26.09.2015 Views

Immunohistochemistry

Immunohistochemistry (IHC) - ZENA-R spol. s ro

Immunohistochemistry (IHC) - ZENA-R spol. s ro

SHOW MORE
SHOW LESS
  • No tags were found...

Transform your PDFs into Flipbooks and boost your revenue!

Leverage SEO-optimized Flipbooks, powerful backlinks, and multimedia content to professionally showcase your products and significantly increase your reach.

Thermo Scientific<br />

<strong>Immunohistochemistry</strong> Solutions<br />

• Antibodies<br />

• Detection Systems<br />

• Ancillary Products<br />

• Research Tools<br />

• Automation<br />

2012/2013<br />

<strong>Immunohistochemistry</strong><br />

Solutions


Accurate and reproducible <strong>Immunohistochemistry</strong><br />

(IHC) is vitally important in today’s clinical and research<br />

landscape. Whether you perform research with precious<br />

samples, or a patient awaits your assessment, Thermo<br />

Scientific <strong>Immunohistochemistry</strong> (IHC) solutions deliver<br />

the high quality results you require and are surprisingly<br />

more affordable.<br />

Plus, with our versatile acquisition programs and<br />

scalable offerings, laboratories of any size can perform<br />

their own IHC.<br />

So whether you stain a couple of slides by hand, or<br />

manage a laboratory staining hundreds a day, you can<br />

count on us to support you.


Table of Contents<br />

Thermo Scientific Workflow Overview<br />

Antibody Panels by Disease State<br />

Laboratory Equipment<br />

Detection Systems<br />

Ancillary Products<br />

Complete Antibody Directory<br />

Clone Index<br />

Catalog Number Index<br />

Recommended Protocol Index<br />

Contact and Ordering Information<br />

2<br />

6<br />

16<br />

28<br />

42<br />

48<br />

251<br />

261<br />

273<br />

284<br />

Icons Used Throughout This Catalog<br />

IVD†<br />

RabbitMAb<br />

This icon indicates antibodies that may have In-vitro Diagnostic (IVD)<br />

applications. Please see page 48 for more information on antibody<br />

regulatory status.<br />

This icon highlights rabbit monoclonal antibodies which have shown<br />

superior results for many key markers. Look for this icon throughout the<br />

antibody directory.<br />

The products in this catalog are intended for multiple applications. IVD=for<br />

in-vitro diagnostic use. ASR=analyte specific re gent. Performance<br />

characteristics must be established by the investigator for use in a<br />

diagnostic assay. RUO=for research use only, not intended for diagnostic<br />

procedures. Specific product lassific tions are listed in the product<br />

sections but please consult the product data sheets and your local Thermo<br />

Scientific distributor for more inform tion. Products are RUO unless<br />

otherwise indicated. All products are manufactured in our ISO13485<br />

certified manufacturing facilit .<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

1


Anatomical Pathology Workflow<br />

<strong>Immunohistochemistry</strong><br />

is just a part of our<br />

complete Anatomical<br />

Pathology portfolio.<br />

TISSUE PROCESSING<br />

STP 420ES and Excelsior AS<br />

Tissue Processor<br />

Improving processing quality<br />

while accelerating results.<br />

TISSUE EMBEDDING<br />

HistoStar Embedding<br />

Workstation<br />

Ergonomic, well-illuminated<br />

and high-capacity workstation.<br />

NEW<br />

LABELING & VERIFICATION<br />

PrintMate ES On-demand<br />

Cassette Printer<br />

Meeting the needs of lean<br />

workflow and error reduction<br />

within your laboratory.<br />

GROSSING<br />

GrossLab Senior<br />

Pathology Workstation<br />

Superior quality, value<br />

packed pathology<br />

workstations.<br />

NEW<br />

CRYOTOMY<br />

TISSUE PROCESSING<br />

LABELING & VERIFICATION<br />

NEW<br />

CryoStar NX70 with<br />

Cold-Disinfection<br />

Fast, safe and complete<br />

protection for users<br />

throughout the day.<br />

SecureSette Tissue Cassette<br />

A revolutionary tissue cassette<br />

which enhances patient safety<br />

and enables lean workflow.<br />

CheckMate Verification System<br />

Prevents sample misidentification<br />

and ensures result integrity in the<br />

AP laboratory.<br />

2 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Anatomical Pathology Workflow<br />

MICROTOMY<br />

LABELING & VERIFICATION<br />

SlideMate On-demand<br />

Slide Printer<br />

Reducing patient identification<br />

errors while enhancing lean<br />

workflow.<br />

HM 355S Microtome<br />

Providing safety, comfort<br />

and precision cutting.<br />

NEW<br />

STAINING & COVERSLIPPING<br />

Gemini AS Stainer and<br />

ClearVue Coverslipper<br />

Perform multiple staining<br />

protocols simultaneously and<br />

automated coverslipping makes<br />

for a perfectly lean workflow.<br />

SLIDES & SPECIALTY GLASS<br />

Superfrost Plus<br />

Microscope Slides<br />

Delivering purity, performance<br />

and peace of<br />

mind for your lab.<br />

HISTOLOGY CONSUMABLES<br />

Thermo Scientific<br />

Histology Consumable<br />

Full line of technically advanced<br />

histology consumables<br />

SIGNATURE SERIES<br />

Signature Series Stains<br />

and Reagents<br />

Crisp, superior cellular definition<br />

for a clearer diagnosis.<br />

IMMUNOHISTOCHEMISTRY<br />

Autostainer 360 and PT Module<br />

Open and affordable IHC solution for<br />

high-quality IHC performance and<br />

increased laboratory profitability.<br />

For more information on anatomical pathology<br />

products, please see our Thermo Scientific<br />

Anatomical Pathology Product Catalog or visit<br />

www.thermoscientific.com/pathology<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

3


IHC Workflow<br />

<strong>Immunohistochemistry</strong> (IHC)<br />

When test results determine the diagnosis, prognosis<br />

and potential treatment of patient disease, achieving<br />

accurate, reproducible results in the shortest period of<br />

time is crucial. Thermo Scientific <strong>Immunohistochemistry</strong><br />

products provide a comprehensive set of high quality and<br />

affordable solutions to bring further standardization to<br />

today’s laboratories.<br />

Used as a system, Thermo Scientific instrumentation,<br />

advanced reagents, and specimen verification are the<br />

standardized solution for your <strong>Immunohistochemistry</strong><br />

laboratory. Standardization with quality results brings<br />

consistency, and with the Thermo Scientific IHC solution,<br />

you can rest assured that your process will provide<br />

accurate results, time and again.<br />

The following workflow diagram demonstrates the<br />

complete Thermo Scientific <strong>Immunohistochemistry</strong><br />

solution.<br />

1<br />

IHC Test Request<br />

When <strong>Immunohistochemistry</strong> (IHC) tests are<br />

requested, you require a system that can ensure<br />

accurate, reproducible results in the shortest time<br />

possible.<br />

2 Improved Sample Verification<br />

Eliminate manual steps and reduce the potential for<br />

patient identification errors. The Thermo Scientific<br />

IHC system can read SlideMate labeled slides,<br />

printed on-demand at any microtome, eliminating<br />

time-consuming manual data entry or/and the need<br />

to hand-label IHC slides.<br />

3 Standardized Antigen Retrieval<br />

Slides receive precise computer-controlled<br />

antigen retrieval in the Thermo Scientific PT<br />

Module, which can also perform heat-induced<br />

deparaffinization.<br />

4 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


IHC Workflow<br />

4 One-Step Transfer<br />

7 Superior Results<br />

Slides rapidly transfer from the Thermo<br />

Scientific PT Module to the Autostainer<br />

in one step, maintaining throughput<br />

while significantly reducing costs.<br />

You can rely on the combination of superior<br />

quality, timely results and increased laboratory<br />

profitability with the Thermo Scientific<br />

<strong>Immunohistochemistry</strong> system. Convince<br />

yourself by evaluating the system in your own<br />

laboratory — the results speak for themselves.<br />

5 Thermo Scientific Autostainer<br />

Slides are stained in the fully open Thermo<br />

Scientific Autostainer that leaves laboratories<br />

in control of costs and test parameters. The<br />

proven record for consistency and dependability<br />

minimizes downtime and ensures<br />

quality results.<br />

PSA (Prostate Specific Antigen), clone EP1588Y<br />

RM-2104<br />

6 Rabbit Monoclonals Antibodies<br />

and Enhanced Detection<br />

Advanced reagents drive the enhanced sensitivity<br />

and crisp, clean results on the system. The<br />

Thermo Scientific UltraVision Quanto detection<br />

system is the latest micropolymer technology<br />

capable of enhancing antibodies of mouse and<br />

rabbit origin, producing superior results at a<br />

surprisingly affordable cost per test.<br />

CDX2, clone EPR2764Y<br />

RM-2116<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

5


Antibody Panels by Disease State<br />

Antibody Panels<br />

We offer one of the most comprehensive antibody portfolios available. In the<br />

following sections we have organized some of our core antibodies by disease<br />

state panel, allowing you to select the best test for your patient assessment.<br />

Don’t see the clone you’re looking for or you need research antibodies?<br />

Flip to our complete antibody directory or visit our web site for a complete listing<br />

of all antibodies we carry.<br />

www.thermoscientific.com/labvision<br />

View the IHC website on<br />

your smartphone.<br />

Download the free mobile<br />

app at http://gettag.mobi<br />

We make every effort to be complete and accurate with the information presented in this catalog. Please note that all information in this catalog<br />

is for general reference only and is no substitute with familiarity with current literature.<br />

6 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Antibody Panels by Disease State<br />

Breast Panel<br />

Estrogen receptor positive breast ca stained with<br />

Clone SP1 (RM-9101-S) and UltraVision Quanto.<br />

High grade breast ca stained with Ki67 Clone SP6<br />

(RM-9106-S) and UltraVision Quanto.<br />

Breast ca with amplified Her 2 stained with Clone SP3<br />

(RM-9103-S) visualized with UltraVision Quanto<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

Estrogen Receptor SP1 RM-9101-R7/RQ RM-9101-S SP1 is quickly becoming the gold standard in ER evaluation with<br />

higher sensitivity than other common tests. 1<br />

USA: IVD, Int’l: IVD<br />

Progesterone Receptor SP2 RM-9102-R7/RQ TM-9102-S Sensitive and specific PR marke . USA: IVD, Int’l: IVD<br />

Ki-67 SP6 RM-9106-R7/RQ RM-9106-S Produces substantially less background than commonly used<br />

Ki67 antibodies. 2<br />

Her-2 SP3 RM-9103-R7/RQ RM-9103-S High resolving power may reduce 2+ results that require<br />

additional FISH testing. 3<br />

USA: IVD, Int’l: IVD<br />

USA: ASR, Int’l: IVD<br />

p53 Y5 RM-2103-R7/RQ RM-2103-S Negative prognostic factor in breast ca. USA: IVD, Int’l: IVD<br />

Cytokeratin 5 XM26 MS-1896-R7 MS-1896-S Sensitive for identifying the “basal-like” phenotype of breast ca. 4 USA: IVD, Int’l: IVD<br />

Cytokeratin 7<br />

OV-TL<br />

12/30<br />

MS-1352-R7/RQ MS-1352-P Identifies luminal cells and is useful for distinguishing between lung<br />

and breast epithelium.<br />

USA: IVD, Int’l: IVD<br />

Cytokeratin 20 Ks20.8 MS-377-R7/RQ MS-377-S Useful as a negative indicator for breast adenocarcinomas. USA: IVD, Int’l: IVD<br />

Mammaglobin 304-1A5 MS-1919-R7/RQ MS-1919-A Mammary marker and elevated expression may indicate a less USA: ASR. Int’l: RUO<br />

aggressive tumor.<br />

NY-BR-1 NY-BR-1#2 MS-1932-R7/RQ MS-1932-S Highly specific breast marker useful for identifying<br />

USA: IVD, Int’l: IVD<br />

undifferentiated breast ca. 5<br />

E-Cadherin EP700Y RM-2100-R7/RQ RM-2100-S Useful for differentiating lobular from ductal breast carcinoma. USA: IVD, Int’l: IVD<br />

1. Cheang MC, Treaba DO, Speers CH, Olivotto IA, Bajdik CD, Chia SK, Goldstein LC, Gelmon KA, Huntsman D, Gilks CB, Nielsen TO, Gown AM. Immunohistochemical detection using the new rabbit monoclonal antibody SP1 of estrogen<br />

receptor in breast cancer is superior to mouse monoclonal antibody 1D5 in predicting survival. J Clin Oncol. 2006 Dec 20;24(36):5637-44.<br />

2. Zabaglo L, Salter J, Anderson H, Quinn E, Hills M, Detre S, A’Hern R, Dowsett M. Comparative validation of the SP6 antibody to Ki67 in breast cancer. J Clin Pathol. 2010 Sep;63(9):800-4.<br />

3 Sheila C. L. Wludarski, MD and Carlos E. Bacchi, MD, PhD. High Concordance of SP3 Rabbit Monoclonal Antibody With FISH to Evaluate HER2 in Breast Carcinoma. Appl Immunohistochem Mol Morphol. 2008 Oct;16(5):466-70.<br />

4. Rohit Bhargava, MD, Sushil Beriwal, MD, Kim McManus, HT(ASCP), and David J. Dabbs, MD. CK5 Is More Sensitive Than CK5/6 in Identifying the “Basal-like” Phenotype of Breast Carcinoma. Am J Clin Pathol 2008;130:724-730.<br />

5. Varga Z, Theurillat JP, Filonenko V, Sasse B, Odermatt B, Jungbluth AA, Chen YT, Old LJ, Knuth A, Jäger D, Moch H. Preferential nuclear and cytoplasmic NY-BR-1 protein expression in primary breast cancer and lymph node metastases.<br />

Clin Cancer Res. 2006 May 1;12(9):2745-51.<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

7


Antibody Panels by Disease State<br />

Prostate Panel<br />

Prostate carcinoma identified with PSA Clone<br />

EP1588Y (RM-2104-S) and UltraVision Quanto.<br />

Prostate carcinoma stained with p540s -AMACR<br />

Clone 13H4 (RM-9130-S) and UltraVision Quanto.<br />

Prostate cancer stained with PSMA Clone SP29<br />

(RM-9131-S) and UltraVision Quanto.<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

p504S 13H4 RM-9130-R7/RQ RM-9130-S Typically positive in malignant prostate but negative in<br />

benign lesions. 1<br />

USA: ASR, Int’l: RUO<br />

CK5 EP1601Y RM-2106-R7/RQ RM-2106-S Stains basal epithelia in normal prostate tissue. USA: IVD, Int’l: IVD<br />

CK20 Ks20.8 MS-377-R7/RQ MS-377-S Assists with differentiating prostate from bladder cancer. 3 USA :IVD, Int’l: IVD<br />

CK14 Polyclonal RB-9020-R7 RB-9020-P Stains basal epithelia in normal prostate tissue. USA: IVD, Int’l: IVD<br />

Epithelial<br />

MOC-31 MS-741-R7/RQ MS-741-P Positive indicator for Adenocarcinoma. USA: IVD, Int’l: IVD<br />

Membrane Antigen<br />

Ki67 SP6 RM-9106-R7/RQ RM-9106-S Excellent proliferation marker. USA: IVD, Int’l: IVD<br />

PSA EP1588Y RM-2104-R7/RQ RM-2104-S Useful for identifying cells of prostatic origin. 1 USA :ASR, Int’l: IVD<br />

PSAP PASE/4LJ MS-321-R7/RQ MS-321-P Useful for identifying cells of prostatic origin. 1 USA: IVD, Int’l: IVD<br />

PSMA SP29 RM-9131-R7/RQ RM-9131-S Useful for identifying cells of prostatic origin and can be<br />

combined with PSA to increase sensitivity. 2<br />

USA: IVD, Int’l: IVD<br />

1. Paner GP, Luthringer DJ, Amin MB. Best practice in diagnostic immunohistochemistry: prostate carcinoma and its mimics in needle core biopsies. Arch Pathol Lab Med. 2008 Sep;132(9):1388-96.<br />

2. Mhawech-Fauceglia P, Zhang S, Terracciano L, Sauter G, Chadhuri A, Herrmann FR, Penetrante R. Prostate-specific membrane antigen (PSMA) protein expression in normal and neoplastic tissues and its sensitivity and specificity in prostat<br />

adenocarcinoma: an immunohistochemical study using mutiple tumour tissue microarray technique. Histopathology. 2007 Mar;50(4):472-83.<br />

3. Bassily NH, Vallorosi CJ, Akdas G, Montie JE, Rubin MA. Coordinate expression of cytokeratins 7 and 20 in prostate adenocarcinoma and bladder urothelial carcinoma. Am J Clin Pathol. 2000 Mar;113(3):383-8.<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

8 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Antibody Panels by Disease State<br />

Gastrointestinal Panel<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

CDX2 EPR2764Y RM-2116-R7/RQ RM-2116-S Useful for differentiating gastrointestinal origin with undifferentiated<br />

tumors.<br />

USA: IVD, Int’l: IVD<br />

Pan CK AE1/AE3 MS-343-R7/RQ MS-343-P Useful for identifying carcinoma. USA: IVD, Int’l: IVD<br />

CK7 OV-TL 12/30 MS-1352-R7/RQ MS-1352-P Reacts with proteins in ductal and glandular tissues. USA: IVD, Int’l: IVD<br />

CK20 Ks20.8 MS-377-R7/RQ MS-377-R7 Reacts primarily with intestinal and gastric epithelium. USA: IVD, Int’l: IVD<br />

COX-2 SP21 RM-9121-R7/RQ MS-9121-S Suggested as a poor prognostic indicator in colon carcinoma. USA: IVD, Int’l: IVD<br />

CD117 Polyclonal RB-9038-R7/RQ RB-9038-P Useful for identifying gastrointestinal stroma tumors (GIST). 1 USA: IVD, Int’l: IVD<br />

Dog-1 1.1 MS-1933-R7/RQ MS-1993-P Very useful for identifying gastrointestinal stroma tumors (GIST). 1 USA: IVD, Int’l: IVD<br />

Dog-1 SP31 RM-9132-R7/RQ RM-9132-S Very useful for identifying gastrointestinal stroma tumors (GIST). 1 USA: IVD, Int’l: IVD<br />

H-pylori Polyclonal RB-9070-R7/RQ RB-9070-P Reacts with H-pylori in the GI tract. USA: ASR, Int’l: IVD<br />

Ki-67 SP6 RM-9106-R7/RQ RM-9106-S Excellent proliferation marker. USA: IVD, Int’l: IVD<br />

CA19-9 SPM110 MS-9085-R7 MS-9085-P Highly expressed in gastrointestinal adenocarcinomas. USA: IVD, Int’l: IVD<br />

Villin CWWB1 MS-1499-R7/RQ MS-1499-P Useful for identifying gastrointestinal adenocarcinoma among other types. USA: IVD, Int’l: IVD<br />

Epithelial Ber-EP4 MS-1898-R7 MS-1898-S Useful for distinguishing adenocarcinoma from mesothelioma and USA: IVD, Int’l: IVD<br />

Specific Antigen<br />

hepatocellular carcinoma.<br />

Her-2 SP3 RM-9103-R7/RQ RM-9103-S Anti-Her2 therapies have increased survival rates in Her-2<br />

overexpressing gastric cancer.<br />

USA; ASR, Int’l: IVD<br />

1. Novelli M, Rossi S, Rodriguez-Justo M, Taniere P, Seddon B, Toffolatti L, Sartor C, Hogendoorn PC, Sciot R, Van Glabbeke M, Verweij J, Blay JY, Hohenberger P, Flanagan A, Dei Tos AP. DOG1 and CD117 are the<br />

antibodies of choice in the diagnosis of gastrointestinal stromal tumours. Histopathology. 2010 Aug;57(2):259-70.<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

Metastatic colon ca stained with CDX2<br />

(RM-2116-S) and UltraVision Quanto.<br />

Colon carcinoma stained with COX2<br />

(MS-1898-S) and UltraVision Quanto.<br />

H. pylori stained in stomach tissue with H. pylori<br />

(RB-9070-P) and UltraVision Quanto.<br />

GIST identified by Dog 1 (MS-1933-P) and<br />

UltraVision Quanto.<br />

GIST identified by Dog 1 (RM-9132-S) and<br />

UltraVision Quanto.<br />

Colon stained with Villin (MS-1499-P) and<br />

UltraVision Quanto.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

9


Antibody Panels by Disease State<br />

Useful Antibodies for Tumors of Unknown Origin<br />

Lymph node stained with CD45 LCA (MS-355-P) and UltraVision Quanto.<br />

Melanoma stained with HMB45 (MS-364-P) and UltraVision Quanto.<br />

Lung carcinoma stained with Pan CK (MS-343-P) and UltraVision Quanto.<br />

Neuroendocrine tumor stained with Synaptophysin (RM-9111-S) and<br />

UltraVision Quanto.<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

Pan Cytokeratin AE1/AE3 MS-343-R7/RQ MS-343-P Useful for identifying carcinoma. USA: IVD, Int’l: IVD<br />

CD45 (LCA) PD7/26/16 + 2B11 MS-355-R7/RQ MS-355-P Useful for identifying lymphoma. USA: IVD, Int’l: IVD<br />

Melanoma HMB45 MS-364-R7/RQ MS-364-P Useful for identifying melanoma. USA: IVD, Int’l: IVD<br />

S100 4C4.9 MS-296-R7/RQ MS-296-P Useful for identifying melanoma. USA: IVD, Int’l: IVD<br />

Actin Muscle Specifi HHF35 MS-742-R7/RQ MS-742-P Useful for identifying myogenic sarcoma. USA: IVD, Int’l: IVD<br />

Vimentin V9 MS-129-R7/RQ MS-129-P Useful for identifying soft tissue tumors. USA: IVD, Int’l: IVD<br />

Synaptophysin SP11 RM-9111-R7/RQ RM-9111-S Useful for identifying neuroendocrine tumors. USA: IVD, Int’l: IVD<br />

Hepatocyte OCH1E5 MS-1810-R7/RQ MS-1810-S Useful for identifying hepatoma. USA: IVD, Int’l: IVD<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

10 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Antibody Panels by Disease State<br />

Renal Panel<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

Renal Cell Carcinoma GP200 MS-409-R7/RQ MS-409-P Assists with the identification of renal cell carcinoma USA: IVD, Int’l: IVD<br />

(RCC)<br />

metastases. 1<br />

CD10 56C6 MS-728-R7/RQ MS-728-S Useful for differentiating Clear cell RCC in conjunction USA: IVD, Int’l: IVD<br />

with RCC and Vimentin.<br />

Vimentin V9 MS-129-R7/RQ MS-129-P Useful for identifying renal epithelial tumors in<br />

USA: IVD, Int’l: IVD<br />

conjunction with RCC and CD10.<br />

CK14 Polyclonal RB-9020-R7 RB-9020-P Useful for separating renal mimics from oncocytic USA: IVD, Int’l: IVD<br />

tumors of the kidney.<br />

Epithelial Specific Antigen Ber-EP4 MS-1898-R7 MS-1898-S Useful for identifying cells of epithelial origins. USA: IVD, Int’l: IVD<br />

Immunoglobulin A Polyclonal RB-1433-R7 RB-1433-A Useful for assessing IgA Nephropathy. USA: IVD, Int’l: IVD<br />

Immunoglobulin D Polyclonal RB-1436-R7 RB-1436-A Useful for assessing IgD distribution. USA: IVD, Int’l: IVD<br />

Immunoglobulin M Polyclonal RB-1434-R7 RB-1434-A Useful for assessing IgM Nephropathy. USA: IVD, Int’l: IVD<br />

TTF-1 8G7G3/1 MS-699-R7/RQ MS-699-P Useful for differentiating Renal malignancies TTF (-) from USA: IVD, Int’l: IVD<br />

Thyroid TTF (+).<br />

Wilm’s Tumor 6F-H2 MS-1837-R7 MS-1837-P Used to identify Wilm’s Tumor or nephroblastoma in the USA: IVD, Int’l: IVD<br />

kidney. 2<br />

CD117 / c-Kit Polyclonal RB-9038-R7/RQ RB-9038-P Potential diagnostic marker for some RCC subsets. USA: IVD, Int’l: IVD<br />

1. Perna AG, Ostler DA, Ivan D, Lazar AJ, Diwan AH, Prieto VG, Reed JA. Renal cell carcinoma marker (RCC-Ma) is specific for cutaneous metastasis of renal cell carcinoma J Cutan Pathol. 2007 May;34(5):381-5.<br />

2. Ichinohasama R, Oji Y, Yokoyama H, Takeuchi K, Fujiwara T, Ishizawa K, Taniguchi O, Tsuboi A, Oka Y, Sugiyama H. Sensitive immunohistochemical detection of WT1 protein in tumors with anti-WT1 antibody against<br />

WT1 235 peptide. Cancer Sci. 2010 May;101(5):1089-92. Epub 2010 Feb 3.<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

Pheoochromocytoma stained with Vimentin (MS-129-P) and UltraVision Quanto.<br />

Nephrolastoma stained with Wilm’s Tumor (MS-1837-P) and UltraVision Quanto.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

11


Antibody Panels by Disease State<br />

Mesothelioma Panel<br />

Mesothelioma stained with Calretinin Clone SP13 (RM-9113-S) and<br />

UltraVision Quanto.<br />

Mesothelioma stained with CK5 (RM-2106-S) and UltraVision Quanto.<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

Antibodies Useful for Identifying Mesothelioma 1<br />

Calretinin SP13 RM-9113-R7/RQ RM-9113-S Useful in differentiating mesotheliomas from USA: IVD, Int’l: IVD<br />

adenocarcinomas.<br />

Mesothelioma HBME-1 MS-1494-R7/RQ MS-1494-S Useful in differentiating mesotheliomas from USA: IVD, Int’l: IVD<br />

adenocarcinomas.<br />

Mesothelin 5B2 MS-1320-R7 MS-1320-S Surface protein present on normal mesothelium and USA: IVD, Int’l: IVD<br />

malignant mesothelioma.<br />

CK5 EP1601Y RM-2106-R7/RQ RM-2106-S Expressed in most epithelial and biphasic<br />

USA: IVD; Int’l: IVD<br />

mesotheliomas<br />

CK 5/6 D5/16 B4 MS-1814-R7/RQ MS-1814-S Useful marker for identifying biphasic<br />

USA: IVD, Int’l: IVD<br />

Mesothelioma. 2<br />

Vimentin V9 MS-129-R7/RQ MS-129-P Useful in differentiating mesotheliomas from USA: IVD, Int’l: IVD<br />

adenocarcinomas.<br />

Wilm’s Tumor Protein (WT1) 6F-H2 MS-1837-R7 MS-1837-S Positive in some mesothelioma tumors. USA: IVD, Int’l: IVD<br />

Antibodies Useful for Identifying Adenocarcinoma 1<br />

Epithelial Membrane Antigen E29 MS-741-R7/RQ MS-741-P Positive indicator for Adenocarcinoma. USA: IVD, Int’l: IVD<br />

Epithelial Specific Antigen Ber-EP4 MS-1898-R7 MS-1898-S Positive indicator for Adenocarcinoma. USA: IVD, Int’l: IVD<br />

CEA Polyclonal RB-368-R7/RQ RB-368-A Positive indicator for Adenocarcinoma. USA: IVD, Int’l: IVD<br />

Other Useful Antibodies<br />

Keratin 18 DC10 MS-142-R7 MS-142-P Useful for differentiating mesothelial and squamous USA: IVD, Int’l: IVD<br />

cell carcinoma.<br />

CK Pan AE1/AE3 MS-343-R7/RQ MS-343-P Useful for identifying carcinomas. USA: IVD, Int’l: IVD<br />

CK18 E431-1 RM-2108-R7/RQ RM-2108-S Useful for differentiating mesothelial and squamous<br />

cell carcinoma.<br />

USA: IVD, Int’l: IVD<br />

1. Yaziji H, Battifora H, Barry TS, Hwang HC, Bacchi CE, McIntosh MW, Kussick SJ, Gown AM. Evaluation of 12 antibodies for distinguishing epithelioid mesothelioma from adenocarcinoma: identification of a three-antibody<br />

immunohistochemical panel with maximal sensitivity and specificit . Mod Pathol. 2006 Apr;19(4):514-23.<br />

2. Chu PG, Weiss LM. Expression of cytokeratin 5/6 in epithelial neoplasms: an immunohistochemical study of 509 cases. Mod Pathol. 2002 Jan;15(1):6-10.<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

12 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Antibody Panels by Disease State<br />

Melanoma Panel<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

Melanoma HMB45 MS-364-R7/RQ MS-364-S Useful for differentiating mesastatis melanoma. USA: IVD, Int’l: IVD<br />

MART-1/Melan A A103 MS-799-R7/RQ MS-799-P Useful for differentiating mesastatis melanoma. USA :IVD, Int’l: IVD<br />

Tyrosinase T311 MS-800-R7/RQ MS-800-P Useful for differentiating mesastatis melanoma from carcinoma. USA: IVD, Int’l: IVD<br />

S100 4C4.9 MS-296-R7/RQ MS-296-P Positive in a wide range of melanotic tumors. USA: IVD, Int’l: IVD<br />

Ki67 SP6 RM-9106-R7/RQ RM-9106-S Excellent proliferation marker. USA: IVD, Int’l: IVD<br />

*Descriptions are for general reference only. Please consult the datasheet and current literature for more information.<br />

Melanoma Clone HMB45 (MS-364-S) stained with UltraVision Quanto Fast Red.<br />

Note: melanin pigment is present.<br />

Melanoma stained with Ki67 Clone SP7 (RM-9106-S) and UltraVision Quanto<br />

Fast Red. Note: melanin pigment is present.<br />

Melanoma stained with MART-1/Melan A (MS-799-P) and UltraVision Quanto.<br />

Note: melanin pigment is present.<br />

Melanoma stained with Melanoma HMB45 (MS-364-P) and UltraVision Quanto.<br />

Note: melanin pigment is present.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

