly, or as required by the Engineer,until final acceptance of the work.METHOD OF MEASUREMENTQuantities measured for payment under this Section shall be the area in square yards ofsatisfactorily installed sodding.BASIS OF PAYMENTSodding will be paid for at the contract unit price per square yard, completed andaccepted. Payment shall constitute full compensation for all work described herein,including the cost of ground preparation, fertilizing, furnishing and installing sod,mowing and complete maintenance of the sodded area until final completion.Payment shall be made under:Item No. 570-1-2Sodding (includes fertilizer and water for sod)(Bahia or match to existing) - Per Square YardSection 02-570 02-570-1


Division 02TECHNICAL SPECIFICATIONS02-603TRAFFIC CONTROL DEVICESThe signalization shown on the plans shall be constructed with equipment and materials whichshall conform to Florida Department of Transportation Standard Specifications for Road andBridge Construction, Section 603 through Section 699, except where noted on the plans andindicated by the following Technical Specifications. The contractor shall furnish certificationsfrom the City of Deltona accepting all the equipment and materials.Traffic ControllersThe required traffic controllers shall be furnished and installed by the Contractor. The 60 dayburn-in required in Section 611 is deleted for the controllers.The Contractor shall furnish, install and remove temporary controllers and signals for temporarytraffic controls during the construction period. Payment will be included in Mobilization.Signal HeadsAll signal heads shall be cast aluminum with 12” glass lenses, backplates and tunnel visors asnoted on the plans.Shop DrawingsThe Contractor shall provide shop drawings for all signalization equipment and installation.These shop drawings will be reviewed and approved by the design engineer and the Engineerprior to Contractor placing orders for signalization equipment or beginning construction.Method of MeasurementQuantities measured for payment under this Section shall be for each complete signalizationunit installed.Basis of PaymentSignalization will be paid for at the lump sum prices for each unit completed and accepted. Thecost of the interconnect shall be included in the contract price for signalization. Payment shallconstitute full compensation for all work described herein and shown in the plans.Section 02-603 02-603-1


Division 02TECHNICAL SPECIFICATIONS02-700TRAFFIC CONTROL SIGNINGThe furnishing and installing of all Traffic Control Signing as shown on the plans shall conformto the requirements of Section 700 of the "Standard Specifications", except as amended herein.All traffic control signs shall be of the type specified and installed at the locations shown on theplans.The materials and methods shall comply with Sections 700-3 through 700-6 of the “StandardSpecifications” and shall be accepted by the City of Deltona prior to fabrication.Method of MeasurementArticle 700-10 of the "Standard Specifications" is deleted and the following is added:“The quantities measured for payment under this Section shall be the number of Traffic ControlHighway Signs furnished and installed as shown on the plans, satisfactorily completed andaccepted.”Basis of PaymentPrice and payment shall be full compensation for furnishing and installation of all materialsnecessary to complete the signs in accordance with the details shown in the plans; including signpanels complete with sheeting, painting, and message; sign posts and supports, footings,excavation, etc; for the lighted signs, all costs of the electrical installation for lighting, up to thepoint of connection by others; and all other work specified in this Section, including allincidentals necessary for the complete item.Payment shall be made under:Item No. 700-1 Signage, Complete Per Lump SumSection 02-700 02-700-1


Division 02TECHNICAL SPECIFICATIONS02-603Payment shall be made under:Item No. Description Unit630-1-12 Conduit (F&I) (Underground) LF630-1-14 Conduit (F&I) (Underground-Jacketed) LF632-7-1 Cable (Signal) (F&I) PI634-4-13 Span Wire Assembly (F&I) (Two Wire) (Box) PI635-1-11 Pull and Junction Boxes (F&I) (Pull Box) EA641-2-16 Prestressed Concrete Strain Pole (F&I) (Type P-VI) EA650-51-313 Traffic Signal (F&I) (3-Section) (1- Way) (Polycarbonate/LED) AS653-191 Signal Pedestrian (F&I) (LED Countdown) (1- Way) AS653-192 Signal Pedestrian (F&I) (LED Countdown) (2- Way) AS659-101 Signal Head Auxuillaries (F&I) (Backplates 3 Section) EA659-106 Signal Head Auxuillaries (F&I) (Tunnel Visor) EA606-1-103 Loop Detector, Inductive (F&I) (Type 3, 1CH, SS, S)) EA606-1-104 Loop Detector, Inductive (F&I) (Type 4, 1CH, SS, S) EA660-2-106 Loop Assembly (F&I) (Type F) AS665-13 Detector, Pedestrian (F&I) (Detector w/ Sign) EA670-5-410 Traffic Control Assembly (Modify) (NEMA) AS690-10 Traffic Signal Head Assembly, Remove EA690-20 Pedestrian Signal Assembly, Remove EA690-34-1 Complete Pole Removal (Deep Direct Burial) EA690-80 Span Wire Assembly (Remove) EA690-90 Remove Cabling and Conduit PI690-100 Signal Equipment, Miscellaneous, Remove PI699-1-1 Internally Illuminated Sign (F&I) (Street Name) EASection 02-603 02-603-1


Division 02TECHNICAL SPECIFICATIONS02-706RAISED RETRO-REFLECTIVE PAVEMENT MARKERS AND BITUMINOUSADHESIVEThe furnishing and installing of all reflective pavement markers as shown on the plans shallconform to the requirements of Section 706 of the "Standard Specifications", except as amendedherein. All reflective markers shall be Class B markers and the type shall be as shown on theplans.Method of MeasurementArticle 706-5 of the "Standard Specifications" is deleted and the following is added: Thequantity to be paid for under this Section shall be per each quantity which shall include all laborand material for the furnishing and installing of all reflective pavement markers as shown on theplans.Basis of PaymentSection 706-6 of the "Standard Specifications" is deleted and the following is added: Thequantity for the furnishing and installing of the reflective pavement markers shall be paid for atthe contract unit price per each.Payment shall be made under:Item No. 706-3Retro-Reflective Pavement Markers EASection 02-706 02-706-1


Division 02TECHNICAL SPECIFICATIONS02-711THERMOPLASTIC TRAFFIC STRIPES AND MARKINGSThe placing of thermoplastic traffic stripes and markings as shown on the plans shallconform to the requirements of Section 711 of the "Standard Specifications", except asamended herein.MaterialsAll thermoplastic pavement marking material shall be alkyd based. The use of hydrocarbonbase material shall not be allowed. Contact City of Deltona for approval of materials prior toinstalling pavement marking.Method of MeasurementThe quantities to be paid for under this Section shall be length measured in feet ofthermoplastic Traffic Stripe or the per each quantity of directional arrows as measured andaccepted by the Engineer. The payment shall include all labor and material for the placing ofall pavement, marking as shown on the plans, including removal of existing temporarypavement markings.Basis of PaymentThe quantity for the placing of the traffic stripes and marking, and removal of temporarypavement markings, shall be paid for per Lump Sum.Payment shall be made under:Item No. 711-11 Thermoplastic Stripes and Markings Per Lump SumSection 02-711 02-711-1

More magazines by this user
Similar magazines