13


Antibody Panels by Disease State<br />

Lymphoma Panel<br />

Mantle cell lymphoma stained with Cyclin D1<br />

SP4 (RM-9104-S) and UltraVision Quanto.<br />

Lymphoma stained with CD23 clone SP23<br />

(RM-9123-S) and UltraVision Quanto.<br />

Lymphoma stained with CD3 clone EP449E<br />

(RM-2109-S) and UltraVision Quanto.<br />

Hodgkin’s lymphoma stained with CD15 clone<br />

MMA (MS-1259-P) and UltraVision Quanto.<br />

Lymphoma stained with CD20 (MS-340-S) and<br />

UltraVision Quanto.<br />

Lymphoma stained with CD5 clone SP19<br />

(RM-9119-S) and UltraVision Quanto.<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

ALK / p80 SP8 RM-9108-R7/RQ RM-9108-S Identifies approximately 60% of anaplastic large cell<br />

USA: IVD; Int’l: IVD<br />

lymphomas.<br />

BCL-2alpha 100/D5 MS-123-R7/RQ MS-123-P Useful for distinguishing between reactive and neoplastic USA: IVD; Int’l: IVD<br />

follicular proliferation in lymph node.<br />

CD10/CALLA 56C6 MS-728-R7/RQ MS-728-S Expressed on cells of lymphoblastic, Burkitt’s and follicular USA: IVD; Int’l: IVD<br />

germinal center lymphomas. Also positive on cells from<br />

patients with chronic myelocytic leukemia (CML).<br />

CD138 MI15 MS-1793-R7/RQ MS-1793-S Useful marker for labeling normal and neoplastic plasma cells USA: IVD; Int’l: IVD<br />

and plasmacytoid lymphomas. Also stains various forms of<br />

Hodgkin’s lymphoma.<br />

CD15 MMA MS-1259-R7/RQ MS-1259-P Aids in the identification of cells of granulocytic lineage and/or USA: IVD; Int’l: IVD<br />

Reed Sternberg differentiation.<br />

CD1a O10 MS-1856-R7/RQ MS-1856-P Useful for differentiating various cutaneous lymphomas (T-cell) USA: IVD; Int’l: IVD<br />

from B-cell lymphomas and pseudolymphomas and is useful in<br />

the differential diagnosis of Langerhans cell histiocytosis.<br />

CD2 (LFA-2) AB75 MS-1074-R7 MS-1074-S Use as a Pan T-Cell marker and is rarely positive in B-cell USA: IVD; Int’l: IVD<br />

populations.<br />

CD20 L26 MS-340-R7/RQ MS-340-S Labels B-cells and is very useful in the identification of USA: IVD; Int’l: IVD<br />

neoplasms of B-cell derivation.<br />

CD21 2G9 MS-1086-R7/RQ MS-1086-S Useful for labeling follicular dendritic cells or tumors. USA: IVD; Int’l: IVD<br />

CD22 FPC1 MS-1087-R7/RQ MS-1087-S B-cell marker that is expressed in a wide range of B and early USA: IVD; Int’l: IVD<br />

B-cells.<br />

CD23 SP23 RM-9123-R7/RQ RM-9123-S Expressed on most mature B-cells (negative on most CD5+<br />

B-cells), and can also be found on the surface of T cells,<br />

macrophages, platelets and EBV transformed B lymphoblasts.<br />

USA: IVD; Int’l: IVD<br />

14 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Antibody Panels by Disease State<br />

Antibody Clone Cat. No. (RTU) Cat. No. [C] Description* Regulatory Status<br />

CD3 SP7 RM-9107-R7/RQ RM-9107-S Excellent all-around T-cell marker. USA: IVD; Int’l: IVD<br />

CD30 Ber-H2 MS-361-R7/RQ MS-361-S Useful for the identification of anaplastic large-cell lymphoma USA: IVD; Int’l: IVD<br />

(ALCL) and as a secondary marker for Hodgkin’s Disease.<br />

CD31 JC/70A MS-353-R7/RQ MS-353-S Labels endothelial cells, and is useful for the identification of USA: IVD; Int’l: IVD<br />

vascular disorders, including angiosarcomas.<br />

CD4 4B12 MS-1528-R7/RQ MS-1528-S Stains many cases of cutaneous T-cell lymphoma. USA: IVD; Int’l: IVD<br />

CD43 DF-T1 MS-146-R7/RQ MS-146-P Labels T-cell lymphomas and mantle cell lymphomas. USA: IVD; Int’l: IVD<br />

CD45/LCA PD7/26/16+2B11 MS-355-R7/RQ MS-355-P Identifies normal or neoplastic lymphoid tissue USA: IVD; Int’l: IVD<br />

CD45RA 4KB5 MS-1845-R7/RQ MS-1845-P Useful for the identification of B-cell lymphomas USA: IVD; Int’l: IVD<br />

CD45RB PD7/26 MS-1846-R7/RQ MS-1846-P Expressed on mature B-lymphocytes and the majority of USA: IVD; Int’l: IVD<br />

lymphomas and leukemias of B-cell origin.<br />

CD45RO (T-Cell) UCHL-1 MS-112-R7/RQ MS-112-P Expressed on all cells of hematopoietic origin, except<br />

USA: IVD; Int’l: IVD<br />

erythrocytes.<br />

CD5 SP19 RM-9119-R7/RQ RM-9119-S Reactive in T-cells and a useful differentiator of mantle cell USA: IVD; Int’l: IVD<br />

lymphoma (CD5+) from follicle center cell lymphoma (CD5-).<br />

CD57 (NK-cells) NK1 MS-136-R7 MS-136-P Marks natural killer cells. USA: IVD; Int’l: IVD<br />

CD68 /<br />

KP1 MS-397-R7/RQ MS-397-P Useful tool for the identification of neoplasms of myeloid and USA: IVD; Int’l: IVD<br />

Macrophage<br />

macrophage/monocyte origin.<br />

CD79a SP18 RM-9118-R7/RQ RM-9118-S Useful for identifying B-cell neoplasms of all maturation stages. USA: IVD; Int’l: IVD<br />

CD8 SP16 RM-9116-R7/RQ RM-9116-S Useful for the identification of normal and neoplastic cytotoxic USA: IVD; Int’l: IVD<br />

suppressor T-cells.<br />

EMA E29 MS-741-R7/RQ MS-741-P May be useful for identifying diffuse large B-cell lymphoma, USA: IVD; Int’l: IVD<br />

plasma cell neoplasms and nodular lymphocyte predominant<br />

Hodgkin’s lymphoma.<br />

Granzyme B GZB01 MS-1157-R7/RQ MS-1157-S Shown to be a negative prognostic indicator with Hodgkin’s USA: IVD; Int’l: IVD<br />

lymphoma.<br />

S100 4C4.9 MS-296-R7/RQ MS-296-P Useful to as a negative indicator for lymphoma with<br />

USA: IVD; Int’l: IVD<br />

undifferentiated neoplasms.<br />

TdT SEN28 MS-1105-R7/RQ MS-1105-S Useful in the classification of malignant lymphomas particularly USA: IVD; Int’l: IVD<br />

pre B and pre T-cell acute lymphoblastic lymphoma.<br />

ZAP-70 2F3.2 MS-1911-R7 MS-1911-P Expressed in T-cells, natural killer cells and pre-B cells. Useful USA: IVD; Int’l: IVD<br />

for identifying a subset of chronic lymphocytic leukemias.<br />

Epstein-Barr Virus CS1+CS2 MS-1458-R7 MS-1458-S EBV associated lymphomas are a known risk for<br />

USA: ASR; Int’l: IVD<br />

/ LMP Ab-1 +CS3+CS4<br />

immunosuppressed individuals. 1<br />

CD56 123C3.D5 MS-204-R7/RQ MS-204-P Positive with natural killer cells and a subset of T-cells. USA: IVD; Int’l: IVD<br />

Cyclin D1 SP4 RM-9104-R7/RQ RM-9104-S Useful for the diagnosis of mantle cell lymphoma. USA: IVD; Int’l: IVD<br />

Kappa Light L1C1 MS-143-R7 MS-143-P Useful in conjunction with Lambda light chain to determine USA: IVD; Int’l: IVD<br />

Chain<br />

kappa lambda rations in B-cell lymphomas.<br />

Kappa Light Polyclonal RB-333-R7/RQ RB-333-A Useful in conjunction with Lambda light chain to determine USA: IVD; Int’l: IVD<br />

Chain<br />

kappa lambda rations in B-cell lymphomas.<br />

Ki67 SP6 RM-9106-R7/RQ RM-9106-S Excellent proliferation marker. USA: IVD; Int’l: IVD<br />

Lambda Light HP6054 MS-180-R7 MS-180-P Useful in conjunction with Kappa light chain to determine USA: IVD; Int’l: IVD<br />

Chain<br />

kappa lambda rations in B-cell lymphomas.<br />

Lambda Light Polyclonal RB-334-R7/RQ RB-334-A Useful in conjunction with Kappa light chain to determine USA: IVD; Int’l: IVD<br />

Chain<br />

kappa lambda rations in B-cell lymphomas.<br />

Pax-5 SP34 RM-9133-R7/RQ RM-9133-S Useful B-cell marker. USA: IVD; Int’l: IVD<br />

Kappa-Lambda Cocktail MV-2003-R7 Double stain cocktail useful for demonstrating Kappa and<br />

Lambda on a single slide.<br />

USA: IVD; Int’l: IVD<br />

1. Kawabata T, Weaver J, Thomas D, Rowe M, Wang F, Kamperschroer C, Haggerty H. Summary of roundtable discussion meeting: Non-human primates to assess risk for<br />

EBV-related lymphomas in humans. J Immunotoxicol. 2011 Dec 3. [Epub ahead of print]J Immunotoxicol. 2011 Dec 3.<br />

*Descriptions are for general reference only. Please consult the data sheet and current literature for more information.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

15


Laboratory Equipment<br />

<strong>Immunohistochemistry</strong> Equipment<br />

Efficient, Consistent and Reliable<br />

• Autostainer Series Immunostainers<br />

• PT Module Antigen Retrieval Device<br />

• Lean IHC Labeling Solutions<br />

• Sequenza Manual Staining System<br />

16 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

All Thermo Scientific IHC systems are designed to create a<br />

technician-centered workflow to rapidly deliver quality results<br />

at the lowest possible cost. Our scalable options range from<br />

convenient manual staining systems for small projects to automation<br />

that can stain hundreds of slides per day, allowing labs<br />

of any size to quickly deliver outstanding results.<br />

The values of Thermo Scientific IHC solutions are based on:<br />

• Flexibility and value of completely open systems<br />

• Proven instrumentation and staining technology<br />

• Consistency with accurate and reproducible antigen retrieval<br />

• Compatibility with Thermo Scientific labeling solutions creates<br />

a lean workflow<br />

• Scalable solutions grow with your laboratory<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

17


Laboratory Equipment<br />

Thermo Scientific Autostainer 360 Stainer*<br />

The Autostainer 360 and PT Module antigen retrieval device<br />

are the ideal solution for clinical laboratories where rapid<br />

turn-around time and workflow are key. Slide throughput is<br />

a maximum of 108 slides per day.<br />

The Industry Standard in IHC Automation<br />

The Autostainer series remains the most widely used instrument<br />

today with more than 6,000 instruments placed. Multiple sizes<br />

are available to best accommodate the needs of laboratories of<br />

nearly any size. For maximum efficiency and reproducibility with<br />

formalin fixed samples we recommend the Autostainer and PT<br />

Module be used together as a system.<br />

Features of the Autostainer and PT Module Series<br />

• Flexibility and value of a completely open system<br />

• Proven reliability<br />

• Efficiency with pretreatment through counterstain automation<br />

• Error reduction with dual bar coding (slides and reagents)<br />

• Full regulatory compliant reporting and data management<br />

• Enhanced lean workflow with on-demand labeling directly<br />

to slides<br />

• Interface can be configured for clinical or research at no<br />

additional cost<br />

Product specifications, accessories and included components<br />

are located on pages 21 and 22.<br />

* Autostainer 360 shown with the included slide and reagent label printers<br />

and the Thermo Scientific PT Module (Optional .<br />

Purchase reagents in Autostainer vials for maximum<br />

efficiency or easily fill your own. The system remains<br />

completely open to reagents from any source. To<br />

order RTU antibodies in Autostainer vials optimized for<br />

the UltraVision Quanto detection system look for the<br />

“RQ” part numbers in the antibody section.<br />

18 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

Thermo Scientific Autostainer 480S Stainer<br />

The industry standard in IHC automation is now 12cm<br />

smaller, saving valuable laboratory space. Note: The<br />

Autostainer 480S is not available in the United States.<br />

Thermo Scientific Autostainer 720 Stainer<br />

The Autostainer 720 handles up to 84 slides at once and<br />

is designed for large-batch applications.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

19


Laboratory Equipment<br />

Consistent Reproducible Antigen<br />

Retrieval<br />

The Thermo Scientific PT Module antigen retrieval<br />

device precisely duplicates antigen retrieval conditions<br />

across all slides. The gentle heat quickly<br />

produces outstanding results while maintaining the<br />

integrity of delicate tissue. In addition, most users<br />

can streamline testing practices by consolidating<br />

various antigen retrieval methods into only one or<br />

two PT Module antigen retrieval device procedures,<br />

which can be run simultaneously. Precise temperature<br />

control without the damaging effects of<br />

temperature variations, microwaves or pressure<br />

delivers a level of consistency unmatched by any<br />

other instrument available.<br />

For more information on the PT Module antigen<br />

retrieval, device and standardization of antigen<br />

retrieval see the publication below.<br />

David S Gray et al. Simultaneous de-waxing<br />

and standardisation of antigen retrieval in<br />

immunohistochemistry using commercially<br />

available equipment. Immunocytochemistry<br />

2006; 4 93-97.<br />

Simple one-step rack transfer from the PT Module antigen retrieval device<br />

to the Autostainer saves operating costs and improves turnaround time.<br />

20 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

Thermo Scientific <strong>Immunohistochemistry</strong> Instrument Specifications<br />

Autostainer 360<br />

Max. Capacity<br />

Dimensions Instrument<br />

(not including computer below)<br />

Weight<br />

Autostainer 480S<br />

Max. Capacity<br />

Dimensions Instrument<br />

(not including computer below)<br />

Weight<br />

Autostainer 720<br />

Max. Capacity<br />

Dimensions Instrument<br />

(not including computer below)<br />

Weight<br />

36 Slides, 40 reagent vials<br />

30.0W x 26.4D x 22.8"H<br />

76W x 67D x 58cm H<br />

121 lbs., 55kg<br />

48 Slides, 50 reagent vials<br />

36W x 26.4D x 22.8”H<br />

91W x 67D x 58cm H<br />

143 lbs., 65kg<br />

84 Slides, 40 reagent vials<br />

50.4W x 26.4D x 22.8"H<br />

128W x 67D x 58cm H<br />

176 lbs., 80kg<br />

Autostainer 360, 480S and 720<br />

Computer and Monitor<br />

14W x 14D x 18"H<br />

Dimensions<br />

(35W x 35D x 46cm H)<br />

Electrical Specification<br />

110/120VAC (range 90-132VAC),<br />

60Hz (+/-2Hz), 4A<br />

220/240VAC (range 198-264VAC),<br />

50Hz (+/-2Hz), 2A<br />

Temperatures Operational temperature: 59° to 86°F<br />

(15° to 30°C)<br />

Storage temperature:<br />

50° to 104°F (10° to 40°C)<br />

Reagent Dispense Volumes 100, 150, 200, 400 and 600µL<br />

minimum 2x100/150 (drop 25mL)<br />

Reagent pipette volume capacity: 1.6mL<br />

Reagent pipette carryover:


Laboratory Equipment<br />

Ordering Information<br />

Product Description Order Number<br />

Autostainer 360 +<br />

PT Module<br />

Autostainer 480S +<br />

PT Module*<br />

Autostainer 720 +<br />

PT Module<br />

Autostainer 720 + 2x<br />

PT Modules<br />

Autostainer 360<br />

Autostainer 480S*<br />

Autostainer 720<br />

Autostainer 360, Report Printer, 2x Label<br />

Printers, Computer pkg**, PT Module<br />

Autostainer 480s, Report Printer, 2x Label<br />

Printers, Computer pkg**, PT Module<br />

Autostainer 720, Report Printer, 2x Label<br />

Printers, Computer pkg**, PT Module<br />

Autostainer 720, Report Printer, 2x Label<br />

Printers, Computer pkg**, 2x PT Modules<br />

Autostainer 360, Report Printer, 2x Label<br />

Printers, Computer pkg**<br />

Autostainer 360, Report Printer, 2x Label<br />

Printers, Computer pkg**<br />

Autostainer 360, Report Printer, 2x Label<br />

Printers, Computer pkg**<br />

North/South America<br />

Europe, Asia<br />

110V 240V 110V 220V<br />

A80500024 A80500023 A80500024 + A80500023<br />

A80400002<br />

A80500008 + A80500027 A80500008 + A80500027<br />

A80400002<br />

A80400002<br />

A80500031 A80500029 A80500010 + A80500029<br />

A80400002<br />

A80500030<br />

A80500009 + 2x<br />

A80400001<br />

A80500010 + 2x<br />

A80400002<br />

A80500009 + 2x<br />

A80400001<br />

A80500004A A80500003 A80500004 A80500003<br />

A80500008 A80500007 A80500008 A80500007<br />

A80500010A A80500009 A80500010 A80500009<br />

PT Module PT Module and Accessories A80400002 A80400001 A80400002 A80400001<br />

*Note: Autostainer 480S is not available in the United States<br />

**Note: Depending on region the Autostainer packages may include a universal power supply (UPS). Contact your local distributor for specific information<br />

Product Description Order Number<br />

Barcodeable Autostainer Vial 12mL Barcodable 12mL K00029<br />

Reagent Vial Barcode Labels Barcodable labels for Autostainer vials A80510134<br />

Slide Labels (no flap Solvent resistant slide labels with no fla A80510164<br />

Slide Labels (flap Solvent resistant slide labels with fla A80510135<br />

Autostainer Operator Guide (CD) For Autostainer 360, 480S and 720 A80510107-CD<br />

PT Module Pump Kit Diaphragm pump kit for PT Module A80410008<br />

480S Reagent Rack Compatible for 480S only A80510138<br />

2D Autostainer Vial Storage Rack Stackable Tray for 40 barcoded vials for transport and storage S00140<br />

15mL Cylindrical Vials Cylindrical Vials for LV-1 or Dako Autostainer A80510136<br />

Reagent Vial Rack (no barcodes) 480S vial rack for LV-1 or Dako Autostainer S00576<br />

PT Module Tank and Lid Accessory PT Module Buffer Tank and Lid P00005a<br />

DAB Away Autostainer Automated Cleaning Kit TA-250-DA<br />

22 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

23


Laboratory Equipment<br />

Enhancing Lean Workflow and Reducing Patient Identification<br />

Errors With On-Demand Labeling for IHC<br />

On-demand labeling improves accuracy and<br />

streamlines workflow. For the first time on-demand<br />

labeling directly on slides is available for IHC. Utilizing<br />

the Thermo Scientific SlideMate slide printer and<br />

LabWriter software IHC slides can be generated at<br />

any microtome in the laboratory.<br />

Benefits of On-Demand Slide<br />

Labeling with IHC<br />

• Improve Turn-Around Time with Fewer<br />

Manual Steps<br />

• Reduce Identification Errors<br />

• Simplify or Eliminate Data Entry<br />

Test and patient information are<br />

printed onto the slide and into<br />

the barcode immediately when<br />

the sample is sectioned.<br />

The information is then scanned directly into the Autostainer. No data entry is required.<br />

24 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

On-Demand Printed IHC Slides In Detail<br />

Antigen Retrieval Information<br />

in the upper left for easy<br />

reference and sorting.<br />

IHC protocol and patient identification are<br />

transmitted to the Autostainer via the barcode.<br />

The Autostainer logs the patient information<br />

and performs the requested IHC test. Barcode<br />

information can be configured to meet account<br />

specifications but the IHC protocol must appear<br />

at the end of barcode after a semicolon. Example:<br />

“S697851,user1,pH 6;ER”<br />

User can configure<br />

all slide label text to meet<br />

their own requirements.<br />

Ordering Information<br />

Description Order Number 110 – 120V Order Number 220 – 240V<br />

SlideMate with Mini PC (built-in digital imager, clamp style arm) – Premium Package* B81300016 B81300020<br />

SlideMate with Mini PC (handheld digital imager with stand, clamp style arm) – Premium Package* B81300018 B81300023<br />

SlideMate with Mini PC (handheld digital imager with stand, desktop stand) – Premium Package* B81300019 B81300022<br />

*Mini PC packages also include LabWriter software, cross-over cable, keyboard, mouse, USB hub, stylus<br />

**15" PC packages also include LabWriter software, handheld digital imager with stand, cross-over cable, keyboard, mouse, stylus<br />

Important Notes: LabWriter must be used for printing Autostainer readable slides on the SlideMate. Autostainer software version 6.7.2.a or higher is required and the programing method barmeth=2 must<br />

be used. The SlideMate does not replace the zebra slide label printers. Slides are printer at the point of need which is on demand, at the microtome. The zebra slide label printers can be used to print paper<br />

slide labels and run along side SlideMate printed slides. Please contact your local Thermo Scientific IHC and Labeling and Tracking representative for more information. Only 2D barcodes with 25 characters of<br />

information or less are compatible with the Autostainer software.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

25


Laboratory Equipment<br />

Thermo Scientific Shandon Sequenza Immunostaining Racks<br />

Organized Method for Manual IHC<br />

When IHC slide volume does not justify an automated system,<br />

the Sequenza ® Immunostaining racks are the perfect solution<br />

for consistent, cost-effective IHC. The staining system is ideal<br />

for research or clinical applications. A single ten slide rack can<br />

be used for smaller projects such as staining frozen sections.<br />

For larger studies or higher volumes, multiple racks can be<br />

ordered. All Thermo Scientific IHC reagents work perfectly with<br />

Coverplate technology.<br />

Thermo Scientific Shandon Immunostaining racks with loaded slides and Coverpl tes<br />

Benefits of the Sequenza Immunostaining<br />

Racks<br />

• Coverplate system ensures consistent high quality<br />

staining<br />

• Saves considerable time with a simple manual process<br />

• Substantial reagent savings. Coverplate technology only<br />

requires 100µL to cover the slide and specimen<br />

• Coverplates protect tissue specimens from drying<br />

throughout staining process<br />

Coverplate Technology<br />

26 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Laboratory Equipment<br />

Sequenza Slide Racks and Coverplates<br />

Description Includes Order Number<br />

Slide Rack and Lid Holds 10 slides with coverplates 73310017<br />

Coverplates 250/Cs. 72110013<br />

Coverplates 50/Pk. 7219950<br />

Coverplates 25/Pk. 72110017<br />

Optional Accessories<br />

Description Includes Order Number<br />

Reagent Trays For organizing staining reagents 73310015<br />

Dropper Bottles 50/Pk. 73310007<br />

Buffer Bottle 750mL For washing slides 73310002<br />

Thermo Scientific Shandon Humidity Chamber<br />

• Ideal for IHC procedures and other laboratory<br />

techniques<br />

• Maintains moist environment during incubation<br />

steps<br />

• Heavy, flanged cover locks in moisture<br />

• Durable, clear acrylic chamber will accommodate<br />

three aluminum slide trays<br />

• Two acrylic tray spacers with legs are supplied to<br />

keep aluminum slide trays separated<br />

• Two 20-slide aluminum slide trays supplied<br />

• Acrylic slide tray spacers and aluminum trays are<br />

also sold separately<br />

• Size (H x W x D): 3 x 8 x 14.125"<br />

(7.6 x 20.3 x 35.9cm)<br />

Description Includes Order Number<br />

Humidity Chamber Chamber, lid, 2 trays and 2 spacers 197<br />

Aluminum Slide Tray 1 Tray 203<br />

Acrylic Spacer 1 Tray spacer 198<br />

Acrylic Chamber Replacement chamber 231975<br />

Acrylic Lid Replacement lid 231974<br />

Polyethylene Lid 1 Lid for heated applications 10388<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

27


Detection System<br />

Detection Systems<br />

Which Detection System Is Best for Your Laboratory?<br />

To complement our robust antibody portfolio we offer an array of<br />

detection technologies designed to meet the needs of the clinical and<br />

research market. The following guide is designed to help you determine<br />

the best kit for your application. See the following detection system<br />

pages for detailed information on each detection kit. When in doubt you<br />

may contact your local representative or our technical service team at<br />

lab.reagents@thermofisher.com.<br />

UltraVision Quanto (IVD)<br />

UltraVision Quanto offers the highest sensitivity with both rabbit and<br />

mouse antibodies. If you perform routine clinical testing with human<br />

samples we recommend the UltraVision Quanto Detection System.<br />

UltraVision Quanto Mouse on Mouse HRP (RUO)<br />

Quanto Mouse on Mouse is designed for research use with mouse<br />

antibodies on mouse samples. Quanto Mouse on Mouse makes optimal<br />

results routine with Mouse on Mouse IHC.<br />

UltraVision Labeled Polymer (LP) (IVD)<br />

UltraVision LP is the predecessor of UltraVision Quanto. UltraVision<br />

LP works well in clinical applications and produces strong, consistent<br />

results. UltraVision LP can also be used for rabbit antibodies in the research<br />

setting.<br />

Note: UltraVision LP enhances mouse antibodies but not rabbit.<br />

UltraVision ONE (IVD)<br />

UltraVision ONE offers the protocol with the least number of steps and is<br />

ideal for clinical applications with frozen sections or where few steps are<br />

ideal.<br />

MultiVision (IVD)<br />

The MultiVision System is designed for visualizing two antigens on a<br />

single slide.<br />

Thermo Scientific UltraVision and UltraVision Plus (IVD)<br />

Robust Biotin and Streptavidin system<br />

Thermo Scientific UltraVision LP Value (IVD)<br />

Similar technology to UltraVision LP at a more affordable price.<br />

28 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

Selection Guide for Automated Staining<br />

With automated staining, choosing the system that maximizes sensitivity while minimizing turnaround<br />

time is paramount to providing quality results as quickly as possible. The guide below compares our<br />

detection systems based on these two variables.<br />

UV Quanto: Highest sensitivity<br />

and short incubation time<br />

Color<br />

Code<br />

Detection<br />

System<br />

UV Quanto<br />

Detection<br />

Time<br />

35 min.<br />

Quanto MOM<br />

55 min.<br />

UV LP<br />

45 min.<br />

UV ONE<br />

55 min.<br />

MultiVision<br />

70 min.<br />

UV Plus<br />

30 min.<br />

Selection Guide for Manual Staining<br />

With manual staining, choosing the system that maximizes sensitivity while offering the least number of<br />

steps is ideal for delivering quality results with as little labor as possible. The guide below compares our<br />

detection systems based on these two variables.<br />

UV ONE: Least<br />

number of steps<br />

Color<br />

Code<br />

Detection<br />

System<br />

Detection<br />

Steps<br />

UV Quanto 5<br />

Quanto MOM 4<br />

UV LP 5<br />

UV ONE 4<br />

MultiVision 5<br />

UV Plus 5<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

29


Detection System<br />

Thermo Scientific UltraVision Quanto Series<br />

The Thermo Scientific UltraVision Quanto product line utilizes the latest detection<br />

technology to deliver consistently strong and reproducible IHC results over a wide<br />

range of clinical and research antibodies. The foundation of this technology is the<br />

latest micro-polymer and is supplemented by advanced chromogens and ancillary<br />

products. The result is a system that has been called one of the simplest and most<br />

sensitive detection systems available by NordiQC 1 .<br />

The following images demonstrate typical results with the various Quanto Detection<br />

System formats. Further details on specific configurations are available on the following<br />

pages.<br />

HER 2 Clone EP1045Y on breast carcinoma stained with UltraVision Quanto HRP and DAB Quanto (TL-125-QHD).<br />

MRP2 on mouse liver stained with UltraVision Quanto Mouse on Mouse HRP (TL-060-QHDM).<br />

1. NordiQC Review of Technical Test Approach Montreal 2010 (Page 28) http://www.nordiqc.org/seminars/Nielsen-Montreal-08-July-10.pdf<br />

30 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

EGFR Clone EP38Y on lung adenicarcinoma stained with UltraVision Quanto and Fast Red (TL-125-QAL).<br />

Estrogen Receptor (ER) Clone SP1 on breast carcinoma stained with UltraVision Quanto and DAB Quanto (TL-125-QHD).<br />

Estrogen Receptor (ER) Clone SP1 on breast carcinoma stained with UltraVision Quanto and Fast Red (TL-125-QAL).<br />

Ki67 Clone SP6 on breast carcinoma stained with UltraVision Quanto and Quanto DAB (TL-125-QHD).<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

31


Detection System<br />

UltraVision Quanto Detection System<br />

The UltraVision Quanto Detection system utilizes innovative micro-polymer technology that<br />

enhances sensitivity while reducing costs and turnaround time. This system is optimized for<br />

mouse and rabbit antibodies on human specimens and is ideal for routine clinical testing.<br />

CDX2 Clone EPR2754Y stained with Quanto HRP and DAB TL-125-QHD.<br />

P504s Clone 13H4 staining with Quanto AP and Fast Red TL-125-QAL.<br />

Benefits of the UltraVision Quanto Detection System<br />

Enhanced Sensitivity<br />

Clean Results<br />

Affordable Price Per Test<br />

Shorter Incubation Times<br />

Improves results with routine and challenging markers alike by<br />

amplifying both mouse and rabbit antibodies.<br />

Best-in-class signal to noise ratio means the signal is amplified while<br />

the background remains clean.<br />

Along with an affordable detection system price, high sensitivity<br />

allows further dilution of primary antibodies. This reduces the amount<br />

of concentrated antibody required for optimal staining and allows us<br />

to offer affordable, ready-to-use antibodies. Quanto optimized antibodies<br />

in Autostainer vials are available. Look for antibodies with the “RQ”<br />

format in the antibody section.<br />

High sensitivity means incubation times remain short, delivering the<br />

fastest turnaround time possible.<br />

UltraVision Quanto HRP DAB Protocol<br />

32 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

UltraVision Quanto AP Protocol<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

UV Quanto (HRP DAB) Peroxide Block, UV-Block, Amplifie , HRP Polymer, DAB Quanto 60mL 300-600 TL-060-QHD<br />

UV Quanto (HRP DAB) Peroxide Block, UV-Block, Amplifie , HRP Polymer, DAB Quanto 125mL 625-1250 TL-125-QHD<br />

UV Quanto (HRP) UV-Block, Amplifie , HRP Polymer 60mL 300-600 TL-060-QHL<br />

UV Quanto (HRP) UV-Block, Amplifie , HRP Polymer 125mL 625-1250 TL-125-QHL<br />

Alkaline Phosphatase Systems<br />

UV Quanto (AP) UV-Block, Amplifie , Labeled AP Polymer 60mL 300-600 TL-060-QAL<br />

UV Quanto (AP) UV-Block, Amplifie , Labeled AP Polymer 125mL 625-1250 TL-125-QAL<br />

HRP Chromogen Systems Additional information No. of Tests Volume Cat. No.<br />

DAB Quanto (HRP) Deep brown DAB chromogen. Stable for 1-2 weeks upon mixing 300-600 2mL DAB Chromogen, TA-060-QHDX<br />

60mL Substrate Chromogen,<br />

60mL Substrate<br />

625-1250 4mL DAB Chromogen, TA-125-QHDX<br />

125mL Substrate<br />

DAB Plus (HRP) Deep brown DAB chromogen 300-600 2mL DAB Chromogen,<br />

TA-060-HDX<br />

60mL Substrate<br />

625-1250 4mL DAB Chromogen,<br />

TA-125-HDX<br />

125mL Substrate<br />

AEC (HRP) Red AEC chromogen. Ready to use. Must be aqueously mounted. 300-600 60mL Single Solution TA-060-SA<br />

625-1250 125mL Single Solution TA-125-SA<br />

AP Chromogen Systems Additional information No. of Tests Volume Cat. No.<br />

Liquid Fast-Red (AP) Bright fast red chromogen. Solvent resistant. 300-600 1mL Liquid Chromogen,<br />

TA-060-AL<br />

60mL Substrate<br />

625-1250 2mL Liquid Chromogen,<br />

TA-125-AL<br />

125mL Substrate<br />

Permanent Fast Red Quanto Bright fast red chromogen. Allows on slide mixing and can be 300-600 60mL Chromogen,<br />

TA-060-QAL<br />

(AP)<br />

permanently mounted.<br />

60mL Substrate<br />

625-1250 125mL Chromogen,<br />

TA-125-QAL<br />

125mL Substrate<br />

Tablet Fast-Red (AP) Fast red chromogen. Must be aqueously mounted. 300-600 12 Tablets, 60mL Substrate TA-060-AF<br />

625-1250 25 Tablets, 125mL Substrate TA-125-AF<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

33


Detection System<br />

UltraVision Quanto Mouse-on-Mouse HRP Detection System<br />

Makes Optimal Results Routine With Mouse-on-Mouse IHC<br />

Historically immunohistochemistry (IHC) staining with mouse antibodies on mouse tissue has been a challenge. The<br />

results were compromised by high levels of undesirable background or weak signals from interactions between the<br />

detection system and mouse tissues. The Thermo Scientific UltraVision Quanto Mouse-on-Mouse HRP Detection<br />

System eliminates these challenges, ensuring laboratories can produce optimal results routinely.<br />

Mouse liver stained with Pax-5 and UltraVision Quanto<br />

Mouse-on-Mouse HRP<br />

Mouse liver stained with MRP2 and UltraVision Quanto<br />

Mouse-on-Mouse HRP<br />

Benefits of the UltraVision Quanto Mouse-on-Mouse Detection System Compared to<br />

Past Challenges<br />

Benefits of UltraVision Quanto Mouse-on-Mouse<br />

Strong Staining – Advanced polymer maximizes available<br />

signal to produce clear and consistent results.<br />

Minimizes Background – An advanced yet simple<br />

one-step block reduces troublesome cross-reactivity<br />

between the detection system and mouse tissue.<br />

Simple Procedure – One-step, biotin-free polymer and<br />

single step block reduce background and yield a simple,<br />

reproducible procedure.<br />

Past Challenges of Mouse-on-Mouse IHC<br />

Weak Positive Signals – Some antibodies could not be<br />

optimized without accepting very high background.<br />

High Background – Interpretation of real positive staining<br />

was difficult with high levels of cross-reactivity between the<br />

detection system and mouse tissue.<br />

Complicated Biotin Based Procedures – Procedures<br />

were extremely time consuming and required extensive<br />

optimization with complicated blocking steps.<br />

Ordering Information<br />

Description Includes Volume ~ No. of Tests Cat. No.<br />

UV Quanto Mouse-On-Mouse H 2<br />

0 2<br />

, Mouse-On-Mouse Block, Polymer 15mL 50 - 150 TL-015-QHDM<br />

UV Quanto Mouse-On-Mouse H 2<br />

0 2<br />

, Mouse-On-Mouse Block, Polymer 60mL 200 - 600 TL-060-QHDM<br />

UV Quanto Mouse-On-Mouse H 2<br />

0 2<br />

, Mouse-On-Mouse Block, Polymer 125mL 415 - 1250 TL-125-QHDM<br />

DAB Quanto Substrate, Chromogen 60mL 200 - 600 TA-060-QHDX<br />

Antibody Diluent OP Quanto Antibody Diluent 125mL 415 - 1250 TA-125-ADQ<br />

34 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

Strong Staining<br />

Antibodies are easier to optimize and interpret with the UltraVision Quanto Mouse-on-Mouse Detection System.<br />

The images below compare optimized results with a mouse antibody on mouse colon with the UltraVision Quanto<br />

Mouse-on-Mouse Detection System and a competitive system.<br />

Competitive System optimized Pan CK (Clone AE1/AE3)<br />

Quanto Mouse on Mouse optimized Pan CK (Clone AE1/AE3)<br />

Minimizing Background<br />

The UltraVision Quanto Mouse-on-Mouse Detection System significantly reduces the background seen with many<br />

other systems. The images below compare the optimized negative controls (antibody diluent only) of the UltraVision<br />

Quanto Mouse-on-Mouse Detection System and a competitive system.<br />

Now you see it - Background in a negative control from a competitive<br />

mouse-on-mouse detection system<br />

Now you don’t - UltraVision Quanto Mouse-on-Mouse drastically<br />

reduces background<br />

Simple Procedure<br />

The UltraVision Quanto Mouse-on-Mouse Detection System procedure is simple, with only five detection system steps<br />

with ready to use reagents. Results are possible in under two hours, nearly half the time of competitive systems.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

35


Detection System<br />

UltraVision Labeled Polymer<br />

Enhanced Micro-Polymer System<br />

UltraVision LP is the predecessor to UltraVision Quanto. The polymer system is built around a smaller polymer<br />

subunit allowing more molecules to attach to the primary antibody and penetrate to areas inaccessible to larger<br />

polymer molecules. The enhancer step amplifies mouse antibodies improving sensitivity. UltraVision LP works well in<br />

clinical applications and produces strong consistent results. UltraVision LP can also be used for rabbit antibodies in<br />

the research setting by omitting the enhancer step. Note: UltraVision LP enhances mouse antibodies but not rabbit.<br />

UltraVision Labeled Polymer (UVLP) Protocol<br />

For research applications with Rabbit<br />

antibodies on rodent tissue, omit the<br />

enhancer step to reduce background.<br />

UltraVision Labeled Polymer (UVLP)<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

UltraVision LP (HRP DAB) Peroxide Block, UV-Block, Enhancer, HRP Polymer, DAB Plus 15mL 75-150 TL-015-HD<br />

UltraVision LP (HRP DAB) Peroxide Block, UV-Block, Enhancer, HRP Polymer, DAB Plus 60mL 300-600 TL-060-HD<br />

UltraVision LP (HRP DAB) Peroxide Block, UV-Block, Enhancer, HRP Polymer, DAB Plus 125mL 625-1250 TL-125-HD<br />

UltraVision LP (HRP AEC) Peroxide Block, UV-Block, Enhancer, HRP Polymer, AEC 15mL 75-150 TL-015-HA<br />

UltraVision LP (HRP) UV-Block, Ehancer, HRP Polymer 60mL 300-600 TL-060-HL<br />

UltraVision LP (HRP) UV-Block, Ehancer, HRP Polymer 125mL 625-1250 TL-125-HL<br />

Alkaline Phosphatase<br />

UltraVision LP (AP Fast Red) UV-Block, Enhancer, AP Polymer, Tablet Fast Red 15mL 75-150 TL-015-AF<br />

UltraVision LP (AP) UV-Block, Enhancer, AP Polymer 60mL 300-600 TL-060-AL<br />

UltraVision LP (AP) UV-Block, Enhancer, AP Polymer 125mL 625-1250 TL-125-AL<br />

36 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

UltraVision ONE<br />

Advanced ONE Step Micro-Polymer Detection<br />

The polymer technology used with UltraVision One does not require an additional enhancer step, which allows a<br />

more rapid procedure. UltraVision One is ideal for manual or automated methods and is the detection system of<br />

choice with unfixed or frozen samples where a ten-minute incubation time can be used. With UltraVision One, you<br />

eliminate avidin/biotin background, improve signal-to-noise ratio, and increase specificity.<br />

UltraVision ONE HRP Protocol<br />

UltraVision ONE<br />

Can be reduced to 10 minutes<br />

for frozen sections.<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

UltraVision ONE (HRP DAB) Peroxide Block, UV-Block, HRP (ONE) Polymer, DAB Plus 15mL 75-150 TL-015-HDJ<br />

UltraVision ONE (HRP DAB) Peroxide Block, UV-Block, HRP (ONE) Polymer, DAB Plus 60mL 300-600 TL-060-HDJ<br />

UltraVision ONE (HRP DAB) Peroxide Block, UV-Block, HRP (ONE) Polymer, DAB Plus 125mL 625-1250 TL-125-HDJ<br />

UltraVision ONE (HRP AEC) Peroxide Block, UV-Block, HRP (ONE) Polymer, AEC 15mL 75-150 TL-015-HAJ<br />

UltraVision ONE (HRP) UV-Block, HRP (ONE) Polymer 60mL 300-600 TL-060-HLJ<br />

UltraVision ONE (HRP) UV-Block, HRP (ONE) Polymer 125mL 625-1250 TL-125-HLJ<br />

Alkaline Phosphatase<br />

UltraVision ONE (AP Fast Red) UV-Block, AP (ONE) Polymer, Liquid Fast Red 15mL 75-150 TL-015-AFJ<br />

UltraVision ONE (AP) UV-Block, AP (ONE) Polymer 60mL 300-600 TL-060-ALJ<br />

UltraVision ONE (AP) UV-Block, AP (ONE) Polymer 125mL 625-1250 TL-125-ALJ<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

37


Detection System<br />

MultiVision<br />

Accelerates Diagnosis By Rapidly Differentiating Cell Types<br />

In immunohistochemistry, it is often necessary to examine the interactions between two antigens. Double staining<br />

brings two tests together onto a single slide. Thermo Scientific MultiVision is an easy-to-use optimized double stain<br />

kit that allows double stains to be incorporated into standard IHC workflows. The MultiVision system allows easy<br />

differentiation of cell types via highly contrasting red and blue chromogens.<br />

CD4 (red) and CD8 (blue) in a lymph node<br />

CD3 (blue) and Ki67 (red) in a lymph node<br />

MultiVision Protocol<br />

MultiVision<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

MV Polymer Mouse Red Rabbit<br />

Blue<br />

UV-Block, Peroxide Block, Polymer Cocktail, Red Chromogen, Blue<br />

Chromogen, mounting medium<br />

12mL 60-120 TL-012-MHRA<br />

MV Polymer Mouse Blue Rabbit<br />

Red<br />

UV-Block, Peroxide Block, Polymer Cocktail, Blue Chromogen, Red<br />

Chromogen, mounting medium<br />

12mL 60-120 TL-012-HARH<br />

Antibody Cocktails Description Volume No. of Tests Cat. No.<br />

ALK - CD30 Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2008-R7<br />

CD20 - Ki67 Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2006-R7<br />

CD3 - CD20 Antibody cocktail optimized for TL-012-MARH 7mL 35-70 MV-2002-R7<br />

CD3 Epsilon - Ki67 Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2005-R7<br />

CD4 - CD8 Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2001-R7<br />

GFAP - Ki67 Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2007-R7<br />

Kappa - Lambda Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2003-R7<br />

Vimentin - Melanoma Antibody cocktail optimized for TL-012-MHRA 7mL 35-70 MV-2004-R7<br />

38 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

UltraVision Biotin Streptavidin Detection Systems<br />

Rapid and Robust Biotin Streptavidin Detection System<br />

The UltraVision detection system remains one of the most rapid and robust biotin-streptavidin detection systems<br />

available. UltraVision is available in a polyvalent (anti-mouse and anti-rabbit) format, as well as single species. The<br />

polyvalent formats are available as standard UltraVision or UltraVision Plus, which offers increased sensitivity allowing<br />

shorter incubation times for further dilution of primary antibodies. For clinical applications where endogenous biotin<br />

could be present we recommend a biotin block (Cat. No. TA-015-BB) or the use of a polymer system.<br />

UltraVision HRP Protocol<br />

UltraVision Plus<br />

Can be reduced to 5 minutes<br />

with UltraVision Plus<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

UltraVision Plus (HRP DAB) Peroxide Block, UV-Block, Biotinylated Secondary, HRP Streptavidin, DAB Plus 15mL 75-150 TP-015-HAX<br />

UltraVision Plus (HRP AEC) Peroxide Block, UV-Block, Biotinylated Secondary, HRP Streptavidin, AEC 15mL 75-150 TP-015-HDX<br />

UltraVision Plus (HRP) UV-Block, Biotinylated Secondary, HRP Labeled Streptavidin 60mL 300-600 TP-060-HLX<br />

UltraVision Plus (HRP) UV-Block, Biotinylated Secondary, HRP Labeled Streptavidin 125mL 625-1250 TP-125-HLX<br />

Alkaline Phosphatase<br />

UltraVision Plus (AP Fast Red) UV-Block, Biotinylated Secondary, AP Labeled Streptavidin, Tablet Fast Red 15mL 75-150 TP-015-AFX<br />

UltraVision Plus (AP) UV-Block, Biotinylated Secondary, AP Labeled Streptavidin 60mL 300-600 TP-060-ALX<br />

UltraVision Plus (AP) UV-Block, Biotinylated Secondary, AP Labeled Streptavidin 125mL 625-1250 TP-125-ALX<br />

UltraVision Biotin Streptavidin Detecton Systems continued on page 40.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

39


Detection System<br />

UltraVision Biotin Streptavidin Detection Systems<br />

Continued from page 39.<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

Anti-Mouse<br />

UltraVision Anti-Mouse<br />

(AP Fast Red)<br />

UltraVision Anti-Mouse<br />

(HRP AEC)<br />

UltraVision Anti-Mouse<br />

(HRP DAB)<br />

UV-Block, Biotinylated Goat Anti-Mouse, AP Labeled Streptavidin,<br />

Fast Red Chromogen/Substrate<br />

Peroxide Block, UV-Block, Biotinylated Goat Anti-Mouse Secondary,<br />

HRP Labeled Streptavidin, AEC<br />

Peroxide Block, UV-Block, Biotinylated Goat Anti-Mouse, HRP Labeled<br />

Streptavidin, DAB Chromogen/Substrate<br />

15mL 75-150 TM-015-AF<br />

15mL 75-150 TM-015-HA<br />

15mL 75-150 TM-015-HD<br />

UltraVision Anti-Mouse (AP) UV-Block, Biotinylated Goat Anti-Mouse, AP Labeled Streptavidin 60mL 300-600 TM-060-AL<br />

UltraVision Anti-Mouse (AP) UV-Block, Biotinylated Goat Anti-Mouse, AP Labeled Streptavidin 125mL 625-1250 TM-125-AL<br />

UltraVision Anti-Mouse (HRP) UV-Block, Biotinylated Goat Anti-Mouse, HRP Labeled Streptavidin 60mL 300-600 TM-060-HL<br />

UltraVision Anti-Mouse (HRP) UV-Block, Biotinylated Goat Anti-Mouse, HRP Labeled Streptavidin 125mL 625-1250 TM-125-HL<br />

Anti-Rabbit<br />

UltraVision Anti-Rabbit<br />

(AP Fast Red)<br />

UV-Block, Biotinylated Goat Anti-Rabbit, AP Labeled Streptavidin, Fast Red<br />

Chromogen/Substrate<br />

15mL 75-150 TR-015-AF<br />

UltraVision Anti-Rabbit<br />

(HRP AEC)<br />

UltraVision Anti-Rabbit<br />

(HRP DAB)<br />

Peroxide Block, UV-Block, Biotinylated Goat Anti-Rabbit Secondary, HRP<br />

Labeled Streptavidin, AEC Chromogen<br />

Peroxide Block, UV-Block, Biotinylated Goat Anti-Rabbit, HRP Labeled<br />

Streptavidin, DAB Chromogen/Substrate<br />

15mL 75-150 TR-015-HA<br />

15mL 75-150 TR-015-HD<br />

UltraVision Anti-Rabbit (AP) UV-Block, Biotinylated Goat Anti-Rabbit, AP Labeled Streptavidin 60mL 300-600 TR-060-AL<br />

UltraVision Anti-Rabbit (HRP) UV-Block, Biotinylated Goat Anti-Rabbit, HRP Labeled Streptavidin 60mL 300-600 TR-060-HL<br />

UltraVision Anti-Rabbit (AP) UV-Block, Biotinylated Goat Anti-Rabbit, AP Labeled Streptavidin 125mL 625-1250 TR-125-AL<br />

UltraVision Anti-Rabbit (HRP) UV-Block, Biotinylated Goat Anti-Rabbit, HRP Labeled Streptavidin 125mL 625-1250 TR-125-HL<br />

Anti-Polyvalent (Mouse and Rabbit)<br />

UltraVision Polyvalent<br />

UV-Block, Biotinylated Polyvalent Secondary, AP Labeled Streptavidin, Fast 15mL 75-150 TP-015-AF<br />

(AP Fast Red)<br />

Red Chromogen/Substrate<br />

UltraVision Polyvalent (HRP AEC) Peroxide Block, UV-Block, Biotinylated Polyvalent Secondary, HRP Labeled 15mL 75-150 TP-015-HF<br />

Streptavidin, AEC Chromogen<br />

UltraVision Polyvalent (HRP DAB) Peroxide Block, UV-Block, Biotinylated Polyvalent Secondary, HRP Labeled 15mL 75-150 TP-015-HD<br />

Streptavidin, DAB Chromogen/Substrate<br />

UltraVision Polyvalent (AP) UV-Block, Biotinylated Polyvalent Secondary, AP Labeled Streptavidin 60mL 300-600 TP-060-AL<br />

UltraVision Polyvalent (AP) UV-Block, Biotinylated Polyvalent Secondary, AP Labeled Streptavidin 125mL 625-1250 TP-125-AL<br />

UltraVision Polyvalent, (HRP) UV-Block, Biotinylated Polyvalent Secondary, HRP Labeled Streptavidin 60mL 300-600 TP-060-HL<br />

UltraVision Polyvalent, (HRP) UV-Block, Biotinylated Polyvalent Secondary, HRP Labeled Streptavidin 125mL 625-1250 TP-125-HL<br />

40 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Detection System<br />

UltraVision Labeled Polymer Value Detection System<br />

Provides Similar Polymer Technology to UltraVision LP At A Lower Price Per Slide<br />

UltraVision LP Value offers sensitivity and signal amplification similar to UltraVision LP, at a more economical price.<br />

As with UltraVision LP, you use less antibody, eliminate avidin/biotin background problems, improve signal-to-noise<br />

ratio, and increase sensitivity.<br />

UltraVision Label Polymer Value Protocol<br />

UltraVision LP Value<br />

Product Name Kit Includes Volume No. of Tests Cat. No.<br />

HRP Systems<br />

UV LP Value (HRP DAB) Peroxide Block, UV-Block, Enhancer, Value Polymer, DAB Plus 15mL 75-150 TL-015-HDS<br />

UV LP Value (HRP AEC) Peroxide Block, UV-Block, Enhancer, Value Polymer, AEC 15mL 75-150 TL-015-HAS<br />

UV LP Value (HRP) UV-Block, Enhancer, Value Polymer 60mL 300-600 TL-060-HLS<br />

UV LP Value (HRP) UV-Block, Enhancer, Value Polymer 125mL 625-1250 TL-125-HLS<br />

Antibody Cocktails Description Volume No. of Tests Cat. No.<br />

UV LP Value (AP Fast Red) UV-Block, Enhancer, Value Polymer, Tablet Fast Red 15mL 75-150 TL-015-AFS<br />

UV LP Value (AP) UV-Block, Enhancer, Value Polymer 60mL 300-600 TL-060-ALS<br />

UV LP Value (AP) UV-Block, Enhancer, Value Polymer 125mL 625-1250 TL-125-ALS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

41


Ancillary Panel<br />

High Quality And Affordable Ancillary Products<br />

For Manual or Automated Staining<br />

• Antigen Retrieval Buffers and Enzymes<br />

• Chromogens<br />

• Blocking Reagents<br />

• Wash Buffers<br />

• Antibody Diluent<br />

• Automated Cleaning Reagents<br />

42 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ancillary Panel<br />

NEW<br />

Thermo Scientific Heat Induced Epitope Retrieval (HIER) Buffers<br />

The NEW Thermo Scientific HIER buffers provide optimal performance with the Thermo Scientific PT Module<br />

antigen retrieval device. These buffers feature increased pH stability, pH color coding and 15mL volumes to<br />

reduce potential errors and manual steps associated with routine antigen retrieval.<br />

The benefits of the NEW Thermo<br />

Scientific HIER buffers include:<br />

• Easy dilution procedure – Simply add one 15mL<br />

bottle to the PT Module tank and then add the<br />

deionized water (1.5L total)<br />

• New formulation increases pH stability and<br />

performance for at least 5 runs or 1 week of use<br />

• pH specific color coding reduces potential errors<br />

• Validated with many antibodies and the Thermo<br />

Scientific UltraVision Quanto detection system<br />

product line<br />

Description Volume No. of Tests Cat. No.<br />

HIER Buffer Low (100X concentrate) 9 x 15mL Up to 45 PT Module Runs and 1080 tests TA-135-HBL<br />

HIER Buffer Medium (100X concentrate) 9 x 15mL Up to 45 PT Module Runs and 1080 tests TA-135-HBM<br />

HIER Buffer High (100X concentrate) 9 x 15mL Up to 45 PT Module Runs and 1080 tests TA-135-HBH<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

43


Ancillary Panel<br />

Complete List of Thermo Scientific Antigen<br />

Retrieval Buffers and Enzymes<br />

Buffers and Enzymes Additional Information No. of Tests Volume Cat. No.<br />

HIER Buffer Low<br />

Optimized for the PT Module. Barcoded for Up to 1080 9x15mL (135mL Total) TA-135-HBL<br />

(100X concentrate)<br />

inventory management.<br />

HIER Buffer Medium<br />

(100X concentrate)<br />

HIER Buffer High<br />

(100X concentrate)<br />

PT Module (100X) Citrate buffer<br />

pH 6<br />

Optimized for the PT Module. Barcoded for<br />

inventory management.<br />

Optimized for the PT Module. Barcoded for<br />

inventory management.<br />

Deparaffinization and antigen retrieval<br />

solution.<br />

Up to 1080 9x15mL (135mL Total) TA-135-HBM<br />

Up to 1080 9x15mL (135mL Total) TA-135-HBH<br />

190-575+ 125mL TA-125-PM1X<br />

250mL<br />

TA-250-PM1X<br />

PT Module (100X) EDTA buffer Deparaffinization and antigen retrieval 190-575+ 125mL TA-125-PM2X<br />

pH 8<br />

solution.<br />

250mL<br />

TA-250-PM2X<br />

PT Module (100X) EDTA buffer Deparaffinization and antigen retrieval 190-575+ 125mL TA-125-PM4X<br />

pH 9<br />

solution.<br />

250mL<br />

TA-250-PM4X<br />

PT Module (100X) Tris-HCL buffer Deparaffinization and antigen retrieval 190-575+ 125mL TA-125-PM3X<br />

pH 10<br />

solution.<br />

250mL<br />

TA-250-PM3X<br />

Pepsin Solution For enzyme-induced antigen retrieval. 25-50 5mL AP-9007-005<br />

625-1250 125mL TA-125-PE<br />

Protease XXV For enzyme-induced antigen retrieval. 10-20 2mL reconstituted AP-9006-002<br />

25-50 5mL reconstituted AP-9006-005<br />

Trypsin Solution For enzyme-induced antigen retrieval. 100-200 15mL buffer, 5 mL trypsin TA-015-TR<br />

775-1550 125mL buffer, 30 mL trypsin TA-125-TR<br />

Citrate Buffer For Antigen Retrieval Antigen retrieval solution. Varies by application (50mL) (10X) AP-9003-50<br />

(10X)<br />

(125mL) (10X)<br />

AP-9003-125<br />

(500mL) (10X)<br />

AP-9003-500<br />

EDTA Buffer For Antigen Retrieval Antigen retrieval solution. Varies by application (50mL) (10X) AP-9004-050<br />

(10X)<br />

(125mL) (10X)<br />

AP-9004-125<br />

(500mL) (10X)<br />

AP-9004-500<br />

Tris-HCl Buffer For Antigen Antigen retrieval solution. Varies by application (50mL) (10X) AP-9005-050<br />

Retrieval (10X)<br />

(125mL) (10X)<br />

AP-9005-125<br />

(500mL) (10X)<br />

AP-9005-500<br />

Citrate Buffer For Antigen Retrieval<br />

(100X)<br />

Antigen retrieval solution. Varies by application 50mL (100X) TA-050-CBX<br />

EDTA Buffer For Antigen Retrieval<br />

(100X)<br />

Tris-HCl Buffer For Antigen<br />

Retrieval (100X)<br />

Antigen retrieval solution. Varies by application 50mL (100X) TA-050-EBX<br />

Antigen retrieval solution. Varies by application 50mL (100X) TA-050-TSX<br />

44 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ancillary Panel<br />

Thermo Scientific Chromogens for IHC<br />

For routine IHC we recommend using the following primary chromogens. Most recommended chromogens<br />

provide walk-away automation with any open IHC instrumentation. On slide chromogen mixing, long stability<br />

or ready to use reagents mean you prepare your chromogen along with the rest of the IHC reagents and not<br />

immediately before use.<br />

Description Kit Contents Volume ~No. of Tests Cat. No.<br />

Permanent Fast Red Quanto (AP) Substrate and Chromogen (Equal parts) 60mL 200-300 TA-060-QAL<br />

Permanent Fast Red Quanto (AP) Substrate and Chromogen (Equal parts) 125mL 415-625 TA-125-QAL<br />

Liquid Fast Red (AP) Substrate and Chromogen 60mL 200-300 TA-060-AL<br />

Liquid Fast Red (AP) Substrate and Chromogen 125mL 415-625 TA-125-AL<br />

DAB Quanto (Brown HRP) Substrate and Chromogen 60mL 200-300 TA-060-QHDX<br />

DAB Quanto (Brown HRP) Substrate and Chromogen 125mL 415-625 TA-125-QHDX<br />

AEC (Red HRP) Ready-to-Use Chromogen 60mL 200-300 TA-060-SA<br />

AEC (Red HRP) Ready-to-Use Chromogen 125mL 415-625 TA-125-SA<br />

Chromogens for HRP Detection Systems<br />

Thermo Scientific DAB Quanto (TA-125-QHDX)<br />

Mixing: 1mL Substrate to 1 drop Chromogen<br />

Thermo Scientific AEC (TA-125-SA)<br />

Mixing: None. Chromogen is ready-to-use<br />

Incubation: 5 minutes<br />

Stability: Working solution<br />

S<br />

stable<br />

1 week at room temperature<br />

2 weeks refrigerated (2-8°C)<br />

C<br />

C<br />

S<br />

C<br />

Incubation: 10 minutes<br />

Stability: 18 months refrigerated (2-8°C)<br />

C<br />

S<br />

C<br />

C<br />

Chromogens for AP Detection Systems<br />

Thermo Scientific Permanent<br />

Fast Red Quanto (TA-125-QAL)<br />

Thermo Scientific Liquid Fast<br />

Red (TA-125-AL)*<br />

Mixing: Equal parts Chromogen and<br />

Substrate. Allows mixing directly on<br />

the slide<br />

Incubation: Substrate (1-5 minutes)<br />

Chromogen (10 minutes)<br />

Stability: Individual<br />

reagents are stable<br />

for 18 months<br />

S<br />

C<br />

S<br />

C<br />

Mixing: 3mL Substrate to 1 drop<br />

Chromogen<br />

Incubation: 10-25 minutes<br />

Stability: Use working solution<br />

within 10-25 minutes<br />

C<br />

S<br />

C<br />

C<br />

C<br />

S<br />

C<br />

*Note: Batch preparation required.<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

45


Ancillary Panel<br />

Complete List of All Thermo Scientific Chromogens for IHC<br />

HRP Chromogen Systems Additional information No. of Tests Volume Cat. No.<br />

DAB Quanto (HRP)<br />

Deep brown DAB chromogen.<br />

300-600 2mL DAB Chromogen, 60mL Substrate TA-060-QHDX<br />

Stable for 1-2 weeks upon mixing.<br />

625-1250 4mL DAB Chromogen, 125mL Substrate TA-125-QHDX<br />

DAB Plus (HRP) Deep brown DAB chromogen. 300-600 2mL DAB Chromogen, 60mL Substrate TA-060-HDX<br />

625-1250 4mL DAB Chromogen, 125mL Substrate TA-125-HDX<br />

AEC (HRP)<br />

Red AEC chromogen. Ready to use<br />

300-600 60mL Single Solution TA-060-SA<br />

Must be aqueously mounted.<br />

625-1250 125mL Single Solution TA-125-SA<br />

AP Chromogen Systems Additional information No. of Tests Volume Cat. No.<br />

Permanent Fast-Red Quanto Bright fast red chromogen. Allows on slide 300-600 60mL Chromogen, 60mL Substrate TA-060-QAL<br />

(AP)<br />

mixing and can be permenantly mounted. 625-1250 125mL Chromogen, 125mL Substrate TA-125-QAL<br />

Liquid Fast-Red (AP)<br />

Bright fast red chromogen.<br />

300-600 1mL Liquid Chromogen, 60mL Substrate TA-060-AL<br />

Solvent resistant.<br />

625-1250 2mL Liquid Chromogen,125mL Substrate TA-125-AL<br />

Tablet Fast-Red (AP)<br />

Fast red chromogen. Must be aqueously 300-600 12 Tablets, 60mL Substrate TA-060-AF<br />

mounted.<br />

625-1250 25 Tablets, 125mL Substrate TA-125-AF<br />

The Thermo Scientific AP and HRP chromogens are optimized for Thermo Scientific detection systems but can be<br />

optimized with other commercially available detection systems. Please note that DAB and AEC chromogens must<br />

be used with HRP detection systems and Fast Red chromogens must be used with AP detection systems.<br />

46 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ancillary Panel<br />

Other Ancillary Products<br />

Blocking Reagents<br />

Blocking Reagents Additional information No. of tests Volume Cat. No.<br />

Ultra V Block Serum-free blocking reagent for IHC. 300-600 60 mL TA-060-UB<br />

625-1250 125mL TA-125-UB<br />

Hydrogen Peroxide Block Endogenous peroxide blocking agent. 300-600 60mL TA-060-HP<br />

625-1250 125mL TA-125-HP<br />

FITC Protein Blocking Agent (PBA) For use with FITC conjugated antibodies. 30-60 6mL TA-006-PBA<br />

Avidin Biotin Blocking Solution For use with Biotin/Streptavidin detection systems. 75-150 15mL Avidin Block +<br />

15mL Biotin Block<br />

TA-015-BB<br />

Wash Buffers and Diluents<br />

Wash Buffers and Diluents Additional Information No. of Tests Volume Cat. No.<br />

Antibody Diluent OP Quanto Antibody diluent optimized to ensure antibody stability. Varies by application 125mL TA-125-ADQ<br />

Tris Buffer Saline and Tween 20 (20X) Makes 2500mL total. Varies by application 125mL TA-125-TT<br />

Tris Buffer Saline and Tween 20 (20X) Ideal for automated use 20L total. 325-650 (automated) 1000mL TA-999-TT<br />

Phosphate Buffered Saline and Tween 20 (20X) Makes 2500mL total. Varies by application 125mL TA-125-PT<br />

Phosphate Buffered Saline and Tween 20 (20X) Ideal for automated use 20L total. 325-650 (automated) 1000mL TA-999-PT<br />

Phosphate Buffered Saline (10X) Makes 10 liters total. Varies by application Powder for<br />

1L of 10X<br />

AP-9009-10<br />

Phosphate Buffered Saline (25X) Makes 3125 mLs total. Varies by application 125mL TA-125-PB<br />

Tris Buffered Saline (25X) Makes 3125 mLs total. Varies by application 125mL TA-125-TB<br />

Counterstains and Mounting Mediums<br />

Aqueous Mounting Medium<br />

and Counterstains<br />

Additional Information No. of Slides Volume Cat. No.<br />

Aqua-Mount Aqueous Mounting Medium For use with or without a coverslip. 625-125 125mL TA-125-AM<br />

PermaFluor For use with fluorescent dyes 30-60 6mL TA-006-FM<br />

150-300 30mL TA-030-FM<br />

Mayer’s Hematoxylin Aqueous (alcohol-free) hematoxylin. 300-600 60mL TA-060-MH<br />

For a complete list of permanent mounting mediums, please see our Thermo Scientific Anatomical<br />

Pathology Product Catalog or visit www.thermoscientific.com/pathology<br />

Automated Cleaning Reagents<br />

635-1250 125mL TA-125-MH<br />

Miscellaneous Additional Information No. of Slides Volume Cat. No.<br />

UltraVision DAB Away For use with Autostainer<br />

automated cleaning<br />

More than 10,000 slides 125mL DAB Away Reagent 1 (TA-125-R1),<br />

125mL DAB Away Reagent 2 (TA-125-R2),<br />

250mL DAB Away Decolorizer (TA-250-R3)<br />

TA-250-DA<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

47


Complete Antibody Directory<br />

Complete Antibody Directory<br />

The following pages contain our complete directory of antibodies available within the Thermo Scientific <strong>Immunohistochemistry</strong><br />

(IHC) portfolio. The antibodies are designed for multiple applications such as clinical or research IHC and<br />

applications other than IHC such as Western Blotting (WB) or immunoprecipitation (IP). For the latest product updates<br />

contact your local representative or visit www.thermoscientific.com/labvision. The diagram below describes how<br />

to best utilize the antibody directory.<br />

IVD Icon:<br />

This means the antibody may have<br />

clinical applications. Check the<br />

Regional Regulatory Status at the<br />

bottom for information on your region.<br />

Laminin Receptor Ab-1, Monoclonal Antibody<br />

General Product<br />

Information<br />

Applications:<br />

List of applications that<br />

may be applicable for this<br />

antibody.<br />

Note: Only IHC, IF, IP and<br />

WB are tested within our<br />

own laboratory.<br />

Host Species: Mouse<br />

Clone: MLuC5<br />

Isotype: IgM<br />

Cross Reactivity: Human. Others-not known.<br />

Epitope: Not determined<br />

Immunogen: Small cell lung carcinoma N592 live cells<br />

Molecular Weight: 67kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cell membrane with some cytoplasmic<br />

Applications:<br />

• Flow Cytometry<br />

• Immunofluorescenc<br />

• Inhibits (partially) the binding of soluble laminin<br />

• Immunohistology (Formalin/paraffin<br />

IVD†<br />

RabbitMAb<br />

Formalin-fixed,paraffin-embedde<br />

human breastcarcinoma stained<br />

with NeoMarkers’Laminin<br />

ReceptorAb-1 (Cat No. MS-259-P)<br />

usingperoxidaseconjugate<br />

and DAB chromogen. Note cell<br />

membrane with some cytoplasmic<br />

staining of tumorcells.<br />

Format Quantity Concentration Cat. No.<br />

Purified Ab with BSA and Azide 100µL 200µg/mL MS-259-P0<br />

Purified Ab with BSA and Azide 500µL 200µg/mL MS-259-P1<br />

Purified Ab with BSA and Azide 1mL 200µg/mL MS-259-P<br />

Purified Ab without BSA and Azide 100µL 1mg/mL MS-259-P1ABX<br />

Purified Ab without BSA and Azide 200µL 1mg/mL MS-259-PABX<br />

Ready-to-use for IHC 7mL n/a MS-259-R7<br />

Positive Control for Histology 5 Slides n/a MS-259-PCS<br />

USA: IVD; Int’l: IVD<br />

Rabbit Monoclonal Icon<br />

This icon is used to indicate<br />

rabbit monoclonal antibodies.<br />

Rabbit monoclonal antibodies<br />

have shown superiority to other<br />

clones for many markers.<br />

Part Numbers:<br />

Reference these<br />

when ordering.<br />

Regional Regulatory Status Key:<br />

This key indicates the general classification of products by region. Antibodies can fall under<br />

any of three regulatory classes:<br />

• IVD – For In-vitro Diagnostic use.<br />

• ASR – Analyte Specific Reagent – Specific to the United States. Performance characteristics<br />

must be established by the investigator for use in a diagnostic assay.<br />

• RUO – Research Use Only – This antibody is designed for research applications and is<br />

not designed for diagnostic purposes. All products are RUO unless otherwise stated.<br />

A regulatory status of ASR or IVD only applies to RQ, R7, R2, A, S, and P formats. All other<br />

formats are for research use only. Consult the product IVD data sheet for specific diagnostic<br />

recommendations. All products are manufactured in our ISO13485 certified manufacturing<br />

facility.<br />

The regulatory status key is meant for general reference only and users must<br />

consult local regulations for specific requirements in their region. Please contact<br />

your local representative for more information.<br />

48 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Complete Antibody Directory<br />

Antibody Format Information<br />

Use this page for more information when choosing your specific antibody format. For immunohistochemistry,<br />

we recommend either the Ready-to-Use “R” formats or Concentrates “P, S, or<br />

A” formats. Specific detail is given on each product format type below.<br />

Part Number Volume and Concentration Supplied As:<br />

XX-####-P (-B) – 200µg in 1.0mL Ascites, concentrated, column purified in 10mM<br />

XX-####-P1 (-B1) – 100µg in 0.5mL<br />

PBS (pH 7.4) with 0.09% Sodium Azide and 0.2%<br />

XX-####-P0 (-B0) – 20µg in 0.1mL<br />

Bovine Serum Albumin. “B” indicates that the<br />

product is labeled with biotin. Store at 2-8°C.<br />

XX-####-PABX – 200µg in 0.2mL Ascites, concentrated, column purified in 10mM<br />

XX-####-P1ABX – 100µg in 0.1mL<br />

PBS (pH 7.4) (without BSA and Sodium Azide).<br />

Store frozen at ~-20°C.<br />

XX-####-S – 1.0mL Tissue culture supernatant, concentrated, with<br />

XX-####-S1<br />

– 0.5mL<br />

0.09% Sodium Azide. Store at 2-8°C.<br />

XX-####-S0<br />

– 0.1mL<br />

XX-####-A (-F) – 1.0mL An unspecified amount of purifi immunoglobulin,<br />

XX-####-A1 (-F1) – 0.5mL<br />

concentrated, in 10mM PBS (pH 7.4) with 0.09%<br />

XX-####-A0 (-F) – 0.1mL<br />

Sodium Azide and 0.2% Bovine Serum Albumin.<br />

“F” indicates that the product is FITC conjugated.<br />

Store at 2-8°C.<br />

XX-####-RQ – 12.0mL (overfilled) Quant Ready-to-use, concentration optimized for<br />

XX-####-R7<br />

– 7.0mL UVLP<br />

immunohistochemical staining on formalin-fixed<br />

XX-####-R2<br />

– 2.0mL<br />

paraffin-embedded tissue sections Note the 12mL<br />

RQ size is overfilled for automation use on the<br />

Thermo Scientific Autostainer. Store at 2-8°C.<br />

POLYCLONAL CATALOG NUMBERS:<br />

XX-####-P – 1.0mg or 200µg in 1.0mL Antisera purified in 10mM PBS (pH 7.4) with<br />

XX-####-P1<br />

– 0.5mg or 100µg in 0.5mL 0.09% Sodiun Azide and 0.2% Bovine Serum<br />

XX-####-P0<br />

– 0.1mg or 20µg in 0.1mL Albumin (rabbit). “B” indicates that the product is<br />

lableled with biotin. Store at 2-8°C.<br />

XX-####-PABX – 1.0mg in 1.0mL Antisera purified in 10mM PBS (pH 7.4) (without<br />

XX-####-P1ABX – 0.5mg in 0.5mL<br />

BSA and Sodium Azide). Store frozen at ~-20°C.<br />

XX-####-A – 1.0mL Antisera, unspecified amount of purifie<br />

XX-####-A1<br />

– 0.5mL<br />

immunoglobulins, concentrated, in 10mM PBS (pH<br />

XX-####-A0<br />

– 0.1mL<br />

7.4) with 0.09% Sodium Azide and 0.2% Bovine<br />

Serum Albumin. Store at 2-8°C.<br />

XX-####-RQ – 12.0mL (overfilled Antisera, ready-to-use, concentration optimized for<br />

XX-####-R7<br />

– 7.0mL<br />

immunohistochemical staining on formalin-fixed<br />

XX-####-R2<br />

– 2.0mL<br />

paraffin-embedded tissue sections Note the 12mL<br />

RQ size is overfilled for automation use on the<br />

Thermo Scientific Autostainer. Store at 2-8°C.<br />

OTHER FORMATS<br />

XX-####-PCL 250ug in 0.1mL Positive control lysate for Western blotting.<br />

XX-####-PCS 5 Slides Five slides with formalin-fixed paraffin-embedded<br />

tissue sections for immunohistochemical staining.<br />

Can be stored at room temperature.<br />

RP-XXX-P1ABX 5µg in 50µl Recombinant protein, in 10mM PBS (7.4) (without<br />

RP-XXX-PABX<br />

10µg in 0.1mL<br />

BSA and Sodium Azide). Store frozen at ~-20°C.<br />

Part Number Key<br />

XX = MS, RM, RB, RT, SH, GT,<br />

HM or NC<br />

MS – Mouse Monoclonal<br />

RM – Rabbit Monoclonal<br />

RB – Rabbit Polyclonal<br />

RT – Rat Monoclonal<br />

SH – Sheep Polyclonal<br />

GT – Goat Polyclonal<br />

HM – Hamster Monoclonal<br />

NC – Negative Control<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

49


14.3.3γ Ab-2, Mouse Monoclonal Antibody<br />

14.3.3σ Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CG31<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: 14.3.3γ recombinant human protein<br />

Molecular Weight: 26-33kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

14.3.3 pan Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CG15<br />

Isotype: IgG1/k<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: 14.3.3γ recombinant human protein<br />

Molecular Weight: 26-33kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–14.3.3γ<br />

Ab–2, Denatured<br />

IP<br />

anti–14.3.3γ<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1502-P0<br />

200µg/mL MS-1502-P1<br />

200µg/mL MS-1502-P<br />

1mg/mL MS-1502-P1ABX<br />

1mg/mL MS-1502-PABX<br />

250µg/100µL MS-1502-PCL<br />

anti–14.3.3<br />

pan, Denatured<br />

IP<br />

anti–14.3.3<br />

pan, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1504-P0<br />

200µg/mL MS-1504-P1<br />

200µg/mL MS-1504-P<br />

1mg/mL MS-1504-P1ABX<br />

1mg/mL MS-1504-PABX<br />

250µg/100µL MS-1504-PCL<br />

Host Species: Mouse<br />

Clone: 1433S01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human 14.3.3σ<br />

protein<br />

Molecular Weight: 26-30kDa<br />

Positive Control: HT29 cells, Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human skin stained with 14.3.3σ<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–14–3–3sigma<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1185-P0<br />

200µg/mL MS-1185-P1<br />

200µg/mL MS-1185-P<br />

1mg/mL MS-1185-P1ABX<br />

1mg/mL MS-1185-PABX<br />

n/a MS-1185-R7<br />

n/a MS-1185-PCS<br />

250µg/100µL MS-1185-PCL<br />

6-Histidine (Epitope Tag) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4D11<br />

Isotype: IgG2a/κ<br />

Species Reactivity: All species.<br />

Epitope: HHHHHHGS<br />

Immunogen: A His-tagged recombinant protein<br />

Positive Control: Hexa-histidine fusion protein<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

hexa-histidine<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Affinity Purification<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-667-P0<br />

MS-667-P1<br />

MS-667-P<br />

MS-667-P1ABX<br />

MS-667-PABX<br />

USA: RUO; Int'l: RUO<br />

ACTH, see Adrenocorticotrophic Hormone<br />

50<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Actin β, Rabbit Polyclonal Antibody<br />

Actin, Muscle Specific Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human, Mouse, Rat,<br />

Bovine, Sheep, Pig, Rabbit, Cat, Dog,<br />

Guinea Ppig, Chicken, Hirudo medicinalis<br />

(leech) and Drosophila.<br />

Epitope: N-terminus<br />

Immunogen: Synthetic peptide<br />

corresponding to N-terminus of human<br />

β-actin<br />

Positive Control: Human leiomyoma<br />

Cellular Localization: Cytoplasmic and FFPE human smooth muscle stained with anti–Actin Beta,<br />

WB<br />

cell membrane<br />

βActin.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9421-P0<br />

RB-9421-P1<br />

RB-9421-P<br />

RB-9421-R7<br />

Host Species: Mouse<br />

Clone: MSA06; same as HUC1-1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse, Rat, Pig, Horse,<br />

Cow and Dog. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Purified actin<br />

Positive Control: Muscle or sarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human rectum stained with Muscle<br />

Specific Actin Ab–6.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1296-P0<br />

MS-1296-P1<br />

MS-1296-P<br />

MS-1296-P1ABX<br />

MS-1296-PABX<br />

MS-1296-R7<br />

MS-1296-PCS<br />

Actin, Muscle Specific Ab-4, Mouse Monoclonal Antibody<br />

Actin, pan Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HHF35<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Rabbit and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: SDS extract of human myocardium<br />

Positive Control: Muscle or sarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human skeletal muscle stained with<br />

Muscle Specific Actin Ab–4.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-742-S0<br />

MS-742-S1<br />

MS-742-S<br />

MS-742-R7<br />

MS-742-RQ<br />

MS-742-PCS<br />

Host Species: Mouse<br />

Clone: ACTN05; same as C4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Mouse, Dog, Pig, Rabbit,<br />

Rat, Chicken, Dictyostelium discoideum and Physarum<br />

polycephalum. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Chicken gizzard actin<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Actin,<br />

Denatured IP<br />

anti–Actin,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1295-P0<br />

200µg/mL MS-1295-P1<br />

200µg/mL MS-1295-P<br />

1mg/mL MS-1295-P1ABX<br />

1mg/mL MS-1295-PABX<br />

200µg/mL MS-1295-B0<br />

200µg/mL MS-1295-B1<br />

200µg/mL MS-1295-B<br />

250µg/100µL MS-1295-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

51


Actin, Skeletal Muscle Ab-2, Mouse Monoclonal Antibody<br />

Actin, Smooth Muscle, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5C5.F8.C7 (α-Sr-1)<br />

Isotype: IgM/κ<br />

Species Reactivity: Human, Cow, Rabbit, Sheep, Rat,<br />

Guinea Pig and Frog. Others not known.<br />

Epitope: N-terminal decapeptide<br />

Immunogen: N-Terminal decapeptide of α skeletal<br />

muscle isoform of actin; acetylated at the N-terminus<br />

Positive Control: Skeletal or Cardiac muscle, or<br />

Rhabdomyosarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

FFPE human skeletal muscle stained with<br />

Skeletal Muscle Actin Ab–2.<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Cow, Rabbit,<br />

Mouse, Rat and Chicken. Others not tested.<br />

Epitope: N-terminus<br />

Immunogen: A synthetic peptide from N-terminus of<br />

human α-smooth muscle isoform of actin<br />

Positive Control: Smooth muscle of arteries, gut wall,<br />

uterus and Leiomyoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human leiomyoma stained with<br />

Smooth Muscle Actin.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-185-P0<br />

MS-185-P1<br />

MS-185-P<br />

MS-185-R7<br />

MS-185-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9010-P0<br />

RB-9010-P1<br />

RB-9010-P<br />

RB-9010-R7<br />

USA: RUO; Int'l: RUO<br />

ADA-Binding Protein, see CD26<br />

Actin, Smooth Muscle Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1A4; also known as asm-1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Baboon, Cow, Rabbit,<br />

Mouse, Rat and Chicken. Others not known.<br />

Epitope: Acetyl group and the first four amino acids<br />

on the N-terminal end of the peptidic chain of<br />

α-smooth actin<br />

Immunogen: N-terminal decapeptide of α-smooth<br />

muscle isoform of actin; acetylated at the N-terminus<br />

Positive Control: Smooth muscle or leiomyosarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human leiomyoma stained with<br />

Smooth Muscle Actin Ab–1.<br />

Conc.<br />

40µg/mL<br />

40µg/mL<br />

40µg/mL<br />

1mg/mL<br />

1mg/mL<br />

40µg/mL<br />

40µg/mL<br />

40µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-113-P0<br />

MS-113-P1<br />

MS-113-P<br />

MS-113-P1ABX<br />

MS-113-PABX<br />

MS-113-B0<br />

MS-113-B1<br />

MS-113-B<br />

MS-113-R7<br />

MS-113-RQ<br />

MS-113-PCS<br />

ADAM17, see TACE<br />

Adenomateous Polyposis Coli, see APC<br />

Adenovirus Fiber (Monomer and Trimer) Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 4D2<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Adenovirus.<br />

Epitope: N-terminus, probably the first 17aa<br />

Immunogen: UV-irradiated Ad2 virus<br />

Molecular Weight: 62kDa (monomer) and 180-200kDa (trimer)<br />

Positive Control: Adenovirus infected cells and tissues<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Inhibition of Ad2 attachment (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1027-P0<br />

MS-1027-P1<br />

MS-1027-P<br />

MS-1027-P1ABX<br />

MS-1027-PABX<br />

†USA: IVD; Int'l: IVD<br />

52<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Adenovirus Type 2 and 5 Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M58 + M73<br />

Isotype: IgG2a/κ + IgG2a/κ<br />

Species Reactivity: Adenovirus.<br />

Immunogen: Adenovirus<br />

Positive Control: 293 cells or adenovirus<br />

infected tissues<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human infected appendix stained withanti–Aden-<br />

ovirus Type 2<br />

Adenovirus Ab–5.<br />

and 5 Ab–5,<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1069-P0<br />

200µg/mL MS-1069-P1<br />

200µg/mL MS-1069-P<br />

1mg/mL MS-1069-P1ABX<br />

1mg/mL MS-1069-PABX<br />

n/a MS-1069-R7<br />

250µg/100µL MS-1069-PCL<br />

Adenovirus Type 2 E1A Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M73<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Adenovirus.<br />

Immunogen: Adenovirus<br />

Molecular Weight: 35-46kDa<br />

Positive Control: 293 cells or adenovirus<br />

infected tissues<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human infected appendix stained withanti–Aden-<br />

ovirus Type 2<br />

Adenovirus Ab–2.<br />

E1A Ab–2, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-588-P0<br />

200µg/mL MS-588-P1<br />

200µg/mL MS-588-P<br />

1mg/mL MS-588-P1ABX<br />

1mg/mL MS-588-PABX<br />

250µg/100µL MS-588-PCL<br />

Adenovirus Type 5 E1A Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M58<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Adenovirus.<br />

Immunogen: Adenovirus<br />

Molecular Weight: 35-46kDa<br />

Positive Control: 293 cells or adenovirus infected cells and tissues<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Adenovirus<br />

Type 5<br />

E1A Ab–1,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-587-P0<br />

200µg/mL MS-587-P1<br />

200µg/mL MS-587-P<br />

1mg/mL MS-587-P1ABX<br />

1mg/mL MS-587-PABX<br />

200µg/mL MS-587-B0<br />

200µg/mL MS-587-B1<br />

200µg/mL MS-587-B<br />

250µg/100µL MS-587-PCL<br />

ADP-Ribosylation Factor (ARF) 6 Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 6ARF01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: ARF6 protein<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1269-P0<br />

MS-1269-P1<br />

MS-1269-P<br />

MS-1269-P1ABX<br />

MS-1269-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

53


Adrenocorticotrophic Hormone (ACTH) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: AH26<br />

Isotype: IgG1<br />

Species Reactivity: Human. It shows a broad species<br />

reactivity.<br />

Epitope: aa 1-24<br />

Immunogen: A synthetic peptide corresponding to aa<br />

1-24 from the N-terminal of human ACTH<br />

Positive Control: Normal pituitary gland or pituitary<br />

adenoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human pituitary gland stained with<br />

ACTH Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-452-P0<br />

MS-452-P1<br />

MS-452-P<br />

MS-452-P1ABX<br />

MS-452-PABX<br />

MS-452-R7<br />

MS-452-PCS<br />

Adrenocorticotrophic Hormone (ACTH), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. It shows broad species reactivity.<br />

Epitope: aa 1-24<br />

Immunogen: Synthetic peptide derived from N-terminus of human ACTH<br />

Positive Control: ACTH recombinant protein<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

anti–Adrenocorticotrophic<br />

Hormone<br />

(ACTH), WB<br />

Albumin, FITC Labeled Antibody<br />

Host Species: Rabbit<br />

IVD†<br />

Species Reactivity: Reacts with the albumin plasma protein found in<br />

human serum and tissues.<br />

Immunogen: Albumin isolated from human serum<br />

Positive Control: Liver, kidney, or lymphatic tissues fixed and processed in the same<br />

manner as the test specimen<br />

Cellular Localization: Liver, spleen, lymph nodes, bone marrow; used in detecting<br />

certain types of kidney tissue<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1925-R2<br />

ALK (Anaplastic Lymphoma Kinase)/p80 Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 5A4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: aa 419-520 (tyrosine kinase domain)<br />

Immunogen: Recombinant protein corresponding to<br />

a region which spans the tyrosine kinase catalytic<br />

domain and part of the C-terminus of the NPM-ALK<br />

transcript (419-520aa)<br />

Molecular Weight: 80kDa<br />

Positive Control: Anaplastic lymphoma<br />

Cellular Localization: Cytoplasmic and/or nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not recommended)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human anaplastic lymphoma stained<br />

with ALK/p80 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1104-S0<br />

MS-1104-S1<br />

MS-1104-S<br />

MS-1104-R7<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

RB-9217-P0<br />

RB-9217-P1<br />

RB-9217-P<br />

USA: RUO; Int'l: RUO<br />

AFP, see α-Fetoprotein<br />

54<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


ALK (Anaplastic Lymphoma Kinase)/p80, Rabbit Monoclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Clone: SP8<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein corresponding to<br />

a region which spans the tyrosine kinase catalytic<br />

domain and part of the C-terminus of the NPM-ALK<br />

transcript<br />

Positive Control: Anaplastic lymphoma<br />

Cellular Localization: Cytoplasmic + nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Alk/CD30, MultiVision Antibody Cocktail<br />

Host Species: Alk — Rabbit; CD30 — Mouse<br />

Clone: Alk — SP8; CD30 — CON6D/C2<br />

Isotype: Alk — Rabbit IgG; CD30 — Mouse IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Alk — Not determined; CD30 — Not<br />

determined<br />

Immunogen: Alk — Recombinant protein<br />

corresponding to a region spanning the tyrosine kinase<br />

catalytic domain and part of the C-terminus of the<br />

NPM-ALK transcript; CD30 — Hodgkin's lymphoma<br />

cell line L428<br />

Molecular Weight: Alk — N/A; CD30 — 120kDa<br />

(mature), 90kDa (precursor)<br />

Positive Control: Anaplastic Large Cell Lymphoma<br />

IVD†<br />

RabbitMAb<br />

FFPE Anaplastic lymphoma stained with<br />

ALK/p80.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9108-S0<br />

RM-9108-S1<br />

RM-9108-S<br />

RM-9108-R7<br />

RM-9108-RQ<br />

IVD†<br />

FFPE human ALCL stained with ALK–CD30<br />

using the MultiVision.<br />

Cellular Localization: Alk — Cytoplasmic and Nuclear; CD30 — Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2008-R7<br />

α-Fetoprotein (AFP), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not known<br />

Immunogen: Human α-fetoprotein purified<br />

from human cord serum<br />

Molecular Weight: 70kDa<br />

Positive Control: HeLa cells, HepG2 cells,<br />

fetal liver or hepatocellular CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

FFPE human fetal liver stained with AFP.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

100µL<br />

IVD†<br />

anti–Alpha Fetoprotein<br />

(AFP),<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL RB-9064-P0<br />

200µg/mL RB-9064-P1<br />

200µg/mL RB-9064-P<br />

n/a RB-9064-R7<br />

n/a RB-9064-RQ<br />

250µg/100µL RB-9064-PCL<br />

α-Fetoprotein (AFP) Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Pig and<br />

Sheep. Does not react with dog. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Purified α-fetoprotein<br />

Molecular Weight: 70kDa<br />

Positive Control: HEP-G-2 cells, Fetal liver<br />

or hepatocellular CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human fetal liver stained with α–Fetoprotein.<br />

Quantity<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Alpha Fetoprotein<br />

(AFP)<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

n/a RB-365-A1<br />

n/a RB-365-A<br />

n/a RB-365-R7<br />

n/a RB-365-PCS<br />

250µg/100µL RB-365-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

55


α -1-Antitrypsin Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Monkey, Horse<br />

and Mink. Does not react with cow, kangaroo, pig,<br />

goat, sheep, cat, dog, guinea pig, mouse and chicken.<br />

Others not known.<br />

Immunogen: Purified human serum α-1-AT<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

AMACR, see p504s<br />

Aminopeptidase-N, see CD13<br />

Quantity<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with α–1–Antitrypsin.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-367-A1<br />

RB-367-A<br />

RB-367-R7<br />

RB-367-PCS<br />

Amphiregulin Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not tested.<br />

Epitope: aa 26-44<br />

Immunogen: A synthetic 19-mer peptide, corresponding to aa<br />

26-44 from the secreted amphiregulin of human origin<br />

Molecular Weight: 18.5-22.5kDa<br />

Positive Control: HT29, LS174T cells<br />

Cellular Localization: Cytoplasmic and/or nuclear<br />

Applications:<br />

• Western Blotting<br />

anti–Amphiregulin<br />

Ab–2, Naulin<br />

Ab–2, WB<br />

anti–Amphireg-<br />

• Immunoprecipitation (Native verified)<br />

tive IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-258-P0<br />

1mg/mL RB-258-P1<br />

1mg/mL RB-258-P<br />

1mg/mL RB-258-P1ABX<br />

1mg/mL RB-258-PABX<br />

250µg/100µL RB-258-PCL<br />

Amyloid A Component Ab-1, Mouse Monoclonal Antibody<br />

Amphiregulin Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human and Mouse. Others not tested.<br />

Epitope: aa 8-26<br />

Immunogen: A synthetic 19-mer peptide, corresponding to aa 8-26<br />

(VKPPQNKTESENTSDKPKR) from the secreted amphiregulin of human origin<br />

Positive Control: LS174T cells<br />

Cellular Localization: Cytoplasmic and/or nuclear<br />

Applications:<br />

• Immunoprecipitation (Native verified)<br />

Host Species: Mouse<br />

Clone: mcl<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Human amyloid A<br />

Positive Control: Amyloid deposits in kidney<br />

Cellular Localization: Extracellular<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human kidney stained with Amyloid<br />

A Component Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Amphiregulin<br />

Ab–1, Native<br />

IP<br />

Cat. No.<br />

RB-257-P0<br />

RB-257-P1<br />

RB-257-P<br />

RB-257-P1ABX<br />

RB-257-PABX<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1219-S0<br />

MS-1219-S1<br />

MS-1219-S<br />

MS-1219-R7<br />

USA: RUO; Int'l: RUO<br />

56<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Amyloid A4/Amyloid β Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BAM01; same as 6F/3D<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: aa 8-17 (SGYEVHHQKL) of mature amyloid<br />

A4/ amyloid Beta which is the same as aa 660-669 of<br />

human amyloid A4/amyloid β protein precursor<br />

Immunogen: A synthetic peptide consisting of residues<br />

8-17 (SGYEVHHQKL) of the amyloid β-protein/amyloid<br />

A4 which is the same as aa 660-669 of human amyloid<br />

A4/amyloid β protein precursor<br />

FFPE human brain of Alzheimer's disease<br />

Molecular Weight: 102kDa (precursor), 4-5kDa stained with Amyloid β Ab–1.<br />

(mature)<br />

Positive Control: Human brain of Alzheimer's disease<br />

Cellular Localization: Transmembrane (APP) and extracellular (Amyloid β)<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Amyloid β, see Amyloid A4<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1167-S0<br />

MS-1167-S1<br />

MS-1167-S<br />

MS-1167-R7<br />

MS-1167-PCS<br />

Amyloid Precursor Protein (APP), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide corresponding to<br />

N-terminal of human APP<br />

Molecular Weight: 110kDa<br />

Positive Control: Brain<br />

Cellular Localization: Cytoplasmic and extracellular<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Anaphase-Promoting Complex, see APC2<br />

Anaplastic Lymphoma Kinase, see ALK<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human Alzheimer's brain stained with<br />

APP.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9023-P0<br />

RB-9023-P1<br />

RB-9023-P<br />

RB-9023-R7<br />

Androgen Receptor Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AR 441<br />

Isotype: IgG1<br />

Species Reactivity: Human<br />

and Dog. Does not react with<br />

mouse. Others not tested.<br />

Epitope: aa 299-315<br />

Immunogen: A synthetic<br />

peptide from human AR<br />

Molecular Weight: 110kDa<br />

Positive Control: LnCAp cells<br />

or prostate CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control For IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human prostate stained with Androgenanti–Androgen<br />

anti–Androgen<br />

Receptor Ab–1.<br />

Receptor<br />

Ab–1, Denatured<br />

IP<br />

Receptor<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-443-P0<br />

200µg/mL MS-443-P1<br />

200µg/mL MS-443-P<br />

1mg/mL MS-443-P1ABX<br />

1mg/mL MS-443-PABX<br />

200µg/mL MS-443-B0<br />

200µg/mL MS-443-B1<br />

200µg/mL MS-443-B<br />

n/a MS-443-R7<br />

n/a MS-443-RQ<br />

n/a MS-443-PCS<br />

250µg/100µL MS-443-PCL<br />

Androgen Receptor Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: N-terminus<br />

Immunogen: A synthetic peptide derived from N-terminus of rat AR<br />

Molecular Weight: 110kDa<br />

Positive Control: LnCAp cells or prostate CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Androgen<br />

Receptor<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1358-P0<br />

1mg/mL RB-1358-P1<br />

1mg/mL RB-1358-P<br />

1mg/mL RB-1358-P1ABX<br />

1mg/mL RB-1358-PABX<br />

250µg/100µL RB-1358-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

57


Androgen Receptor, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide derived from<br />

N-terminal of rat AR<br />

Molecular Weight: 110kDa<br />

Positive Control: LnCAp cells or prostate CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

IVD†<br />

FFPE human prostate stained with Androgen<br />

Receptor Ab–3.<br />

APC2 (Anaphase-Promoting Complex) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not tested.<br />

Epitope: aa 810-822<br />

Immunogen: A peptide from C-terminus of the human APC2<br />

Molecular Weight: 92kDa<br />

Positive Control: HeLa cells<br />

Applications:<br />

• Western Blotting<br />

anti–APC2<br />

(Anaphase–Promoting<br />

Complex)<br />

Ab–1,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for Histology<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-9030-P0<br />

RB-9030-P1<br />

RB-9030-P<br />

RB-9030-R7<br />

RB-9030-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-067-P0<br />

RB-067-P1<br />

RB-067-P<br />

RB-067-P1ABX<br />

RB-067-PABX<br />

†USA: IVD; Int'l: IVD<br />

Positive Control Lysate<br />

100µL<br />

250µg/100µL RB-067-PCL<br />

APC (Adenomateous Polyposis Coli), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from<br />

C-terminus of human APC protein<br />

Molecular Weight: 300kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human colon carcinoma stained with<br />

APC antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9276-P0<br />

RB-9276-P1<br />

RB-9276-P<br />

RB-9276-R7<br />

USA: RUO; Int'l: RUO<br />

APP, see Amyloid Precursor Protein<br />

ARF, see ADP-Ribosylation Factor<br />

ASH Signalling Protein, see Grb2<br />

Bak Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse.<br />

Hamster (Weakly). Others not known.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide from the<br />

N-terminus of human Bak protein<br />

Molecular Weight: ~24kDa<br />

Positive Control: A431 cells, Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

FFPE human tonsil stained with Bak Ab–2. anti–Bak<br />

Ab–2, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1520-P0<br />

1mg/mL RB-1520-P1<br />

1mg/mL RB-1520-P<br />

1mg/mL RB-1520-P1ABX<br />

1mg/mL RB-1520-PABX<br />

n/a RB-1520-R7<br />

n/a RB-1520-PCS<br />

250µg/100µL RB-1520-PCL<br />

58<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Bax Ab-1, Mouse Monoclonal Antibody<br />

Bcl-1, see Cyclin D1<br />

Host Species: Mouse<br />

Clone: 2D2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not<br />

react with mouse and rat. Others not<br />

tested.<br />

Epitope: aa 3-16<br />

Immunogen: A synthetic peptide, aa 3-16<br />

(Cys-GSGEQPRGGGPTSS) of human Bax<br />

protein. This amino acid sequence is not<br />

shared by mouse and rat Bax protein.<br />

Molecular Weight: 21kDa<br />

Positive Control: HeLa cells, Hodgkin's lymphoma<br />

Cellular Localization: Cytoplasmic and cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry (Not tested)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human Hodgkin's lymphoma stained anti–Bax<br />

with Bax Ab–1.<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Bax Ab-4, Mouse Monoclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL MS-711-P0<br />

200µg/mL MS-711-P1<br />

200µg/mL MS-711-P<br />

1mg/mL MS-711-P1ABX<br />

1mg/mL MS-711-PABX<br />

200µg/mL MS-711-B0<br />

200µg/mL MS-711-B1<br />

200µg/mL MS-711-B<br />

n/a MS-711-R7<br />

n/a MS-711-PCS<br />

250µg/100µL MS-711-PCL<br />

Bcl-2α Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 100/D5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not<br />

react with mouse and rat. Others not<br />

known.<br />

Epitope: aa 41-54<br />

Immunogen: A synthetic peptide, aa 41-54<br />

(GAAPAPGIFSSQPG-Cys) of human Bcl-2<br />

protein<br />

Molecular Weight: 25-26kDa<br />

Positive Control: Raji Cells, Tonsil or<br />

follicular lymphomas<br />

FFPE human tonsil stained with Bcl–2<br />

Ab–1.<br />

Cellular Localization: Cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

IVD†<br />

anti–bcl–2alpha<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-123-P0<br />

200µg/mL MS-123-P1<br />

200µg/mL MS-123-P<br />

n/a MS-123-R7<br />

n/a MS-123-RQ<br />

n/a MS-123-PCS<br />

1mg/mL MS-123-P1ABX<br />

1mg/mL MS-123-PABX<br />

250µg/100µL MS-123-PCL<br />

Host Species: Mouse<br />

Clone: 6A7<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: aa 12-24<br />

Immunogen: A Synthetic peptide, aa 12-24 (Cys-GPTSSEQIMKTGA), of human Bax<br />

protein. This amino acid sequence is shared by human, mouse and rat Bax protein.<br />

Molecular Weight: 21kDa<br />

Positive Control: PC12 or HeLa cells<br />

Cellular Localization: Cytoplasmic and cell membrane<br />

Applications:<br />

• Western Blotting (Not optimum)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-714-P0<br />

MS-714-P1<br />

MS-714-P<br />

MS-714-B0<br />

MS-714-B1<br />

MS-714-B<br />

MS-714-P1ABX<br />

MS-714-PABX<br />

USA: RUO; Int'l: RUO<br />

B-Cell Marker, see CD79a<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

59


Bcl-2α Ab-3, Mouse Monoclonal Antibody<br />

Bcl-X Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 8C8<br />

Isotype: IgG1<br />

Species Reactivity: Human and Monkey.<br />

Does not react with mouse and rat. Others<br />

not tested.<br />

Epitope: aa 41-54<br />

Immunogen: A synthetic peptide, aa 41-54<br />

(Cys-GAAPAPGIFSSQPG) of human Bcl-2<br />

protein<br />

Molecular Weight: 25-26kDa<br />

FFPE human tonsil stained with Bcl–2α<br />

Positive Control: Raji or HeLa Cells, Tonsil Ab–3.<br />

or follicular lymphomas<br />

Cellular Localization: Cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Bcl-6 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BL6.02, same as PG-B6p<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Rabbit, Rat, Sheep<br />

and Pig. Others not tested.<br />

Epitope: aa 3-484<br />

Immunogen: Recombinant protein corresponding to<br />

amino acids 3-484 of the human Bcl-6 protein<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

anti–BCL–2alpha<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-597-P0<br />

200µg/mL MS-597-P1<br />

200µg/mL MS-597-P<br />

1mg/mL MS-597-P1ABX<br />

1mg/mL MS-597-PABX<br />

200µg/mL MS-597-B0<br />

200µg/mL MS-597-B1<br />

200µg/mL MS-597-B<br />

n/a MS-597-R7<br />

n/a MS-597-PCS<br />

250µg/100µL MS-597-PCL<br />

FFPE human tonsil stained with Bcl–6<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1114-S0<br />

MS-1114-S1<br />

MS-1114-S<br />

MS-1114-R7<br />

MS-1114-RQ<br />

MS-1114-PCS<br />

Host Species: Mouse<br />

Clone: 2H12<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Mouse, Rat and Pig.<br />

Others not tested.<br />

Epitope: aa 3-14<br />

Immunogen: A synthetic peptide, aa 3-14<br />

(Cys-QSNRELVVDFLS) of human Bcl-X protein. This<br />

amino acid sequence is shared by human and murine<br />

Bcl-X protein.<br />

Molecular Weight: 27kDa<br />

Positive Control: Hodgkin's lymphoma<br />

Cellular Localization: Cytoplasmic and Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not optimum)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Bcl-XL Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 7D9<br />

Isotype: IgG2a<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: aa 35-50<br />

Immunogen: A synthetic peptide corresponding to aa<br />

35-50 (TEAPEETEAERETPSA) of mouse Bcl-XL protein<br />

Molecular Weight: 27kDa<br />

Positive Control: Hodgkin's lymphoma<br />

Cellular Localization: Cytoplasmic and cell/nuclear<br />

membrane.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

FFPE human Hodgkin's lymphoma stained<br />

with Bcl–X Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-715-P0<br />

MS-715-P1<br />

MS-715-P<br />

MS-715-P1ABX<br />

MS-715-PABX<br />

MS-715-B0<br />

MS-715-B1<br />

MS-715-B<br />

MS-715-R7<br />

MS-715-PCS<br />

FFPE human Hodgkin's lymphoma stained<br />

with Bcl–XL Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-1334-P0<br />

MS-1334-P1<br />

MS-1334-P<br />

MS-1334-P1ABX<br />

MS-1334-PABX<br />

MS-1334-PCS<br />

USA: RUO; Int'l: RUO<br />

β Catenin, see Catenin, β<br />

60<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Biotin Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BTN.4<br />

Isotype: IgG1/κ<br />

Species Reactivity: All species.<br />

Immunogen: Biotin conjugated to BSA<br />

Applications:<br />

• Western Blotting<br />

• Confocal Microscopy<br />

• Flow Cytometry<br />

• Image Analysis<br />

• in situ Nucleic Acid Hybridization<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1048-P0<br />

MS-1048-P1<br />

MS-1048-P<br />

MS-1048-P1ABX<br />

MS-1048-PABX<br />

Bromodeoxyuridine (BrdU) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BRD.3<br />

Isotype: IgG1<br />

Species Reactivity: All species.<br />

Immunogen: Bromodeoxyuridine (BrdU) conjugated<br />

to BSA<br />

Positive Control: Cultured cells grown in presence of<br />

BrdU or tissues from experimental animals injected<br />

with BrdU<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE, BrdU–labeled mouse small intestine<br />

stained with BrdU Ab–3.<br />

Conc.<br />

40µg/mL<br />

40µg/mL<br />

40µg/mL<br />

1mg/mL<br />

1mg/mL<br />

40µg/mL<br />

40µg/mL<br />

40µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1058-P0<br />

MS-1058-P1<br />

MS-1058-P<br />

MS-1058-P1ABX<br />

MS-1058-PABX<br />

MS-1058-B0<br />

MS-1058-B1<br />

MS-1058-B<br />

MS-1058-R7<br />

MS-1058-PCS<br />

Bromodeoxyuridine (BrdU) Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Bu20a<br />

Isotype: IgG1/κ<br />

Species Reactivity: All species.<br />

Immunogen: BrdU conjugated to BSA<br />

Positive Control: Cultured cells grown in presence of BrdU or tissues from experimental<br />

animals injected with BrdU<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

BrdU, see Bromodeoxyuridine<br />

CA 72-4, see TAG-72<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

C1q Complement, FITC Labeled Antibody<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1848-P0<br />

MS-1848-P1<br />

MS-1848-P<br />

MS-1848-P1ABX<br />

MS-1848-PABX<br />

MS-1848-R7<br />

MS-1848-PCS<br />

Host Species: Rabbit<br />

IVD†<br />

Species Reactivity: Reacts with human C1q complement.<br />

Immunogen: C1q component isolated from human serum<br />

Positive Control: Skin or kidney fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Diseased skin and kidney tissue (e.g., mesangial proliferative<br />

glomerulonephritis)<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

2mL<br />

C3c Complement, FITC Labeled Antibody<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1926-R2<br />

Host Species: Sheep<br />

Species Reactivity: Reacts with human C3c complement, as well as the C3c component<br />

of native C3 and C3b. Broad species cross reactivity.<br />

Immunogen: C3c complement from human serum<br />

Positive Control: Skin or kidney fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Various types of diseased skin and kidney tissue (e.g.,<br />

Glomerulonephritis)<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

SH-1923-R2<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

61


C4 Complement, FITC Labeled Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Reacts with human C4 as well as C4b and C4 complements. Broad<br />

species cross reactivity.<br />

Immunogen: C4 component isolated from human plasma<br />

Positive Control: Kidney fixed and processed in the same manner as the test specimen<br />

Cellular Localization: Diseased kidney tissue (e.g., Lupus glomerulonephritis)<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1927-R2<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 121SLE<br />

Isotype: IgM<br />

Species Reactivity: Human. Does not react with<br />

rat. Others not tested.<br />

Immunogen: Mucins from ovarian cyst<br />

Molecular Weight: >400kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker), Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SPM110<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Purified human CA19-9<br />

Molecular Weight: >400kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for Histology<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human colon carcinoma stained with<br />

CA19–9 antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-9085-P0<br />

MS-9085-P1<br />

MS-9085-P<br />

MS-9085-R7<br />

MS-9085-PCS<br />

CA 125 (Ovarian Cancer Antigen) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

FFPE human colon carcinoma stained with<br />

CA19–9 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-379-P0<br />

MS-379-P1<br />

MS-379-P<br />

MS-379-R7<br />

MS-379-PCS<br />

MS-379-P1ABX<br />

MS-379-PABX<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 116-NS-19-9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Sialic acid-containing residue of the monosialoganglioside<br />

Immunogen: Human colon carcinoma cell line SW1116<br />

Positive Control: Colon CA<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Host Species: Mouse<br />

Clone: Ov185:1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Partially purified mucin fraction from a<br />

pool of cancer tissue from patients with epithelial<br />

ovarian cancer<br />

Positive Control: Ovarian CA<br />

Cellular Localization: Extracellular<br />

membrane-associated<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

human ovarian carcinoma stained with<br />

CA125 Ab–1<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1151-S0<br />

MS-1151-S1<br />

MS-1151-S<br />

MS-1151-R7<br />

MS-1151-RQ<br />

MS-1151-PCS<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1811-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1811-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1811-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1811-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1811-PCS<br />

USA: RUO; Int'l: RUO<br />

62<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CA 125 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M11<br />

Isotype: IgG1/κ<br />

Speices Reactivity: Human. Others not known.<br />

Epitope: Different than clone OC125<br />

Immunogen: CA 125 antigen derived from ascites<br />

fluid<br />

Molecular Weight: >200kDa<br />

Positive Control: Breast, ovarian, endometrial, colon<br />

and lung CA<br />

Cellular Localization: Extracellular<br />

membrane-associated<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human endometrial carcinoma<br />

stained with CA 125 Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1812-S0<br />

MS-1812-S1<br />

MS-1812-S<br />

MS-1812-R7<br />

MS-1812-PCS<br />

CA 125 (Ovarian Cancer Antigen), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM111<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Ovarian cancer cell line<br />

Molecular Weight: >200kD<br />

Positive Control: Colon CA<br />

Cellular Localization: Extracellular<br />

membrane-associated<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human colon carcinoma stained with<br />

CA125.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-9086-P0<br />

MS-9086-P1<br />

MS-9086-P<br />

MS-9086-R7<br />

c-Abl Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 8E9<br />

Isotype: IgG1/γ<br />

Species Reactivity: Human and Mouse.<br />

Others not tested.<br />

Epitope: SH2 domain<br />

Immunogen: Recombinant Abl protein<br />

Molecular Weight: 120kDa<br />

Positive Control: HeLa cells or placenta<br />

Cellular Localization: Cytoplasmic and<br />

nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human placenta stained with c–Abl<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cadherin E, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP700Y<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide derived from the<br />

fifth cadherin domain of human cadherin<br />

Molecular Weight: 135/80kDa<br />

Positive Control: Breast Carcinoma<br />

Cellular Localization: Cell Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

anti–c–Abl<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-938-P0<br />

200µg/mL MS-938-P1<br />

200µg/mL MS-938-P<br />

1mg/mL MS-938-P1ABX<br />

1mg/mL MS-938-PABX<br />

200µg/mL MS-938-B0<br />

200µg/mL MS-938-B1<br />

200µg/mL MS-938-B<br />

n/a MS-938-R7<br />

n/a MS-938-PCS<br />

250µg/100µL MS-938-PCL<br />

IVD†<br />

RabbitMAb<br />

FFPE human breast carcinoma stained with<br />

Cadherin E.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2100-S0<br />

RM-2100-S<br />

RM-2100-R7<br />

RM-2100-RQ<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

63


Cadherin E, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM471<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: 600-707aa<br />

Immunogen: Recombinant protein encoding human<br />

Cadherin-E 600-707aa<br />

Molecular Weight: 120kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human breast carcinoma stained with<br />

Cadherin E.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cadherin, Pan Ab-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Chicken,<br />

Dog, Monkey, Cow and Xenopus.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the C-terminal<br />

end of chicken N-cadherin<br />

Positive Control: Tonsil, squamous epithelium<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

MS-9470-P0<br />

MS-9470-P1<br />

MS-9470-P<br />

MS-9470-R7<br />

MS-9470-RQ<br />

FFPE human lung small cell carcinoma<br />

stained with Cadherin, pan Ab–4.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1524-P0<br />

RB-1524-P1<br />

RB-1524-P<br />

RB-1524-P1ABX<br />

RB-1524-PABX<br />

RB-1524-R7<br />

RB-1524-PCS<br />

Cadherin, Pan, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat,<br />

Chicken, Dog, Monkey, Cow and Xenopus.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the<br />

C-terminus of chicken N-cadherin<br />

Molecular Weight: 120kDa<br />

Positive Control: MCF-Cells, Tonsil and<br />

squamous epithelium<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human skin stained with Cadherin pananti–Cadherin,<br />

antibody.<br />

Pan, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Calcitonin, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP17<br />

Speices Reactivity: Human, Monkey, Mouse, Rat, Dog,<br />

Horse, Sheep and Pig. Others not tested.<br />

Epitope: 1-32aa<br />

Immunogen: Synthetic human calcitonin 1-32 amino<br />

acid peptide<br />

Positive Control: Thyroid or medullary CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc. Cat. No.<br />

200µg/mL RB-9036-P0<br />

200µg/mL RB-9036-P1<br />

200µg/mL RB-9036-P<br />

n/a RB-9036-R7<br />

n/a RB-9036-PCS<br />

250µg/100µL RB-9036-PCL<br />

IVD†<br />

RabbitMAb<br />

FFPE human thyroid carcinoma stained<br />

with Calcitonin<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9117-S0<br />

RM-9117-S1<br />

RM-9117-S<br />

RM-9117-R7<br />

RM-9117-RQ<br />

64<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Calcitonin Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Mouse, Rat,<br />

Dog, Horse, Sheep and Pig. Others not tested.<br />

Immunogen: A synthetic peptide from human<br />

calcitonin<br />

Positive Control: Thyroid or medullary CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

500µL<br />

1mL<br />

FFPE human thyroid stained with Calcitonin<br />

Ab–2.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Caldesmon, HMW Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: h-CALD<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Crude human uterus extract<br />

Molecular Weight: 150kDa (h-caldesmon)<br />

Positive Control: Uterus<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Cat. No.<br />

RB-1519-P1ABX<br />

RB-1519-PABX<br />

RB-1519-R7<br />

RB-1519-PCS<br />

RB-1519-P0<br />

RB-1519-P1<br />

RB-1519-P<br />

FFPE human uterus stained with<br />

Caldesmon Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

IVD†<br />

Cat. No.<br />

MS-1169-P0<br />

MS-1169-P1<br />

MS-1169-P<br />

MS-1169-R7<br />

MS-1169-RQ<br />

MS-1169-PCS<br />

MS-1169-P1ABX<br />

MS-1169-PABX<br />

Caldesmon, LMW Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: l-CALD<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant caldesmon<br />

Molecular Weight: 80kDa (l-caldesmon)<br />

Positive Control: Rh30 cells, Uterus<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

CALLA, see CD10<br />

FFPE human uterus stained with Caldesmonan-<br />

ti–Caldesmon,<br />

Ab–2.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Calponin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CALP<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Crude human uterus extract<br />

Molecular Weight: 34kDa<br />

Positive Control: Myoepithelial cells in breast ducts<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1251-P0<br />

200µg/mL MS-1251-P1<br />

200µg/mL MS-1251-P<br />

1mg/mL MS-1251-P1ABX<br />

1mg/mL MS-1251-PABX<br />

200µg/mL MS-1251-B0<br />

200µg/mL MS-1251-B1<br />

200µg/mL MS-1251-B<br />

n/a MS-1251-R7<br />

n/a MS-1251-PCS<br />

250µg/100µL MS-1251-PCL<br />

IVD†<br />

FFPE human breast stained with Calponin<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1168-P0<br />

MS-1168-P1<br />

MS-1168-P<br />

MS-1168-R7<br />

MS-1168-RQ<br />

MS-1168-PCS<br />

MS-1168-P1ABX<br />

MS-1168-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

65


Calponin-1, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP798Y<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide derived from near<br />

the C-terminus of human Calponin-1<br />

Molecular Weight: 29/34kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cytoplasm Myoepithelial cells<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Calprotectin, CD68/see Macrophage<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Calretinin, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length mouse calretinin<br />

protein<br />

Molecular Weight: 31.5kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Nuclear and Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human breast carcinoma stained with<br />

Calponin–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2102-S0<br />

RM-2102-S<br />

RM-2102-R7<br />

RM-2102-RQ<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Calretinin.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9002-P0<br />

RB-9002-P1<br />

RB-9002-P<br />

RB-9002-R7<br />

Calretinin, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP13<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length mouse calretinin<br />

protein<br />

Molecular Weight: 31.5kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human mesothelioma stained with<br />

Calretinin.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Calretinin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5A5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length mouse calretinin<br />

protein<br />

Molecular Weight: 31.5kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting (Not recommended)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Cat. No.<br />

RM-9113-S0<br />

RM-9113-S1<br />

RM-9113-S<br />

RM-9113-R7<br />

RM-9113-RQ<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Calretinin Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1110-S0<br />

MS-1110-S1<br />

MS-1110-S<br />

MS-1110-R7<br />

66<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Calretinin Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DAK Calret 1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length human calretinin<br />

protein cloned from Mero-41 cells<br />

Molecular Weight: 31.5kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC<br />

USA: RUO; Int'l: RUO<br />

Carcinoembryonic Antigen, see CEA<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human mesothelioma stained with<br />

Calretinin Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Caspase 3 (CPP32) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3CSP01; same as 7.1.44<br />

Isotype: IgG2a<br />

Species Reactivity: Human.<br />

Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

full-length human Caspase 3<br />

protein<br />

Molecular Weight: 32kDa<br />

Positive Control: Jurkat cells,<br />

Tonsil and appendix<br />

Cellular Localization:<br />

Predominantly Cytoplasmic with<br />

some nuclear staining<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE human tonsil stained with Caspase 3<br />

Ab–1.<br />

Cat. No.<br />

MS-1859-S0<br />

MS-1859-S1<br />

MS-1859-S<br />

MS-1859-R7<br />

anti–Caspase anti–Caspase<br />

3 (CPP32) 3 (CPP32)<br />

Ab–1, Native Ab–1, Denatured<br />

IP<br />

IP<br />

Caspase 3 (CPP32) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3CSP03; same as<br />

4.1.18<br />

Isotype: IgG2a<br />

Species Reactivity: Human.<br />

Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

full-length human Caspase 3<br />

protein<br />

Molecular Weight: 32kDa<br />

Positive Control: Jurkat cells,<br />

Tonsil and appendix<br />

Cellular Localization:<br />

FFPE human tonsil stained with Caspase 3 anti–Caspase<br />

Ab–3.<br />

3 (CPP32)<br />

Ab–3, Native<br />

IP<br />

Predominantly Cytoplasmic with some nuclear staining<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Caspase<br />

3 (CPP32)<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1123-P0<br />

200µg/mL MS-1123-P1<br />

200µg/mL MS-1123-P<br />

1mg/mL MS-1123-P1ABX<br />

1mg/mL MS-1123-PABX<br />

n/a MS-1123-R7<br />

n/a MS-1123-PCS<br />

250µg/100µL MS-1123-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control wor IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Caspase<br />

3 (CPP32)<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1121-P0<br />

200µg/mL MS-1121-P1<br />

200ug/mL MS-1121-P<br />

1mg/mL MS-1121-P1ABX<br />

1mg/mL MS-1121-PABX<br />

n/a MS-1121-PCS<br />

250µg/100µL MS-1121-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

67


Caspase 3 (CPP32) Ab-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse, Rat, Monkey, Rabbit,<br />

Hamster, Cow, Sheep, Pig and<br />

Dog. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

full-length human caspase 3<br />

protein<br />

Molecular Weight: 32kDa<br />

Positive Control: Jurkat cells,<br />

Tonsil<br />

Cellular Localization:<br />

Predominantly cytoplasmic with<br />

some nuclear staining<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

(Denatured verified)<br />

FFPE human tonsil stained with Caspase 3<br />

Ab–4.<br />

anti–Caspase<br />

3 (CPP32)<br />

Ab–4, WB<br />

anti–Caspase anti–Caspase<br />

3 (CPP32) 3 (CPP32)<br />

Ab–4, Native Ab–4, Denatured<br />

IP<br />

IP<br />

Caspase 6 (Mch 2) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 6CSP03; same as 14.1.190<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Caspase 6 prodomain<br />

Immunogen: Recombinant human caspase 6 prodomain<br />

Molecular Weight: 34kDa<br />

Positive Control: Jurkat cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Caspase<br />

6 (Mch 2)<br />

Ab–3, Denatured<br />

IP<br />

Caspase 8 (FLICE) Ab-3, Mouse Monoclonal Antibody<br />

anti–Caspase<br />

6 (Mch 2)<br />

Ab–3, WB<br />

Cat. No.<br />

MS-1126-P0<br />

MS-1126-P1<br />

MS-1126-P<br />

MS-1126-P1ABX<br />

MS-1126-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1197-P0<br />

1mg/mL RB-1197-P1<br />

1mg/mL RB-1197-P<br />

1mg/mL RB-1197-P1ABX<br />

1mg/mL RB-1197-PABX<br />

1mg/mL RB-1197-B0<br />

1mg/mL RB-1197-B1<br />

1mg/mL RB-1197-B<br />

n/a RB-1197-R7<br />

n/a RB-1197-PCS<br />

250µg/100µL RB-1197-PCL<br />

Host Species: Mouse<br />

Clone: 8CSP03; same as 4.1.20<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length human Caspase 8 protein<br />

Molecular Weight: 55kDa<br />

Positive Control: Jurkat cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Caspase<br />

8 (FLICE)<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1143-P0<br />

200µg/mL MS-1143-P1<br />

200ug/mL MS-1143-P<br />

1mg/mL MS-1143-P1ABX<br />

1mg/mL MS-1143-PABX<br />

250µg/100µL MS-1143-PCL<br />

USA: RUO; Int'l: RUO<br />

68<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Caspase 9/LAP6 Ab-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Cow and Sheep.<br />

Others not tested.<br />

Epitope: aa 1-134<br />

Immunogen: Recombinant protein encoding aa 1-134 of human<br />

caspase 9<br />

Molecular Weight: 46-48kDa<br />

Positive Control: Jurkat cells, Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

anti–Caspase anti–Caspase<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

9/LAP6 Ab–4, 9/LAP6 Ab–4,<br />

• Western Blotting<br />

Denatured IP WB<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Catenin, β, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: E247<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide derived from near<br />

the N-terminus of human β-catenin<br />

Molecular Weight: 92kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cell Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc. Cat. No.<br />

1mg/mL RB-1205-P0<br />

1mg/mL RB-1205-P1<br />

1mg/mL RB-1205-P<br />

1mg/mL RB-1205-P1ABX<br />

1mg/mL RB-1205-PABX<br />

1mg/mL RB-1205-B0<br />

1mg/mL RB-1205-B1<br />

1mg/mL RB-1205-B<br />

n/a RB-1205-PCS<br />

250µg/100µL RB-1205-PCL<br />

IVD†<br />

RabbitMAb<br />

FFPE human breast carcinoma stained with<br />

β–catenin.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2101-S0<br />

RM-2101-S<br />

RM-2101-R7<br />

RM-2101-RQ<br />

Catenin, β, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse.<br />

Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the<br />

C-terminus of the β-catenin protein<br />

Molecular Weight: 92kDa<br />

Positive Control: MCF-7 cells, Breast CA<br />

Cellular Localization: Cytoplasmic and<br />

cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

FFPE human breast CA stained with<br />

β–Catenin antibody.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Catenin, β Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 17C2<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant glycoprotein corresponding<br />

to C-terminal 160aa of β-catenin<br />

Molecular Weight: 92kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cytoplasmic and cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

IVD†<br />

anti–Catenin–beta,<br />

WB<br />

Cat. No.<br />

RB-9035-P0<br />

RB-9035-P1<br />

RB-9035-P<br />

RB-9035-R7<br />

RB-9035-PCS<br />

FFPE human breast CA stained with<br />

Catenin, β Ab–3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1763-S0<br />

MS-1763-S1<br />

MS-1763-S<br />

MS-1763-R7<br />

MS-1763-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

69


Catenin, β Ab-2, Rabbit Polyclonal Antibody<br />

CD1a Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse, Rat, Chicken and<br />

Xenopus. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic<br />

peptide from the C-terminus of<br />

the β-catenin protein<br />

Molecular Weight: 92kDa<br />

Positive Control: MCF-7 cells, FFPE human breast cancer stained with<br />

Breast CA<br />

Catenin, β Ab–2.<br />

Cellular Localization:<br />

Cytoplasmic and cell<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cathepsin G Ab-1, Mouse Monoclonal Antibody<br />

an-<br />

anti–Catenin–beta<br />

Ab–2, WB ta Ab–2, Nati–Catenin–betive<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-1491-P0<br />

1mg/mL RB-1491-P1<br />

1mg/mL RB-1491-P<br />

1mg/mL RB-1491-P1ABX<br />

1mg/mL RB-1491-PABX<br />

n/a RB-1491-R7<br />

n/a RB-1491-PCS<br />

250µg/100µL RB-1491-PCL<br />

Host Species: Mouse<br />

Clone: MTB1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: External domain<br />

Immunogen: Full external domain of CD1a<br />

Molecular Weight: 49kDa<br />

Positive Control: Thymus<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

CD1a Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: O10<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Molecular Weight: 49kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human skin stained with CD1a Ab–2.<br />

Conc. Cat. No.<br />

n/a MS-746-S0<br />

n/a MS-746-S1<br />

n/a MS-746-S<br />

n/a MS-746-R7<br />

n/a MS-746-PCS<br />

IVD†<br />

Host Species: Mouse<br />

Clone: 19C3<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal 124aa<br />

Immunogen: Recombinant protein corresponding to<br />

124aa from N-terminus of human cathepsin G<br />

Molecular Weight: 29kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Cathepsin<br />

G Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1835-S0<br />

MS-1835-S1<br />

MS-1835-S<br />

MS-1835-R7<br />

MS-1835-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

FFPE human tonsil stained with CD1a<br />

Ab–5.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1856-P0<br />

MS-1856-P1<br />

MS-1856-P<br />

MS-1856-R7<br />

MS-1856-RQ<br />

MS-1856-PCS<br />

MS-1856-P1ABX<br />

MS-1856-PABX<br />

USA: RUO; Int'l: RUO<br />

CBP, see CITED1<br />

70<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD2 (LFA-2) Ab-2, Mouse Monoclonal Antibody<br />

CD3ε (Early T-Cell Marker) Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: AB75<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant fragment encoding the<br />

external domain of the human CD2 protein<br />

Molecular Weight: 45-58kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD2 Ab–2.<br />

Conc. Cat. No.<br />

n/a MS-1074-S0<br />

n/a MS-1074-S1<br />

n/a MS-1074-S<br />

n/a MS-1074-R7<br />

n/a MS-1074-PCS<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: aa 156-168 of ε-chain<br />

Immunogen: A synthetic 13-mer peptide,<br />

corresponding to aa 156-168 of the ε-chain of human<br />

CD3 protein<br />

Molecular Weight: ~20kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human lymphoma stained with CD3ε<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-360-A0<br />

RB-360-A1<br />

RB-360-A<br />

RB-360-R7<br />

RB-360-PCS<br />

CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP7<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Monkey, Horse,<br />

Dog and Cat. Others not tested.<br />

Epitope: 156-168aa<br />

Immunogen: A synthetic 13-mer peptide<br />

corresponding to aa 156-168 of the ε-chain of human<br />

CD3 protein<br />

Positive Control: Jurkat cells, Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human tonsil stained with CD3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9107-S0<br />

RM-9107-S1<br />

RM-9107-S<br />

RM-9107-R7<br />

RM-9107-RQ<br />

CD3ε (Early T-Cell Marker) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PS1<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: ε-chain<br />

Immunogen: Recombinant nonglycosylated ε-chain<br />

of CD3 protein<br />

Molecular Weight: ~20kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD3ε<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-401-S0<br />

MS-401-S1<br />

MS-401-S<br />

MS-401-R7<br />

MS-401-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

71


CD3ε (Early T-Cell Marker) Ab-9, Mouse Monoclonal Antibody<br />

CD3ε/Ki-67, MultiVision Antibody Cocktail<br />

Host Species: Mouse<br />

Clone: F7.2.38<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Cytoplasmic region of ε-chain<br />

Immunogen: Purified CD3 ε γ δ/CD3ϖ<br />

Molecular Weight: ~20kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD3ε<br />

Ab–9.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1880-S0<br />

MS-1880-S1<br />

MS-1880-S<br />

MS-1880-R7<br />

MS-1880-PCS<br />

Host Species: CD3ε — Mouse; Ki-67 — Rabbit<br />

Clone: CD3ε — 7.2.38F; Ki-67 — SP6<br />

Isotype: CD3ε Mouse IgG1/κ; Ki-67— Rabbit IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: CD3ε — Cytoplasmic region of epsilon chain;<br />

Ki-67 — treminus<br />

Immunogen: CD3ε —Purified CD3εγδ/CD3ϖ; Ki-67—A<br />

synthetic peptide derived from the human Ki-67 protein<br />

Molecular Weight: CD3ε — 20KDa; Ki-67—unknown<br />

Positive Control: Tonsil<br />

Cellular Localization: CD3ε — Cell Membrane; Ki-67<br />

— Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

CD3/CD20, MultiVision Antibody Cocktail<br />

IVD†<br />

FFPE human tonsil stained with<br />

MV–2005–R7 using the MultiVision anti–Mouse/<br />

HRP + anti–Rabbit/ AP<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2005-R7<br />

CD3ε, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP449E<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues in the cytoplasmic domain of human CD3ε.<br />

The antibody does not cross react with other subunits<br />

of CD3.<br />

Molecular Weight: 23kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

1mL<br />

1mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human tonsil stained with CD3ε.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2109-S0<br />

RM-2109-S<br />

RM-2109-R7<br />

RM-2109-RQ<br />

Host Species: CD3 — Rabbit; CD20 — Mouse<br />

Clone: CD3 — SP7; CD20 — L26<br />

Isotype: CD3 — Rabbit IgG; CD20 — Mouse IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: CD3 — 156-168aa; CD20 — not known<br />

Immunogen: CD3 — synthetic 13-mer peptide<br />

corresponding to aa 156-168 of the ε-chain of human<br />

CD3 protien; CD2 0— Human tonsil B cells<br />

Molecular Weight: CD3 — not known; CD20 —<br />

30-33kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: CD3 — Cell membrane; CD20<br />

— Cell membrane/cytoplasmic domain<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

IVD†<br />

FFPE Human Tonsil stained with<br />

MV–2002–R7 using MultiVision anti–Rabbit/<br />

HRP +anti–Mouse/ AP.<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2002-R7<br />

†USA: IVD; Int'l: IVD<br />

72<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD4 Ab-8, Mouse Monoclonal Antibody<br />

CD5, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4B12<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Stimulated human leukocytes<br />

Molecular Weight: 59kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with CD4 Ab–8.<br />

Host Species: Rabbit<br />

Clone: SP19<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Intracellular region<br />

Immunogen: Synthetic peptide from the<br />

intracellular region of CD5<br />

Positive Control: Raji cells, Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

IVD† RabbitMAb<br />

FFPE human tonsil stained with CD5. anti–CD5, WB<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1528-S0<br />

MS-1528-S1<br />

MS-1528-S<br />

MS-1528-R7<br />

MS-1528-RQ<br />

MS-1528-PCS<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9119-S0<br />

RM-9119-S1<br />

RM-9119-S<br />

RM-9119-R7<br />

RM-9119-RQ<br />

CD4/CD8, MultiVision Antibody Cocktail<br />

Host Species: CD4 — Mouse; CD8 — Rabbit<br />

Clone: CD4 — 4B12; CD8 — SP16<br />

Isotype: CD4 — Mouse IgG/κ; CD8 — Rabbit IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: CD4 — Not determined; CD8 — C-terminus<br />

Immunogen: CD4 — stimulated human leukocytes;<br />

CD8 — synthetic peptide containing the 13 C-terminal<br />

amino acids of the cytoplasmic domain of the α-chain<br />

of the CD8 molecule<br />

Molecular Weight: CD4 — 59kDa; CD8 — not known<br />

Positive Control: Tonsil<br />

Cellular Localization: CD4 — Membrane; CD8 —<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

IVD†<br />

FFPE human tonsil stained with<br />

MV–2001–R7 using the MultiVision anti–Mouse/<br />

HRP + anti–Rabbit/ AP (cat.#<br />

TL–012–MHRA).<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2001-R7<br />

CD5 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4C7<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: External domain<br />

Immunogen: Recombinant protein corresponding to<br />

the external domain of the CD5 molecule<br />

Molecular Weight: 67kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD5 Ab–1.<br />

Conc. Cat. No.<br />

n/a MS-393-S0<br />

n/a MS-393-S1<br />

n/a MS-393-S<br />

n/a MS-393-R7<br />

n/a MS-393-RQ<br />

n/a MS-393-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

73


CD8, Rabbit Monoclonal Antibody<br />

CD8, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP16<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: Synthetic peptide sequence comprising<br />

the 13 C-terminal amino acids of the cytoplasmic<br />

domain of α-chain of the CD8 molecule<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: Synthetic peptide sequence comprising<br />

the 13 C-terminal amino acids of the cytoplasmic<br />

domain of α-chain of the CD8 molecule<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with CD8.<br />

FFPE human tonsil stained with CD8.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

CD8 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: C8/144B<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A 13 amino acid synthetic peptide from<br />

the C-terminal cytoplasmic domain of α-chain of<br />

human CD8 molecule<br />

Molecular Weight: 32kDa<br />

Positive Control: Lymph node or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc. Cat. No.<br />

n/a RM-9116-S0<br />

n/a RM-9116-S1<br />

n/a RM-9116-S<br />

n/a RM-9116-R7<br />

n/a RM-9116-RQ<br />

IVD†<br />

FFPE human tonsil stained with CD8 Ab–1.<br />

Conc. Cat. No.<br />

n/a MS-457-S0<br />

n/a MS-457-S1<br />

n/a MS-457-S<br />

n/a MS-457-R7<br />

n/a MS-457-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9009-P0<br />

RB-9009-P1<br />

RB-9009-P<br />

RB-9009-R7<br />

CD9/Motility-Related Protein-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 72F6<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding the major<br />

extracellular loop of the human CD9<br />

Molecular Weight: 24-27kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD9 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1077-S0<br />

MS-1077-S1<br />

MS-1077-S<br />

MS-1077-R7<br />

MS-1077-PCS<br />

74<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD10/CALLA (Neutral Endopeptidase) Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 56C6<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not<br />

tested.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant external domain of CD10<br />

protein<br />

Molecular Weight: 100kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human small intestine stained with<br />

CD10 Ab–2.<br />

CD14 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 7<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding the<br />

external domain of human CD14<br />

Molecular Weight: 55kDa<br />

Positive Control: Placenta<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human placenta stained with CD14<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1080-S0<br />

MS-1080-S1<br />

MS-1080-S<br />

MS-1080-R7<br />

MS-1080-PCS<br />

†USA: IVD; Int'l: IVD<br />

FFPE human Lymphoma stained with CD10<br />

Ab–2<br />

CD15 Ab-3, Mouse Monoclonal Antibody<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-728-S0<br />

MS-728-S1<br />

MS-728-S<br />

MS-728-R7<br />

MS-728-RQ<br />

MS-728-PCS<br />

CD13/Aminopeptidase-N Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 38C12<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminal half of the extracellular domain<br />

Immunogen: Recombinant protein encoding the<br />

C-terminal half of the extracellular domain of human<br />

CD13<br />

Molecular Weight: 150kDa<br />

Positive Control: Prostate, liver<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting (Not suitable)<br />

FFPE human liver stained with CD13 Ab–3.<br />

Host Species: Mouse<br />

Clone: MMA; same as LeuM1<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: U937 histiocytic cell line<br />

Molecular Weight: 220kDa<br />

Positive Control: Reed-Sternberg's cells in Hodgkin's<br />

lymphoma<br />

Cellular Localization: Membrane and granular<br />

paranuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human Hodgkin's lymphoma stained<br />

with CD15 Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1259-P0<br />

MS-1259-P1<br />

MS-1259-P<br />

MS-1259-R7<br />

MS-1259-RQ<br />

MS-1259-PCS<br />

MS-1259-P1ABX<br />

MS-1259-PABX<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1079-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1079-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1079-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1079-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1079-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

75


CD16/Fcγ Receptor III, Mouse Monoclonal Antibody<br />

CD20, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2H7<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant protein encoding the<br />

external domain of human CD16<br />

Molecular Weight: 50-65kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD16.<br />

Conc. Cat. No.<br />

n/a MS-1085-S0<br />

n/a MS-1085-S1<br />

n/a MS-1085-S<br />

n/a MS-1085-R7<br />

n/a MS-1085-PCS<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: Synthetic peptide derived from<br />

C-terminus of human CD20 protein<br />

Molecular Weight: 33-37kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane/cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human tonsil stained with CD20.<br />

Conc. Cat. No.<br />

200µg/mL RB-9013-P0<br />

200µg/mL RB-9013-P1<br />

200µg/mL RB-9013-P<br />

n/a RB-9013-R7<br />

USA: RUO; Int'l: RUO<br />

†USA: IVD; Int'l: IVD<br />

CD20 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: L26<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Does not react with cow,<br />

dog, pig and rat.<br />

Epitope: Cytoplasmic domain<br />

Immunogen: Human tonsil B cells<br />

Molecular Weight: 30-33kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane/cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD20<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-340-S0<br />

MS-340-S1<br />

MS-340-S<br />

MS-340-R7<br />

MS-340-RQ<br />

MS-340-PCS<br />

CD20/Ki-67, MultiVision Antibody Cocktail<br />

Host Species: CD20 — Rabbit; Ki-67 — Mouse<br />

Clone: CD20 — L26; Ki-67 — SP6<br />

Isotype: CD20 — Mouse IgG2a/κ; Ki-67— Rabbit IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: CD20 — Cytoplasmic domain; Ki-67 —<br />

C-treminus<br />

Immunogen: CD20 — Human tonsil B cells; Ki-67 —<br />

A synthetic peptide derived from the human Ki-67<br />

protein<br />

Molecular Weight: CD20 — 30-33KDa; Ki-67 —<br />

unknown<br />

Positive Control: Tonsil<br />

Cellular Localization: CD20 — Cell Membrane; Ki-67<br />

— Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

IVD†<br />

FFPE human lymphoma stained with<br />

MV–2006–R7 using the MultiVision anti–Mouse/<br />

HRP + anti–Rabbit/ AP<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2006-R7<br />

†USA: IVD; Int'l: IVD<br />

76<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD21 Ab-2, Mouse Monoclonal Antibody<br />

CD23, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2G9<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding the<br />

external domain of human CD21<br />

Molecular Weight: 140kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with CD21<br />

Ab–2.<br />

Host Species: Rabbit<br />

Clone: SP23<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant protein encoding human<br />

CD23 48-248aa<br />

Molecular Weight: 45kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD† RabbitMAb<br />

FFPE human tonsil stained with CD23.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1086-S0<br />

MS-1086-S1<br />

MS-1086-S<br />

MS-1086-R7<br />

MS-1086-RQ<br />

MS-1086-PCS<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9123-S0<br />

RM-9123-S1<br />

RM-9123-S<br />

RM-9123-R7<br />

RM-9123-RQ<br />

†USA: IVD; Int'l: IVD<br />

CD23 Ab-1, Mouse Monoclonal Antibody<br />

CD22 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: FPC1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant protein encoding the<br />

external domain of human CD22<br />

Molecular Weight: 130-140kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD22<br />

Ab–4.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1087-S0<br />

MS-1087-S1<br />

MS-1087-S<br />

MS-1087-R7<br />

MS-1087-RQ<br />

MS-1087-PCS<br />

Host Species: Mouse<br />

Clone: 1B12<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not tested.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant external domain of CD23<br />

protein<br />

Molecular Weight: 45kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD23<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-729-S0<br />

MS-729-S1<br />

MS-729-S<br />

MS-729-R7<br />

MS-729-RQ<br />

MS-729-PCS<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

77


CD24 (GPI-Linked Surface Mucin) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SN3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Cell membrane antigen preparation<br />

isolated from NALM-1 human pre-B leukemia cell line<br />

Molecular Weight: 30-70kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Frozen human tonsil section stained with<br />

CD24 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

CD25/IL-2Rα Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: IL2R.1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human interleukin-2 receptor<br />

Molecular Weight: 55kDa<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Cat. No.<br />

MS-1278-P0<br />

MS-1278-P1<br />

MS-1278-P<br />

MS-1278-P1ABX<br />

MS-1278-PABX<br />

CD25/IL-2Rα Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4C9<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein corresponding to<br />

the external domain of the Interleukin-2 Receptor<br />

molecule<br />

Molecular Weight: 55kDa<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD25<br />

Ab–4.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1088-S0<br />

MS-1088-S1<br />

MS-1088-S<br />

MS-1088-R7<br />

MS-1088-PCS<br />

CD26/DPP IV/ADA-Binding Protein Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 202-36<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Rat. Does not react with pig and sheep. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Human T-cell clone<br />

Molecular Weight: 110kDa<br />

Positive Control: HEP-G2 cells, Lymph node or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-203-P0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-524-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-203-P1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-524-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-203-P<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-524-P<br />

Ab wthout BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-203-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-524-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-203-PABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-524-PABX<br />

USA: RUO; Int'l: RUO<br />

USA: RUO; Int'l: RUO<br />

78<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD27 Ab-2, Mouse Monoclonal Antibody<br />

CD29 (Integrin β -1) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 137B4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Recombinant human CD27 protein<br />

Molecular Weight: 120kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD27<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1468-S0<br />

MS-1468-S1<br />

MS-1468-S<br />

MS-1468-R7<br />

MS-1468-PCS<br />

Host Species: Mouse<br />

Clone: 7F10<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant protein encoding the<br />

N-terminal region of human CD29<br />

Molecular Weight: 110kDa (nonreducing) and 130<br />

(reducing)<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD29<br />

Ab–3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1089-S0<br />

MS-1089-S1<br />

MS-1089-S<br />

MS-1089-R7<br />

MS-1089-PCS<br />

USA: RUO; Int'l: RUO<br />

CD29 (Integrin β -1) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4B7R<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Pig. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Human melanoma V+B2 cell line<br />

Molecular Weight: 110kDa (nonreducing) and 130 (reducing)<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

CD30 (Reed-Sternberg Cell Marker), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CON6D/C2<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Hodgkin's lymphoma cell line L428<br />

Molecular Weight: 120kDa (mature), 90kDa<br />

(precursor)<br />

Positive Control: Hodgkin's lymphoma<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE Hodgkin's lymphoma stained with<br />

CD30.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-596-P0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1915-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-596-P1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1915-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-596-P<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1915-P<br />

Ab wWithout BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-596-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1915-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-596-PABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-1915-PABX<br />

USA: RUO; Int'l: RUO<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

7mL<br />

5 Slides<br />

n/a<br />

n/a<br />

MS-1915-R7<br />

MS-1915-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

79


CD30 (Reed-Sternberg Cell Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: Ber-H2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with<br />

baboon and monkey. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Co cells<br />

Molecular Weight: 120kDa (mature), 95kDa<br />

(precursor)<br />

Positive Control: Hodgkin's lymphoma<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human Hodgkin's lymphoma stained<br />

with CD30 Ab–1<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-361-S0<br />

MS-361-S1<br />

MS-361-S<br />

MS-361-R7<br />

MS-361-RQ<br />

MS-361-PCS<br />

Host Species: Mouse<br />

Clone: JC/70A<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat<br />

and pig. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Membrane preparation of a spleen from<br />

a patient with hairy cell leukemia<br />

Molecular Weight: 100kDa (endothelial cells) and<br />

130kDa (platelets)<br />

Positive Control: Placenta, Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with CD31.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-353-S0<br />

MS-353-S1<br />

MS-353-S<br />

MS-353-R7<br />

MS-353-RQ<br />

MS-353-PCS<br />

CD30 (Reed-Sternberg Cell Marker) Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: HRS4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant extracellular domain of<br />

CD30 protein<br />

Molecular Weight: 120kDa (mature), 95kDa<br />

(precursor)<br />

Positive Control: Hodgkin's lymphoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human Hodgkin's lymphoma stained<br />

with CD30 Ab–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1857-P0<br />

MS-1857-P1<br />

MS-1857-P<br />

MS-1857-R7<br />

MS-1857-PCS<br />

MS-1857-P1ABX<br />

MS-1857-PABX<br />

†USA: IVD; Int'l: IVD<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-6, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 1A10<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain downstream of the signal<br />

sequence<br />

Immunogen: Recombinant protein corresponding to<br />

the extracellular domain downstream of the signal<br />

sequence of the CD31 molecule<br />

Molecular Weight: 100kDa (endothelial cells) and<br />

130kDa (platelets)<br />

Positive Control: Tonsil, Placenta, Liver, Lung<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD31<br />

Ab–6.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1873-S0<br />

MS-1873-S1<br />

MS-1873-S<br />

MS-1873-R7<br />

MS-1873-PCS<br />

USA: RUO; Int'l: RUO<br />

80<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide corresponding to<br />

C-terminus of mouse CD31 protein<br />

Molecular Weight: 100 and 130kDa<br />

Positive Control: Tonsil, Placenta<br />

Cellular Localization: Endothelial cells in blood vessel<br />

of tonsil<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human tonsil stained with CD31.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-10333-P0<br />

RB-10333-P1<br />

RB-10333-P<br />

RB-10333-R7<br />

CD35/CR1 (Follicular Dendritic Cell Marker), Mouse Monoclonal<br />

Antibody<br />

CD36/GPIIIb/GPIV Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 185-1G2<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Stimulated human leukocytes<br />

Molecular Weight: 88kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Function Blocking<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Frozen human tonsil section stained with<br />

CD36 Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-756-P0<br />

MS-756-P1<br />

MS-756-P<br />

MS-756-P1ABX<br />

MS-756-PABX<br />

Host Species: Mouse<br />

Clone: E11<br />

Isotype: IgG1<br />

Species Reactivity: Human, Rhesus Monkey and<br />

Baboon. Others not tested.<br />

Epitope: Distal from the C3b-binding site<br />

Immunogen: Intact human monocytes<br />

Molecular Weight: 210-220kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Quantity<br />

FFPE human tonsil stained with CD35.<br />

Conc. Cat. No.<br />

CD37 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: IPO-24<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Spleen cells of a patient with hairy cell leukemia<br />

Molecular Weight: 33-55kDa<br />

Positive Control: Raji cells, Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen only)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

800µg/mL<br />

800µg/mL<br />

800µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

MS-336-P0<br />

MS-336-P1<br />

MS-336-P<br />

MS-336-P1ABX<br />

MS-336-PABX<br />

MS-336-R7<br />

MS-336-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-541-P0<br />

MS-541-P1<br />

MS-541-P<br />

MS-541-P1ABX<br />

MS-541-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

81


CD38 Ab-3, Mouse Monoclonal Antibody<br />

CD43/T-Cell Marker Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 38C03; same as SPC32<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant protein encoding the<br />

extracellular domain of human CD38<br />

Molecular Weight: 45kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD38<br />

Ab–3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

CD42b (GPIb) Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-983-S0<br />

MS-983-S1<br />

MS-983-S<br />

MS-983-R7<br />

MS-983-PCS<br />

Host Species: Mouse<br />

Clone: DF-T1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Myeloblastic KG1 cells<br />

Molecular Weight: 95/115/135kDa (depending upon<br />

extent of glycosylation)<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with CD43<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-146-P0<br />

MS-146-P1<br />

MS-146-P<br />

MS-146-R7<br />

MS-146-RQ<br />

MS-146-PCS<br />

MS-146-P1ABX<br />

MS-146-PABX<br />

Host Species: Mouse<br />

Clone: 42C01<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Recombinant CD42b.<br />

Molecular Weight: 135-145kDa (α-chain) and<br />

22-25kDa (β-chain)<br />

Positive Control: Tonsil<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD42b<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1174-P0<br />

MS-1174-P1<br />

MS-1174-P<br />

MS-1174-P1ABX<br />

MS-1174-PABX<br />

MS-1174-R7<br />

MS-1174-PCS<br />

†USA: IVD; Int'l: IVD<br />

CD43/T-Cell Marker Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 84-3C1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Stimulated human leukocytes<br />

Molecular Weight: 95/115/135kDa (depending upon<br />

extent of glycosylation)<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD43<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-679-P0<br />

MS-679-P1<br />

MS-679-P<br />

MS-679-P1ABX<br />

MS-679-PABX<br />

MS-679-R7<br />

MS-679-PCS<br />

82<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD44 Std./H-CAM Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5F12<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat. Others not known.<br />

Epitope: Partially sensitive to trypsin<br />

Immunogen: EBV-transformed normal human B-lymphocytes<br />

Molecular Weight: 80-95kDa<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Blocks the binding of hyaluronic acid to CD44 receptor<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

CD44 Std./H-CAM Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 156-3C11<br />

Isotype: IgG2a<br />

Species Reactivity: Human,<br />

Baboon and Green Monkey.<br />

Does not react with rat. Others<br />

not tested.<br />

Epitope: Resistant to digestion<br />

by trypsin and chymotrypsin<br />

Immunogen: Stimulated human<br />

leukocytes<br />

Molecular Weight: 80-95kDa<br />

Positive Control: HUVEC or<br />

HeLa cells, tonsil or esophageal<br />

CA<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

FFPE human esophageal CA stained with<br />

CD44 Ab–4.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Cat. No.<br />

MS-178-P0<br />

MS-178-P1<br />

MS-178-P<br />

MS-178-P1ABX<br />

MS-178-PABX<br />

anti–CD44<br />

Std./HCAM<br />

Ab–4, Native<br />

IP<br />

IVD†<br />

anti–CD44<br />

Std./HCAM<br />

Ab–4, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-668-P0<br />

200µg/mL MS-668-P1<br />

200µg/mL MS-668-P<br />

n/a MS-668-R7<br />

n/a MS-668-PCS<br />

1mg/mL MS-668-P1ABX<br />

1mg/mL MS-668-PABX<br />

200µg/mL MS-668-B0<br />

200µg/mL MS-668-B1<br />

200µg/mL MS-668-B<br />

250µg/100µL MS-668-PCL<br />

CD45/T200/LCA Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Bra55<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rhesus monkey. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Non-T, non-B ALL cell line (REH)<br />

Molecular Weight: 220, 205, 190, 180kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

CD45/T200/LCA Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PD7/26/16 + 2B11<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat<br />

and dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: PD7/26/16: human peripheral blood<br />

lymphocytes maintained in T-cell growth factor. 2B11:<br />

isolated neoplastic cells from T-cell lymphoma.<br />

Molecular Weight: 220, 205, 190, 180kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Cat. No.<br />

MS-240-P0<br />

MS-240-P1<br />

MS-240-P<br />

MS-240-P1ABX<br />

MS-240-PABX<br />

IVD†<br />

FFPE human tonsil stained with CD45<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-355-P0<br />

MS-355-P1<br />

MS-355-P<br />

MS-355-R7<br />

MS-355-RQ<br />

MS-355-PCS<br />

MS-355-P1ABX<br />

MS-355-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

83


CD45RB Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PD7/26<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Exon B<br />

Immunogen: Human peripheral blood lymphocytes<br />

maintained in T-cell growth factor<br />

Molecular Weight: 170kDa<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with CD45RB<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1846-P0<br />

MS-1846-P1<br />

MS-1846-P<br />

MS-1846-R7<br />

MS-1846-PCS<br />

MS-1846-P1ABX<br />

MS-1846-PABX<br />

CD45RO (T-Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: UCHL-1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Rhesus Monkey and<br />

Chimpanzee. Does not react with rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Interleukin-2-dependent human T<br />

lymphocytes<br />

Molecular Weight: 180kDa<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human lymph node stained with<br />

CD45RO Ab–1.<br />

Conc.<br />

100µg/mL<br />

100µg/mL<br />

100µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-112-P0<br />

MS-112-P1<br />

MS-112-P<br />

MS-112-R7<br />

MS-112-RQ<br />

MS-112-PCS<br />

MS-112-P1ABX<br />

MS-112-PABX<br />

CD47 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: B6H12.2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Ig domain<br />

Immunogen: Intact CD47 purified from placenta<br />

Molecular Weight: 47-52kDa (reduced) and 45-50.5, 110kDa (nonreduced)<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence (Methanol fixed only)<br />

• Immunoprecipitation (Native only)<br />

• Flow Cytometry<br />

• Blocks binding of SIRPα<br />

• Inhibits in assays in which CD47-integrin association is required<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

CD54/ICAM-1 Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-1302-P0<br />

MS-1302-P1<br />

MS-1302-P<br />

MS-1302-P1ABX<br />

MS-1302-PABX<br />

Host Species: Mouse<br />

Clone: 15.2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human monocytes<br />

Molecular Weight: 85-115kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone Fixed)<br />

Frozen human tonsil section stained with<br />

• Flow Cytometry<br />

CD54 Ab–1.<br />

• Blocks binding of LFA-1 and infected RBCs to ICAM-3 (Order Ab without azide)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-114-P0<br />

MS-114-P1<br />

MS-114-P<br />

MS-114-P1ABX<br />

MS-114-PABX<br />

84<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD54/ICAM-1 Ab-2, Mouse Monoclonal Antibody<br />

CD56/NCAM-1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: W-CAM-1; same as Wehi-CAM-1 or 1H4<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Raji Burkitt lymphoma cells<br />

Molecular Weight: 85-115kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Blocks intercellular adhesion of human cell lines<br />

• Functional Study<br />

Host Species: Mouse<br />

Clone: 123C3.D5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular (close to transmembrane<br />

domain)<br />

Immunogen: Membrane preparation of a small cell<br />

lung carcinoma<br />

Molecular Weight: 180, 145 and 125kDa<br />

Positive Control: Neuroblastoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

IVD†<br />

FFPE human neuroblastoma stained with<br />

CD56 Ab–2<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-305-P0<br />

MS-305-P1<br />

MS-305-P<br />

MS-305-P1ABX<br />

MS-305-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-204-P0<br />

MS-204-P1<br />

MS-204-P<br />

MS-204-R7<br />

MS-204-RQ<br />

MS-204-PCS<br />

USA: RUO; Int'l: RUO<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-204-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-204-PABX<br />

CD54/ICAM-1 Ab-4, Mouse Monoclonal Antibody<br />

†USA: IVD; Int'l: IVD<br />

Host Species: Mouse<br />

Clone: 23G12<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding part of<br />

the external domain of human CD54<br />

Molecular Weight: 85-115kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting (Not suitable)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD54<br />

Ab–4.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1094-S0<br />

MS-1094-S1<br />

MS-1094-S<br />

MS-1094-R7<br />

MS-1094-PCS<br />

CD56/NCAM-1 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 56C04; same as 123A8<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Membrane preparation of a small cell<br />

lung carcinoma<br />

Molecular Weight: 180, 145 and 125kDa<br />

Positive Control: Neuroblastoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human neuroblastoma stained with<br />

CD56 Ab–4<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1149-P0<br />

MS-1149-P1<br />

MS-1149-P<br />

MS-1149-R7<br />

MS-1149-PCS<br />

MS-1149-P1ABX<br />

MS-1149-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

85


CD57 (Natural Killer Cell Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: NK1<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human peripheral blood mononuclear<br />

cells<br />

Molecular Weight: 110kDa<br />

Positive Control: Lymph node or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with CD57<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-136-P0<br />

MS-136-P1<br />

MS-136-P<br />

MS-136-R7<br />

MS-136-PCS<br />

MS-136-P1ABX<br />

MS-136-PABX<br />

CD57 (Natural Killer Cell Marker) Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: HNK-1; same as Leu-7<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Membrane extracts of the HSB-2<br />

T-lymphoblastoid cell line<br />

Molecular Weight: 110kDa<br />

Positive Control: Lymph node or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD57<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1163-P0<br />

MS-1163-P1<br />

MS-1163-P<br />

MS-1163-P1ABX<br />

MS-1163-PABX<br />

MS-1163-R7<br />

MS-1163-PCS<br />

CD61 (GPIIIa) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2f2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding part of<br />

the external domain of human CD61<br />

Molecular Weight: 105kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane of platelets<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

CD63 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: NKI/C-3; same as MX-49.129.5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Smooth plasma membrane fraction of<br />

MeWo cells<br />

Molecular Weight: 53kDa (nonreduced)<br />

Positive Control: Melanoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

CD66e, see CEA<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD61<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1095-S0<br />

MS-1095-S1<br />

MS-1095-S<br />

MS-1095-R7<br />

MS-1095-PCS<br />

FFPE human melanoma stained with CD63<br />

Ab–1.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1118-P0<br />

MS-1118-P1<br />

MS-1118-P<br />

MS-1118-P1ABX<br />

MS-1118-PABX<br />

MS-1118-R7<br />

MS-1118-PCS<br />

USA: RUO; Int'l: RUO<br />

86<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD68/Macrophage Marker Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: KP1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey, Cat and Rat.<br />

Does not react with pig, dog and chicken.<br />

Epitope: Not determined<br />

Immunogen: Subcellular fraction of human alveolar<br />

macrophages<br />

Molecular Weight: 110kDa<br />

Positive Control: Tonsil, lymph node, or spleen<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with CD68<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-397-P0<br />

MS-397-P1<br />

MS-397-P<br />

MS-397-R7<br />

MS-397-RQ<br />

MS-397-PCS<br />

MS-397-P1ABX<br />

MS-397-PABX<br />

CD68/Macrophage Marker Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PG-M1<br />

Isotype: IgG3/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Gaucher cells<br />

Molecular Weight: 110kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

CD71/Transferrin Receptor Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 10F11<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Molecular Weight: ~90-95kDa<br />

Positive Control: Placenta<br />

Cellular Localization: Granular cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

CD74 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LN2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Baboon.<br />

Does not react with rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: SU-DHL-4 lymphoma cells<br />

Molecular Weight: 35kDa<br />

Positive Control: Raji cells, Tonsil/lymph<br />

node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1096-S0<br />

MS-1096-S1<br />

MS-1096-S<br />

MS-1096-R7<br />

MS-1096-PCS<br />

IVD†<br />

FFPE human tonsil stained with CD74 Ab–1. anti–CD74<br />

Ab–1, WB<br />

FFPE human tonsil stained with CD68<br />

Ab–4.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

Conc.<br />

200µg/mL<br />

Cat. No.<br />

MS-131-P0<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1808-S0<br />

MS-1808-S1<br />

MS-1808-S<br />

MS-1808-R7<br />

MS-1808-PCS<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

200µg/mL MS-131-P1<br />

200µg/mL MS-131-P<br />

n/a MS-131-R7<br />

n/a MS-131-PCS<br />

1mg/mL MS-131-P1ABX<br />

1mg/mL MS-131-PABX<br />

250µg/100µL MS-131-PCL<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

87


CD79a/mb-1 (B-Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HM47/A9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey,<br />

Horse, Cow, Pig, Rabbit, Guinea Pig, Rat,<br />

Mouse and Chicken (Plasma cells). Does<br />

not react with opossum.<br />

Epitope: GTYQDVGSLNIADVQ<br />

Immunogen: A synthetic peptide<br />

consisting of GTYQDVGSLNIADVQ of human<br />

CD79a protein<br />

Molecular Weight: 47kDa<br />

Positive Control: Raji cells, Lymph node<br />

or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with CD79a<br />

Ab–1.<br />

FFPE rat spleen stained with CD79a Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–CD79a/mb–1<br />

(B Cell Marker)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-357-P0<br />

200µg/mL MS-357-P1<br />

200µg/mL MS-357-P<br />

1mg/mL MS-357-P1ABX<br />

1mg/mL MS-357-PABX<br />

200µg/mL MS-357-B0<br />

200µg/mL MS-357-B1<br />

200µg/mL MS-357-B<br />

n/a MS-357-R7<br />

n/a MS-357-PCS<br />

250µg/100µL MS-357-PCL<br />

CD79a/mb-1 (B-Cell Marker) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: JCB117<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein containing part of<br />

the extracellular portion of the CD79a glycoprotein<br />

Molecular Weight: 50kDa<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with CD79a<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1171-P0<br />

MS-1171-P1<br />

MS-1171-P<br />

MS-1171-R7<br />

MS-1171-PCS<br />

MS-1171-P1ABX<br />

MS-1171-PABX<br />

CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP18<br />

Species Reactivity: Human. Does not react with<br />

mouse, rat, canine, monkey and opossum.<br />

Epitope: N-terminus<br />

Immunogen: Synthetic peptide derived from<br />

N-terminal region of human CD79a protein<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

FFPE human tonsil stained with CD79a.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9118-S0<br />

RM-9118-S1<br />

RM-9118-S<br />

RM-9118-R7<br />

RM-9118-PCS<br />

RM-9118-RQ<br />

†USA: IVD; Int'l: IVD<br />

88<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD81/TAPA-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1.3.3.22<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: B-cell line derived from a Burkitt<br />

lymphoma<br />

Molecular Weight: 24kDa<br />

Positive Control: Daudi, Raji, U266, HUT-78, HUT-102,<br />

Jurkat, HL-60, KG1a, A293, A431, MG63, and human<br />

lymphocytes; Tonsil/lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Functional Study<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

CD95/Fas Ab-3, Mouse Monoclonal Antibody<br />

Frozen human tonsil stained with CD81<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-502-P0<br />

MS-502-P1<br />

MS-502-P<br />

MS-502-P1ABX<br />

MS-502-PABX<br />

Host Species: Mouse<br />

Clone: GM30<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Internal domain near the C-terminus<br />

Immunogen: Recombinant protein corresponding to<br />

the internal domain near the C-terminal end of the Fas<br />

molecule<br />

Molecular Weight: 48kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Membrane<br />

FFPE human small intestine stained with<br />

Applications:<br />

CD95 Ab–3.<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1098-S0<br />

MS-1098-S1<br />

MS-1098-S<br />

MS-1098-PCS<br />

CD99/MIC2 (Ewing' s Sarcoma Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: HO36-1.1<br />

Isotype: IgM<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Purified E-rosette forming cells from<br />

human peripheral blood lymphocytes<br />

Molecular Weight: 27-32kDa<br />

Positive Control: Pancreas or Ewing's sarcoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human Ewing's sarcoma stained with<br />

CD99 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-294-P0<br />

MS-294-P1<br />

MS-294-P<br />

MS-294-R7<br />

MS-294-PCS<br />

MS-294-P1ABX<br />

MS-294-PABX<br />

CD99/MIC2 (Ewing' s Sarcoma Marker) Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: O13<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with<br />

mouse and rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: MeWo human melanoma cells<br />

Molecular Weight: 27-32kDa<br />

Positive Control: Pancreas or Ewing's sarcoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human Ewing's sarcoma stained with<br />

CD99 Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1633-P0<br />

MS-1633-P1<br />

MS-1633-P<br />

MS-1633-P1ABX<br />

MS-1633-PABX<br />

MS-1633-R7<br />

MS-1633-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

89


CD105/Endoglin/TGF β 1/3 Receptor, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant protein encoding aa 26-176<br />

of human CD105<br />

Molecular Weight: 95kDa (monomer) and 190kDa<br />

(dimer)<br />

Positive Control: Tonsil, Placenta<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human tonsil stained with CD105.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9291-P0<br />

RB-9291-P1<br />

RB-9291-P<br />

RB-9291-R7<br />

CD105/Endoglin/TGF-β 1/3 Receptor Ab-3, Mouse Monoclonal<br />

Antibody<br />

CD106/VCAM-1 Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1.4C3<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Stimulated human umbilical vein<br />

endothelial cells (HUVEC)<br />

Molecular Weight: 110kDa<br />

Positive Control: Placenta<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin)<br />

• Western Blotting (Not recommended)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with CD106<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1101-P0<br />

MS-1101-P1<br />

MS-1101-P<br />

MS-1101-P1ABX<br />

MS-1101-PABX<br />

MS-1101-R7<br />

MS-1101-PCS<br />

Host Species: Mouse<br />

Clone: SN6h<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Purified GP160 from cell<br />

membrane glycoproteins of fresh<br />

non-T/non-B acute lymphoblastic leukemia<br />

cells<br />

Molecular Weight: 95kDa (monomer) and FFPE human tonsil stained with CD105<br />

190kDa (dimer)<br />

Ab–3.<br />

Positive Control: HUVEC cells, Tonsil,<br />

lymph node and thymus<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–CD105/Endoglin/TGF–beta1/3<br />

Receptor<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1290-P0<br />

200µg/mL MS-1290-P1<br />

200µg/mL MS-1290-P<br />

1mg/mL MS-1290-P1ABX<br />

1mg/mL MS-1290-PABX<br />

n/a MS-1290-R7<br />

n/a MS-1290-PCS<br />

250µg/100µL MS-1290-PCL<br />

CD115/c-fms/CSF-1R/M-CSFR Ab-1, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: 2-4A5-4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with mouse and cat. Others not known.<br />

Epitope: aa 349-512<br />

Immunogen: v-ras-transformed rat NRK cells expressing transduced human CSF-1R<br />

Molecular Weight: 130 and 150kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen)<br />

• Immunofluorescence<br />

• Blocks Ligand Binding<br />

• Blocks Ligand-dependent Proliferation<br />

• Inhibits CSF-1-independent Growth of Cells Expressing Mutant CSF-1R<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RT-601-P0<br />

RT-601-P1<br />

RT-601-P<br />

RT-601-P1ABX<br />

RT-601-PABX<br />

90<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD117/c-Kit/SCF-Receptor Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: K45<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular second N-terminus Ig-like<br />

domain of c-kit<br />

Immunogen: Recombinant human extracellular c-kit<br />

fragment<br />

Molecular Weight: 145kDa<br />

Positive Control: Skin, GI Stromal Tumor (GIST)<br />

Cellular Localization: Membrane/cytoplasmic<br />

Applications:<br />

Frozen human tonsil section stained with<br />

CD117 Ab–3.<br />

• <strong>Immunohistochemistry</strong> (Frozen or fixed in methacarn or Stieve's and embedded in<br />

paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-289-P0<br />

MS-289-P1<br />

MS-289-P<br />

MS-289-P1ABX<br />

MS-289-PABX<br />

CD117/c-Kit/SCF-Receptor Ab-6, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from C-terminus of<br />

human CD117/c-kit protein<br />

Molecular Weight: 145kDa<br />

Positive Control: Tonsil, GI Stromal Tumor (GIST)<br />

Cellular Localization: Membrane/cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

FFPE human tonsil stained with<br />

CD117/c–Kit Ab–6.<br />

FFPE human stroma tumor stained with<br />

CD117/c–Kit Ab–6.<br />

CD117/c-Kit/SCF-Receptor, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Dog. Others not<br />

tested.<br />

Epitope: Cytoplasmic domain<br />

Immunogen: A synthetic peptide from the cytoplasmic<br />

domain of human CD117/c-kit protein<br />

Molecular Weight: 145kDa<br />

Positive Control: Stromal tumor, skin or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human stroma tumor stained with<br />

CD117/c–kit antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

CD137 (4-1BB) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BBK-2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Ectodomain<br />

Immunogen: Ectodomain of human 4-1BB recombinant protein<br />

Molecular Weight: 30kDa<br />

Positive Control: Spleen, thymus or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-9038-P0<br />

RB-9038-P1<br />

RB-9038-P<br />

RB-9038-R7<br />

RB-9038-RQ<br />

Cat. No.<br />

MS-621-B0<br />

MS-621-B1<br />

MS-621-B<br />

MS-621-P0<br />

MS-621-P1<br />

MS-621-P<br />

MS-621-P1ABX<br />

MS-621-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

4mg/mL<br />

4mg/mL<br />

4mg/mL<br />

4mg/mL<br />

4mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1518-P0<br />

RB-1518-P1<br />

RB-1518-P<br />

RB-1518-P1ABX<br />

RB-1518-PABX<br />

RB-1518-R7<br />

RB-1518-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

91


CD138, Rabbit Polyclonal Antibody<br />

CD141/Thrombomodulin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested<br />

Epitope: aa 18-218<br />

Immunogen: Recombinant protein encoding aa 18-218 human CD138<br />

Molecular Weight: 30.5kDa (core protein); 85-92kDa (depending upon<br />

glycosaminoglycans)<br />

Positive Control: Tonsil<br />

Cellular Localization: Plasma cell and Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

CD138 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MI15<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Ectodomain<br />

Immunogen: U-266 cells<br />

Molecular Weight: 30.5kDa (core protein); 85-92kDa<br />

(depending upon glycosaminoglycans)<br />

Positive Control: U-266 cells, Tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

RB-9422-P0<br />

RB-9422-P1<br />

RB-9422-P<br />

IVD†<br />

FFPE human tonsil stained with CD138<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1793-S0<br />

MS-1793-S1<br />

MS-1793-S<br />

MS-1793-R7<br />

MS-1793-RQ<br />

MS-1793-PCS<br />

Host Species: Mouse<br />

Clone: 141C01; same as 1009<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: EGF domain<br />

Immunogen: Recombinant protein encoding the six<br />

repeated EGF domains of human thrombomodulin<br />

Molecular Weight: 75kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human placenta stained with CD141<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1102-S0<br />

MS-1102-S1<br />

MS-1102-S<br />

MS-1102-R7<br />

MS-1102-PCS<br />

CD155/PVR (Poliovirus Receptor) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: D171<br />

Isotype: IgG1<br />

Species Reactivity: Human and Monkey. Does not react with pig, dog, rabbit, rat,<br />

hamster and mouse. Others not known.<br />

Epitope: aa 35-50<br />

Immunogen: HeLa cells<br />

Molecular Weight: 60-80kDa<br />

Positive Control: HeLa, SV 80, HEp-2, RD, A431, HL-60, U-937 cells; Monkey Vero,<br />

GMK, or TC-7 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Inhibits Replication of Poliovirus in HeLa Cells<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-465-P0<br />

MS-465-P1<br />

MS-465-P<br />

MS-465-P1ABX<br />

MS-465-PABX<br />

MS-465-B0<br />

MS-465-B1<br />

MS-465-B<br />

USA: RUO; Int'l: RUO<br />

92<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CD163 Ab-1, Mouse Monoclonal Antibody<br />

CDC7 Kinase Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 10D6<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Domains 1 to 4 of the N-terminal region<br />

Immunogen: Recombinant protein encoding of<br />

domains 1-4 of the N-terminal region of human CD163<br />

Positive Control: Placenta<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

FFPE human placenta stained with CD163<br />

Ab–1.<br />

Host Species: Mouse<br />

Clone: DCS-341<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: GST fusion protein full length CDC7<br />

Positive Control: HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

FFPE human tonsil stained with CDC7<br />

Ab–1.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

CDC6 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-180<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human CDC6 protein<br />

Molecular Weight: 62kDa<br />

Positive Control: Raji or MDA231cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

anti–CDC6<br />

Ab–1, Native<br />

IP<br />

Cat. No.<br />

MS-1103-S0<br />

MS-1103-S1<br />

MS-1103-S<br />

MS-1103-R7<br />

MS-1103-PCS<br />

anti–CDC6<br />

Ab–1, Denatured<br />

IP<br />

anti–CDC6<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-867-P0<br />

200µg/mL MS-867-P1<br />

200µg/mL MS-867-P<br />

1mg/mL MS-867-P1ABX<br />

1mg/mL MS-867-PABX<br />

200µg/mL MS-867-B0<br />

200µg/mL MS-867-B1<br />

200µg/mL MS-867-B<br />

250µg/100µL MS-867-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

CDC25A Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-120<br />

Isotype: IgG2a<br />

Species Reactivity: Human<br />

and Rat. Others not known.<br />

Immunogen: Purified<br />

recombinant CDC25A<br />

Molecular Weight: 65kDa<br />

Positive Control: LS174T cells,<br />

Tonsil<br />

Cellular Localization: Nuclear FFPE human tonsil stained with CDC25A<br />

membrane<br />

Ab–1.<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1888-P0<br />

200µg/mL MS-1888-P1<br />

200µg/mL MS-1888-P<br />

1mg/mL MS-1888-P1ABX<br />

1mg/mL MS-1888-PABX<br />

n/a MS-1888-R7<br />

n/a MS-1888-PCS<br />

250µg/100µL MS-1888-PCL<br />

anti–CDC25A anti–CDC25A<br />

Ab–1, Native Ab–1, WB<br />

IP<br />

Conc. Cat. No.<br />

200ug/mL MS-638-P0<br />

200ug/mL MS-638-P1<br />

200ug/mL MS-638-P<br />

1mg/mL MS-638-P1ABX<br />

1mg/mL MS-638-PABX<br />

250µg/100µL MS-638-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

93


CDC25C Ab-1, Mouse Monoclonal Antibody<br />

CDC47/MCM7 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 25C14; same as TC-14<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: aa 1-150<br />

Immunogen: Recombinant human CDC25C protein<br />

Molecular Weight: 53-56kDa<br />

Positive Control: HeLa, HT29 or LS174T cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not Suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–CDC25C anti–CDC25C<br />

Ab–1, Denatured<br />

Ab–1, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-751-P0<br />

200µg/mL MS-751-P1<br />

200µg/mL MS-751-P<br />

1mg/mL MS-751-P1ABX<br />

1mg/mL MS-751-PABX<br />

250µg/100µL MS-751-PCL<br />

Host Species: Mouse<br />

Clone: 47DC141; same as DCS-141<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Rat,<br />

Dog and Xenopus. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant hCDC47<br />

protein<br />

Molecular Weight: 80kDa<br />

Positive Control: MAD109, or PC12 cells,<br />

Tonsil or breast cancer<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and<br />

denatured)<br />

FFPE rat breast carcinoma stained with<br />

CDC47 Ab–2.<br />

FFPE human tonsil stained with CDC47<br />

Ab–2.<br />

anti–CDC47/MCM7<br />

Ab–2, Native<br />

IP<br />

anti–CDC47/MCM7<br />

Ab–2, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-862-P0<br />

200µg/mL MS-862-P1<br />

200µg/mL MS-862-P<br />

1mg/mL MS-862-P1ABX<br />

1mg/mL MS-862-PABX<br />

200µg/mL MS-862-B0<br />

200µg/mL MS-862-B1<br />

200µg/mL MS-862-B<br />

n/a MS-862-R7<br />

n/a MS-862-PCS<br />

250µg/100µL MS-862-PCL<br />

94<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cdh1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DH01; same as DCS-266<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human Cdh1 protein<br />

Molecular Weight: ~55kDa<br />

Positive Control: Jurkat or LS174T cells<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Cdh1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1116-P0<br />

200µg/mL MS-1116-P1<br />

200µg/mL MS-1116-P<br />

1mg/mL MS-1116-P1ABX<br />

1mg/mL MS-1116-PABX<br />

250µg/100µL MS-1116-PCL<br />

Cdk1/p34 cdc2 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A17.1.1<br />

Isotype: IgG2a<br />

Species Reactivity: Human,<br />

Mouse, Rat, Guinea Pig,<br />

Woodchuck, Xenopus and<br />

Chicken.<br />

Epitope: aa 220-227<br />

Immunogen: C-Terminal 2/3 of<br />

Xenopus CDC2 expressed in E.<br />

coli<br />

Molecular Weight: 34kDa<br />

Positive Control: HeLa,<br />

MAD109, PC12 or NIH-3T3<br />

cells; Tonsil or lymph node<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Kinase Assay<br />

• Inhibits activation of p34cdc2<br />

kinase by cyclins<br />

FFPE human tonsil stained with Cdk1 Ab–1. anti–Cdk1/<br />

p34cdc2<br />

Ab–1, Native<br />

IP<br />

anti–Cdk1/p34cdc2<br />

Ab–1, WB<br />

anti–Cdk1/<br />

p34cdc2<br />

Ab–1, Denatured<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-110-P0<br />

200µg/mL MS-110-P1<br />

200µg/mL MS-110-P<br />

1mg/mL MS-110-P1ABX<br />

1mg/mL MS-110-PABX<br />

200µg/mL MS-110-B0<br />

200µg/mL MS-110-B1<br />

200µg/mL MS-110-B<br />

n/a MS-110-R7<br />

n/a MS-110-PCS<br />

250µg/100µL MS-110-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

95


Cdk2 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2B6<br />

Isotype: IgG2b<br />

Species Reactivity: Human, Mouse and<br />

Rat.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant Cdk2<br />

protein<br />

Molecular Weight: 33kDa<br />

Positive Control: HeLa cells, Tonsil<br />

Cellular Localization: Cytoplasmic and<br />

nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE rat spleen stained with Cdk2 Ab–1.<br />

FFPE human tonsil stained with Cdk2 Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cdk2 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2B6 + 8D4<br />

Isotype: IgG2b (2B6) + IgG2a (8D4)<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant Cdk2 protein<br />

Molecular Weight: 33kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured only)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Cdk2<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-459-P0<br />

200µg/mL MS-459-P1<br />

200µg/mL MS-459-P<br />

1mg/mL MS-459-P1ABX<br />

1mg/mL MS-459-PABX<br />

200µg/mL MS-459-B0<br />

200µg/mL MS-459-B1<br />

200µg/mL MS-459-B<br />

n/a MS-459-R7<br />

n/a MS-459-PCS<br />

250µg/100µL MS-459-PCL<br />

anti–Cdk2<br />

Ab–4, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-617-P0<br />

200µg/mL MS-617-P1<br />

200µg/mL MS-617-P<br />

1mg/mL MS-617-P1ABX<br />

1mg/mL MS-617-PABX<br />

250µg/100µL MS-617-PCL<br />

Cdk4 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-35<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse, Rat and Pig. Others not<br />

known.<br />

Epitope: aa 1-20<br />

Immunogen: Purified recombinant Cdk4 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: NIH 3T3, MAD109, LS174T, or MCF-7 cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Cdk4 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-31<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: aa 16-35<br />

Immunogen: Recombinant Cdk4<br />

protein<br />

Molecular Weight: 34kDa<br />

Positive Control: MAD109, anti–Cdk4 anti–Cdk4 Ab–2, WB<br />

LS174T or PC12 cells<br />

Ab–2, Native<br />

Cellular Localization: Nuclear IP<br />

and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Cdk4<br />

Ab–1, Native<br />

IP<br />

anti–Cdk4<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-299-P0<br />

200µg/mL MS-299-P1<br />

200µg/mL MS-299-P<br />

1mg/mL MS-299-P1ABX<br />

1mg/mL MS-299-PABX<br />

200µg/mL MS-299-B0<br />

200µg/mL MS-299-B1<br />

200µg/mL MS-299-B<br />

250µg/100µL MS-299-PCL<br />

Conc. Cat. No.<br />

200µg/mL MS-469-P0<br />

200µg/mL MS-469-P1<br />

200µg/mL MS-469-P<br />

1mg/mL MS-469-P1ABX<br />

1mg/mL MS-469-PABX<br />

250µg/100µL MS-469-PCL<br />

96<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cdk4 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-31 + DCS-35<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: aa 1-35<br />

Immunogen: Purified<br />

recombinant Cdk4 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: MCF-7 or anti–Cdk4 anti–Cdk4 Ab–6, WB<br />

PC12 cells<br />

Ab–6, Denatured<br />

IP<br />

Cellular Localization: Nuclear<br />

and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Cdk5 Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DC34<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Rat, Mouse and C. elegans.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant Cdk5<br />

protein<br />

Molecular Weight: 31kDa<br />

Positive Control: HT29, anti–Cdk5 anti–Cdk5 Ab–3, WB<br />

MAD109 or PC12 cells; Brain Ab–3, Native<br />

Cellular Localization: Nuclear IP<br />

and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-616-P0<br />

200µg/mL MS-616-P1<br />

200µg/mL MS-616-P<br />

1mg/mL MS-616-P1ABX<br />

1mg/mL MS-616-PABX<br />

250µg/100µL MS-616-PCL<br />

Conc. Cat. No.<br />

200µg/mL MS-906-P0<br />

200µg/mL MS-906-P1<br />

200µg/mL MS-906-P<br />

1mg/mL MS-906-P1ABX<br />

1mg/mL MS-906-PABX<br />

250µg/100µL MS-906-PCL<br />

Cdk5 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DC17 + DC34<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant Cdk5 protein<br />

Molecular Weight: 31kDa<br />

Positive Control: IMR-5 or Ls174T cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Cdk6 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: K6.83; same as DCS-83<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: aa 30-65<br />

Immunogen: Purified recombinant Cdk6 protein<br />

Molecular Weight: 40kDa<br />

Positive Control: LS174T cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Kinase assay (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Cdk5<br />

Ab–4, Native<br />

IP<br />

anti–Cdk5<br />

Ab–4, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1059-P0<br />

200µg/mL MS-1059-P1<br />

200µg/mL MS-1059-P<br />

1mg/mL MS-1059-P1ABX<br />

1mg/mL MS-1059-PABX<br />

250µg/100µL MS-1059-PCL<br />

anti–Cdk6<br />

Ab–1, Native<br />

IP<br />

anti–Cdk6<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-398-P0<br />

200µg/mL MS-398-P1<br />

200µg/mL MS-398-P<br />

1mg/mL MS-398-P1ABX<br />

1mg/mL MS-398-PABX<br />

200µg/mL MS-398-B0<br />

200µg/mL MS-398-B1<br />

200µg/mL MS-398-B<br />

250µg/100µL MS-398-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

97


Cdk6 Ab-2, Mouse Monoclonal Antibody<br />

CDX2, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: K6.90; same as DCS-90<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant Cdk6 protein<br />

Molecular Weight: 40kDa<br />

Positive Control: Ls174T cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Kinase assay (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Cdk6<br />

Ab–2, Native<br />

IP<br />

anti–Cdk6<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-399-P0<br />

200µg/mL MS-399-P1<br />

200µg/mL MS-399-P<br />

1mg/mL MS-399-P1ABX<br />

1mg/mL MS-399-PABX<br />

250µg/100µL MS-399-PCL<br />

Host Species: Rabbit<br />

Clone: EPR2764Y<br />

Species Reactivity: Human. Others not tested.<br />

Ig Isotype: Rabbit IgG<br />

Epitope: not determined<br />

Immunogen: A synthetic peptide corresponding to<br />

residues near the N-terminus of human CDX2<br />

Molecular Weight: 40kDa<br />

Positive Control: Colon carcinomas<br />

Cellular Localization: Nuclear with occasional<br />

cytoplasmic staining on colon carcinoma<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ready-to-use for IHC (Quanto)<br />

Ready-to-use for IHC (UVLP)<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

12mL<br />

7mL<br />

100µL<br />

1mL<br />

IVD†<br />

FFPE Colon Ca stained with anti–CDX2<br />

antibody<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2116-RQ<br />

RM-2116-R7<br />

RM-2116-S0<br />

RM-2116-S<br />

CDw75 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LN1<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Nuclei from pokeweed<br />

mitogen-stimulated peripheral blood lymphocytes<br />

Molecular Weight: 53 and 87kDa<br />

Positive Control: Lymph node or tonsil<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

IVD†<br />

FFPE human tonsil stained with CDw75<br />

Ab–1.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-130-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-130-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-130-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-130-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-130-PCS<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-130-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-130-PABX<br />

†USA: IVD; Int'l: IVD<br />

98<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


CEA (Carcinoembryonic Antigen)/CD66e Ab-2, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human<br />

and Mouse. Weakly reacts with<br />

Rat. Does not react with dog.<br />

Others not known.<br />

Immunogen: Human CEA<br />

isolated from hepatic<br />

metastasis of colon<br />

adenocarcinoma<br />

Molecular Weight: 180kDa<br />

Positive Control: LS174T cells<br />

or colon CA<br />

Cellular Localization:<br />

Cytoplasmic and luminal<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE human colon carcinoma stained with<br />

Carcinoembryonic Antigen Ab–2.<br />

IVD†<br />

anti–CEA (Carcinoembryonicinoembryonic<br />

anti–CEA (Car-<br />

Antigen)/CD66e<br />

Antigen)/CD66e<br />

Ab–2, Native Ab–2, Denatured<br />

IP<br />

IP<br />

CEA (Carcinoembryonic Antigen)/CD66e Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: COL-1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human.<br />

Does not react with rat. Others<br />

not known.<br />

Immunogen: Human colon<br />

carcinoma extract<br />

Molecular Weight: 180kDa<br />

Positive Control: LS174T cells,<br />

Colon CA<br />

Cellular Localization:<br />

Cytoplasmic and luminal<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE human colon carcinoma stained with<br />

CEA Ab–3.<br />

anti–CEA/<br />

CD66e Ab–3,<br />

Denatured IP<br />

anti–CEA/CD66e<br />

Ab–3, WB<br />

FFPE human colon carcinoma stained with<br />

CEA Ab–1<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

anti–CEA (Carcinoembryonic<br />

Antigen)/CD66e<br />

Ab–2, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

n/a RB-368-A0<br />

n/a RB-368-A1<br />

n/a RB-368-A<br />

n/a RB-368-R7<br />

n/a RB-368-RQ<br />

n/a RB-368-PCS<br />

250µg/100µL RB-368-PCL<br />

Format<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

c-erb-B, see HER<br />

Quantity<br />

5 Slides<br />

100µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc. Cat. No.<br />

n/a MS-613-PCS<br />

250µg/100µL MS-613-PCL<br />

200µg/mL MS-613-P0<br />

200µg/mL MS-613-P1<br />

200µg/mL MS-613-P<br />

1mg/mL MS-613-P1ABX<br />

1mg/mL MS-613-PABX<br />

200µg/mL MS-613-B0<br />

200µg/mL MS-613-B1<br />

200µg/mL MS-613-B<br />

n/a MS-613-R7<br />

c-fms, see CD115<br />

CFTR, see Cystic Fibrosis Transmembrane Regulator<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

99


Chk2 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2CHK01; same as DCS-293<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant Chk2 protein<br />

Molecular Weight: ~70kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

anti–Chk2<br />

Ab–1, WB<br />

Chorionic Gonadotropin, Human/hCG Ab-2, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Purified β-subunit of hCG<br />

Molecular Weight: 22kDa<br />

Positive Control: Placenta or chorioca<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin-fixed)<br />

FFPE human placenta stained with hCG<br />

Ab–2.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1330-P0<br />

200µg/mL MS-1330-P1<br />

200µg/mL MS-1330-P<br />

1mg/mL MS-1330-P1ABX<br />

1mg/mL MS-1330-PABX<br />

250µg/100µL MS-1330-PCL<br />

Chorionic Gonadotropin, Human/hCG, Mouse Monoclonal Antibody<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-059-A0<br />

RB-059-A1<br />

RB-059-A<br />

RB-059-R7<br />

RB-059-PCS<br />

Chorionic Gonadotropin, Human/hCG Ab-5, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SPM105<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Human hCG β<br />

Molecular Weight: 22kDa (β-hCG)<br />

Positive Control: Placenta<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human placenta stained with hCG β.<br />

Conc. Cat. No.<br />

200µg/mL MS-9080-P0<br />

200µg/mL MS-9080-P1<br />

200µg/mL MS-9080-P<br />

n/a MS-9080-R7<br />

Host Species: Mouse<br />

Clone: CG04 + CG05<br />

Isotype: IgG2a/κ + IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Purified β-subunit of hCG<br />

Molecular Weight: 22kDa (β-hCG)<br />

Positive Control: Placenta or chorioca<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not optimum)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

FFPE human placenta stained with hCG β<br />

Ab–5.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1065-P0<br />

MS-1065-P1<br />

MS-1065-P<br />

MS-1065-P1ABX<br />

MS-1065-PABX<br />

†USA: IVD; Int'l: IVD<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1065-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1065-PCS<br />

USA: RUO; Int'l: RUO<br />

100<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Chromogranin A, Rabbit Polyclonal Antibody<br />

Chromogranin A Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Pig, Rat and<br />

Rabbit. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding human<br />

chromogranin A<br />

Molecular Weight: 68-75kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human pancreas stained with Chromogranin<br />

A.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9003-P0<br />

RB-9003-P1<br />

RB-9003-P<br />

RB-9003-R7<br />

Host Species: Mouse<br />

Clone: LK2H10<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey, Pig,<br />

Rat and Rabbit. Others not known.<br />

Immunogen: Human pheochromocytoma<br />

Molecular Weight: 68-75kDa<br />

Positive Control: PC-12 cells, Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

IVD†<br />

FFPE human pancreatic tumor stained with anti–Chromogranin<br />

A, Chromogranin A Ab–1.<br />

WB<br />

Chromogranin A, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP12<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding human<br />

chromogranin A<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human pancreas stained with Chromogranin<br />

A.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9112-S0<br />

RM-9112-S1<br />

RM-9112-S<br />

RM-9112-R7<br />

RM-9112-RQ<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

FFPE rat pancreas stained with Chromogranin<br />

A Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Chromogranin A Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PHE5<br />

Isotype: IgG1<br />

Species Reactivity: Human and Monkey. Does not<br />

react with rat. Others not known.<br />

Immunogen: Human pheochromocytoma<br />

Molecular Weight: 68-75kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Immunofluorescence<br />

Cat. No.<br />

MS-324-P0<br />

MS-324-P1<br />

MS-324-P<br />

MS-324-R7<br />

MS-324-PCS<br />

MS-324-P1ABX<br />

MS-324-PABX<br />

MS-324-B0<br />

MS-324-B1<br />

MS-324-B<br />

FFPE human GI tumor stained with Chromogranin<br />

A Ab–2.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-381-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-381-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-381-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-381-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-381-PABX<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-381-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-381-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

101


Chromogranin A Ab-3, Mouse Monoclonal Antibody<br />

Clathrin, Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LK2H10 + PHE5<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human and Monkey. Others not<br />

known.<br />

Immunogen: Human pheochromocytoma<br />

Molecular Weight: 68-75kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic in endocrine cells<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human carcinoid stained with Chromogranin<br />

A Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-382-P0<br />

MS-382-P1<br />

MS-382-P<br />

MS-382-P1ABX<br />

MS-382-PABX<br />

MS-382-R7<br />

MS-382-PCS<br />

CITED1 (CBP/p300-interacting transactivator<br />

1)/Melanocyte-specific protein 1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant full-length CITED1 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: Papillary thyroid CA<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human Wilm's tumor stained with<br />

CITED1 antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9219-P0<br />

RB-9219-P1<br />

RB-9219-P<br />

RB-9219-R7<br />

Host Species: Mouse<br />

Clone: CON.1<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Cow. Others not<br />

known.<br />

Epitope: aa 23-44<br />

Immunogen: Synthetic peptide derived from bovine<br />

clathrin light chain corresponding to the conserved<br />

region of the light chains, residues 23-44<br />

Molecular Weight: 25-29kDa<br />

Positive Control: Placenta<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Claudin 1, Rabbit Polyclonal Antibody<br />

FFPE human placenta stained with Clathrin<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey,<br />

Mouse, Dog and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived<br />

from the C-terminus of human Claudin 1<br />

Molecular Weight: 22kDa<br />

Positive Control: T47D cells, Skin or<br />

Breast CA<br />

Cellular Localization: Membrane on skin<br />

and cytoplasmic and nuclear on breast<br />

carcinoma<br />

FFPE human skin stained with Claudin 1.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Cat. No.<br />

MS-1291-P0<br />

MS-1291-P1<br />

MS-1291-P<br />

MS-1291-P1ABX<br />

MS-1291-PABX<br />

MS-1291-R7<br />

MS-1291-PCS<br />

IVD†<br />

anti–Claudin<br />

1, WB<br />

CK, see Cytokeratin<br />

Format<br />

Purified Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

Conc.<br />

200µg/mL<br />

Cat. No.<br />

RB-9209-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

RB-9209-P1<br />

c-Kit, see CD117<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

RB-9209-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RB-9209-R7<br />

Positive Control Lysate<br />

100µL<br />

250µg/100µL RB-9209-PCL<br />

†USA: IVD; Int'l: IVD<br />

102<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Claudin 3, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the<br />

C-terminus of mouse Claudin 3<br />

Molecular Weight: 22-24kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Claudin 4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the<br />

C-terminus of human Claudin 4<br />

Molecular Weight: 22-24kDa<br />

Positive Control: Tonsil and Ovarian CA<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human small intestine stained with<br />

Claudin 3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9251-P0<br />

RB-9251-P1<br />

RB-9251-P<br />

RB-9251-R7<br />

IVD†<br />

FFPE human ovarian CA stained with<br />

Claudin 4 antibody.<br />

c-myb/v-myb Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4E3<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant v-myb protein<br />

Molecular Weight: ~80kDa<br />

Positive Control: Jurkat and Ls174T cells,<br />

Testis<br />

Cellular Localization: Cytoplasmic and<br />

nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab wthout BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human seminoma stained with c–myb<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–c–myb/v–myb<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1728-P0<br />

200µg/mL MS-1728-P1<br />

200µg/mL MS-1728-P<br />

1mg/mL MS-1728-P1ABX<br />

1mg/mL MS-1728-PABX<br />

n/a MS-1728-R7<br />

n/a MS-1728-PCS<br />

250µg/100µL MS-1728-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9266-P0<br />

RB-9266-P1<br />

RB-9266-P<br />

RB-9266-R7<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

103


c-myc Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 9E10.3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not<br />

react with mouse, rat and chicken. Others<br />

not tested.<br />

Epitope: aa 410-419<br />

Immunogen: A synthetic peptide, aa<br />

408-439,<br />

FFPE human breast carcinoma stained withanti–c–myc<br />

c–myc Ab–2.<br />

Ab–2, WB<br />

(AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) from C-terminus of human c-myc<br />

Molecular Weight: 64-67kDa<br />

Positive Control: Raji cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Electron Microscopy<br />

• Affinity Purification, Immunoprecipitation and Western Blotting of fusion proteins<br />

labeled with EQKLISEEDL tag<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

c-myc Ab-5, Mouse Monoclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL MS-139-P0<br />

200µg/mL MS-139-P1<br />

200µg/mL MS-139-P<br />

1mg/mL MS-139-P1ABX<br />

1mg/mL MS-139-PABX<br />

200µg/mL MS-139-B0<br />

200µg/mL MS-139-B1<br />

200µg/mL MS-139-B<br />

n/a MS-139-R7<br />

n/a MS-139-PCS<br />

250µg/100µL MS-139-PCL<br />

c-myc Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 9E11; same as A3B2<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse and Chicken. Others not known.<br />

Epitope: aa 408-439 (Different from Ab-2)<br />

Immunogen: A synthetic peptide, aa 408-439,<br />

(AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) from C-terminus of human c-myc<br />

Molecular Weight: 64-67kDa<br />

Positive Control: Raji cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• Immunoprecipitation (Native and denatured)<br />

• Epitope Tagging (Not Suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-127-P0<br />

MS-127-P1<br />

MS-127-P<br />

MS-127-P1ABX<br />

MS-127-PABX<br />

CNPase Ab-1 (Oligodendrocyte & Schwann Cell Marker), Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 11-5B<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Cow, Sheep,<br />

Goat, Pig, Cat, Dog, Rabbit, Rat and Mouse. Does not<br />

react with guinea pig and chicken.<br />

Epitope: Not determined<br />

Immunogen: Purified human 2'-3'-cyclic nucleotide<br />

3'-phosphodiesterase (CNPase)<br />

Molecular Weight: 46kDa (CNP1) and 48kDa (CNP2)<br />

Positive Control: Brain<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

FFPE human brain stained with CNPase<br />

Ab–1.<br />

Host Species: Mouse<br />

Clone: 67P05<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Rat and Chicken. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant c-myc protein<br />

Molecular Weight: 64-67kDa<br />

Positive Control: Raji cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not Suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and Denatured)<br />

• Gel Supershift (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–c–myc<br />

Ab–5, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1054-P0<br />

200µg/mL MS-1054-P1<br />

200µg/mL MS-1054-P<br />

250µg/100µL MS-1054-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE rat brain stained with CNPase Ab–1.<br />

Conc. Cat. No.<br />

200µg/mL MS-349-P0<br />

200µg/mL MS-349-P1<br />

200µg/mL MS-349-P<br />

1mg/mL MS-349-P1ABX<br />

1mg/mL MS-349-PABX<br />

200µg/mL MS-349-B0<br />

200µg/mL MS-349-B1<br />

200µg/mL MS-349-B<br />

n/a MS-349-R7<br />

n/a MS-349-PCS<br />

USA: RUO; Int'l: RUO<br />

104<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Collagen II Ab-1, Mouse Monoclonal Antibody<br />

Collagen II Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5B2.5<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Chicken and Mouse. Others not known.<br />

Epitope: GGFDEK, slightly preceding the lysine residue involved in crosslinking. Two<br />

terminal glycine residues constitute a key structural element of the epitope. The epitope<br />

is lost after digestion of lathyritic type II collagen with recombinant stromelysin.<br />

Immunogen: A purified preparation of lathyritic type II collagen from embryonic chicken<br />

sternum<br />

Positive Control: Cartilage<br />

Cellular Localization: Cartilage matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-234-P0<br />

MS-234-P1<br />

MS-234-P<br />

MS-234-P1ABX<br />

MS-234-PABX<br />

Host Species: Mouse<br />

Clone: 6B3<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Chicken and<br />

Salamander. Others not known.<br />

Epitope: Triple helix of type II collagen<br />

Immunogen: Purified type II collagen; obtained from<br />

the adult chicken sternum by limited pepsinization<br />

Positive Control: Cartilage in lung or fetus<br />

Cellular Localization: Cartilage matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

wWithout BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human fetus stained with Collagen II<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-306-P0<br />

MS-306-P1<br />

MS-306-P<br />

MS-306-P1ABX<br />

MS-306-PABX<br />

MS-306-R7<br />

MS-306-PCS<br />

Collagen II Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2B1.5<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse, Rat, Cow and<br />

Chicken. Others not known.<br />

Epitope: Carboxyl-terminal one quarter of the type II<br />

collagen. The epitope for 2B1.5 MAb is not susceptible<br />

to digestion of lathyritic type II collagen with<br />

recombinant stromelysin.<br />

Immunogen: A purified preparation of lathyritic type<br />

II collagen from embryonic chicken sternum<br />

Positive Control: Cartilage in lung or fetus<br />

Cellular Localization: Cartilage matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human lung stained with Collagen II<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-235-P0<br />

MS-235-P1<br />

MS-235-P<br />

MS-235-P1ABX<br />

MS-235-PABX<br />

MS-235-B0<br />

MS-235-B1<br />

MS-235-B<br />

MS-235-R7<br />

MS-235-PCS<br />

USA: RUO; Int'l: RUO<br />

Collagen IV Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PHM-12<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human glomeruli<br />

Positive Control: Skin<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human skin stained with Collagen IV<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-375-S0<br />

MS-375-S1<br />

MS-375-S<br />

MS-375-R7<br />

MS-375-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

105


Collagen IV Ab-2, Mouse Monoclonal Antibody<br />

Collagen VII Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CIV 22<br />

Isotype: IgG1<br />

Species Reactivity: Human and Cow. Does not react<br />

with rat, pig and dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human glomeruli<br />

Positive Control: Skin<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

FFPE human skin stained with Collagen IV<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Collagen IV Ab-3, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-448-S0<br />

MS-448-S1<br />

MS-448-S<br />

MS-448-PCS<br />

Host Species: Mouse<br />

Clone: LH7.2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Marmoset, Monkey, Cow, Sheep, Goat, Pig and Guinea<br />

Pig.<br />

Epitope: On nonhelical (noncollagenous) C-terminal region of collagen VII and is resistant<br />

to collagenase, trypsin, pronase, neuraminidase, chondroitinase and hyaluronidase.<br />

However, it is lost by digestion of collagen VII with pepsin.<br />

Immunogen: Insoluble fractions of human neonatal foreskin epidermal cells<br />

Molecular Weight: 250kDa (intact) 150kDa (digested)<br />

Positive Control: Normal skin<br />

Cellular Localization: Epidermal basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen only; fixation in methanol is not suitable)<br />

• Immunofluorescence<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-444-P0<br />

MS-444-P1<br />

MS-444-P<br />

MS-444-P1ABX<br />

MS-444-PABX<br />

Host Species: Mouse<br />

Clone: PHM-12 + CIV 22<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human glomeruli<br />

Positive Control: Skin<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human skin stained with Collagen IV<br />

Ab–3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-747-S0<br />

MS-747-S1<br />

MS-747-S<br />

MS-747-R7<br />

MS-747-PCS<br />

USA: RUO; Int'l: RUO<br />

Collagen X Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: X-AC9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Chicken. Does not react with human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified chicken type X collagen<br />

Positive Control: Chicken cartilage<br />

Cellular Localization: Cartilage matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin; not qualified for IHC on human<br />

tissues)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-852-P0<br />

MS-852-P1<br />

MS-852-P<br />

MS-852-P1ABX<br />

MS-852-PABX<br />

MS-852-B0<br />

MS-852-B1<br />

MS-852-B<br />

Collagenase, see MMP<br />

106<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


COX-1, Rabbit Polyclonal Antibody<br />

COX2, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide corresponding to<br />

C-terminal of human COX-1<br />

Molecular Weight: 72kDa<br />

Positive Control: Esophagus<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human esophagus stained with<br />

COX–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-10687-P0<br />

RB-10687-P1<br />

RB-10687-P<br />

RB-10687-R7<br />

Host Species: Rabbit<br />

Clone: SP21<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide from C-terminus of<br />

rat COX2<br />

Molecular Weight: 70kDa<br />

Positive Control: Lung and colon CAs<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD† RabbitMAb<br />

FFPE colon carcinoma stained with COX2<br />

Conc. Cat. No.<br />

n/a RM-9121-S0<br />

n/a RM-9121-S1<br />

n/a RM-9121-S<br />

n/a RM-9121-R7<br />

n/a RM-9121-RQ<br />

CPP32, see Caspase 3<br />

†USA: IVD; Int'l: IVD<br />

CR1, see CD35<br />

CREB-Binding Protein, see p300<br />

CSF-1R, see CD115<br />

COX2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, and<br />

Rat. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: Synthetic peptide<br />

corresponding to C-terminus of rat COX2<br />

Molecular Weight: 70kDa<br />

Positive Control: HT29 cells, Lung and<br />

colon CA<br />

Cellular Localization: Cytoplasmic and<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

IVD†<br />

FFPE human colon carcinoma stained with anti–COX2,<br />

COX2.<br />

WB<br />

CXCR4/Fusin/LESTR/HUMSTR Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey and Mouse. Others not known.<br />

Epitope: Extracellular<br />

Immunogen: A synthetic peptide derived from the second extracellular loop of human<br />

CXCR4<br />

Molecular Weight: 40kDa<br />

Positive Control: Raji cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab WWithout BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1615-P0<br />

RB-1615-P1<br />

RB-1615-P<br />

RB-1615-P1ABX<br />

RB-1615-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9072-P0<br />

200µg/mL RB-9072-P1<br />

200µg/mL RB-9072-P<br />

n/a RB-9072-R7<br />

250µg/100µL RB-9072-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

107


Cyclin A Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 6E6<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human.<br />

Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant<br />

N-terminal fragment of human<br />

cyclin A protein<br />

Molecular Weight: 60kDa<br />

Positive Control: HeLa cells,<br />

Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin-fixed only)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with Cyclin A<br />

Ab–6.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cyclin A Ab-7, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic<br />

peptide from the C-terminus of<br />

human cyclin A<br />

Molecular Weight: 60kDa<br />

Positive Control: HeLa cells,<br />

Tonsil<br />

Cellular Localization: Nuclear<br />

and occasional cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with Cyclin A<br />

Ab–7.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

anti–Cyclin A, anti–Cyclin A,<br />

Native IP WB<br />

Conc. Cat. No.<br />

n/a MS-1061-S0<br />

n/a MS-1061-S1<br />

n/a MS-1061-S<br />

n/a MS-1061-R7<br />

n/a MS-1061-PCS<br />

250µg/100µL MS-1061-PCL<br />

anti–Cyclin A anti–Cyclin A<br />

Ab–7, Denatured<br />

Ab–7, WB<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-1548-P0<br />

1mg/mL RB-1548-P1<br />

1mg/mL RB-1548-P<br />

1mg/mL RB-1548-P1ABX<br />

1mg/mL RB-1548-PABX<br />

n/a RB-1548-PCS<br />

250µg/100µL RB-1548-PCL<br />

Cyclin B1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: V152<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Rat and Hamster. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Hamster cyclin B1 protein<br />

Molecular Weight: 62kDa<br />

Positive Control: Jurkat cells, Tonsil or breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Not suitable)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cyclin B1 Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic<br />

peptide derived from the<br />

C-terminus of human cyclin B1<br />

Molecular Weight: 62kDa<br />

Positive Control: Jurkat,<br />

Ls174T, HeLa cells; Breast CA<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast cancer stained with<br />

Cyclin B1 Ab–2.<br />

anti–Cyclin B1<br />

Ab–2, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

anti–Cyclin<br />

B1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-338-P0<br />

200µg/mL MS-338-P1<br />

200µg/mL MS-338-P<br />

1mg/mL MS-338-P1ABX<br />

1mg/mL MS-338-PABX<br />

n/a MS-338-R7<br />

n/a MS-338-PCS<br />

250µg/100µL MS-338-PCL<br />

anti–Cyclin B1 anti–Cyclin B1<br />

Ab–2, Native Ab–2, Denatured<br />

IP<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-008-P0<br />

1mg/mL RB-008-P1<br />

1mg/mL RB-008-P<br />

1mg/mL RB-008-P1ABX<br />

1mg/mL RB-008-PABX<br />

n/a RB-008-PCS<br />

250µg/100µL RB-008-PCL<br />

108<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cyclin B1 Ab-3, Mouse Monoclonal Antibody<br />

Cyclin C Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: GNS1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Hamster. Others not<br />

known.<br />

Epitope: aa 1-21<br />

Immunogen: Human cyclin B1 protein<br />

Molecular Weight: 62kDa<br />

Positive Control: MAD109 or LS174T cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Cyclin B1 Ab-4, Mouse Monoclonal Antibody<br />

anti–Cyclin B1 anti–Cyclin B1<br />

Ab–3, Native Ab–3, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-868-P0<br />

200µg/mL MS-868-P1<br />

200µg/mL MS-868-P<br />

1mg/mL MS-868-P1ABX<br />

1mg/mL MS-868-PABX<br />

250µg/100µL MS-868-PCL<br />

Host Species: Mouse<br />

Clone: GNS11<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Mouse, Rat<br />

and Hamster. Others not known.<br />

Epitope: aa 1-306<br />

Immunogen: Human cyclin B1 protein<br />

Molecular Weight: 62kDa<br />

Positive Control: LS174T cells, Tonsil or<br />

breast CA<br />

Cellular Localization: Cytoplasmic FFPE human tonsil stained with Cyclin B1 anti–Cyclin B1<br />

Applications:<br />

Ab–4.<br />

Ab–4, Native<br />

• <strong>Immunohistochemistry</strong><br />

IP<br />

(Formalin/paraffin)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-869-P0<br />

MS-869-P1<br />

MS-869-P<br />

MS-869-P1ABX<br />

MS-869-PABX<br />

MS-869-B0<br />

MS-869-B1<br />

MS-869-B<br />

MS-869-R7<br />

MS-869-PCS<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Dog, Mouse and Rat. Others not known.<br />

Epitope: aa 290-303<br />

Immunogen: A synthetic peptide corresponding to aa 290-303 (Cys-QGPNGSQNSSYSQS)<br />

from the C-terminal of human cyclin C<br />

Molecular Weight: 31-32kDa<br />

Positive Control: HeLa cells<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cyclin D1/Bcl-1, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP4<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat.<br />

Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide from<br />

C-terminus of human cyclin D1<br />

Molecular Weight: 36kDa<br />

Positive Control: MAD109 cells, breast CA<br />

or mantle cell lymphoma<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

Cat. No.<br />

RB-009-P0<br />

RB-009-P1<br />

RB-009-P<br />

RB-009-P1ABX<br />

RB-009-PABX<br />

RabbitMAb<br />

FFPE human mantle cell lymphoma stained anti–Cyclin<br />

with Cyclin D1.<br />

D1/Bcl–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9104-S0<br />

RM-9104-S1<br />

RM-9104-S<br />

RM-9104-R7<br />

RM-9104-RQ<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

109


Cyclin D1/Bcl-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-6<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Monkey, Mouse, Rat<br />

and Dog.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant full-length cyclin<br />

D1 protein<br />

Molecular Weight: 36kDa<br />

Positive Control: MAD109 cells; Mantle cell<br />

lymphomas and breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not Suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Biological Blockade<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Cyclin<br />

D1/Bcl–1<br />

Ab–1, Native<br />

IP<br />

Cyclin D1/Bcl-1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-11<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant full-length cyclin D1 protein<br />

Molecular Weight: 36kDa<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

anti–Cyclin<br />

D1/Bcl–1<br />

Ab–1, Denatured<br />

IP<br />

anti–Cyclin<br />

D1/Bcl–1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-210-P0<br />

200µg/mL MS-210-P1<br />

200µg/mL MS-210-P<br />

1mg/mL MS-210-P1ABX<br />

1mg/mL MS-210-PABX<br />

200µg/mL MS-210-B0<br />

200µg/mL MS-210-B1<br />

200µg/mL MS-210-B<br />

250µg/100µL MS-210-PCL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-211-P0<br />

MS-211-P1<br />

MS-211-P<br />

MS-211-P1ABX<br />

MS-211-PABX<br />

Cyclin D1/Bcl-1 Ab-3, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic<br />

peptide derived from the<br />

C-terminus of human cyclin D1<br />

Molecular Weight: 36kDa<br />

Positive Control: MAD109 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Cyclin D1 anti–Cyclin D1 / Bcl–1 Ab–3, WB<br />

/ Bcl–1 Ab–3,<br />

Native IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Cyclin D1/Bcl-1 Ab-4, Rabbit Polyclonal Antibody<br />

Conc. Cat. No.<br />

1mg/mL RB-010-P0<br />

1mg/mL RB-010-P1<br />

1mg/mL RB-010-P<br />

1mg/mL RB-010-P1ABX<br />

1mg/mL RB-010-PABX<br />

250µg/100µL RB-010-PCL<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from the C-terminal<br />

of human cyclin D1<br />

Molecular Weight: 36kDa<br />

Positive Control: MAD109 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

anti–Cyclin D1 anti–Cyclin D1<br />

• Immunofluorescence<br />

/ Bcl–1 Ab–4, / Bcl–1 Ab–4,<br />

• Immunoprecipitation<br />

Native IP WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-212-P0<br />

1mg/mL RB-212-P1<br />

1mg/mL RB-212-P<br />

1mg/mL RB-212-P1ABX<br />

1mg/mL RB-212-PABX<br />

250µg/100µL RB-212-PCL<br />

110<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cyclin D1, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EPR2241IHC<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues near the C-terminus of human Cyclin D1<br />

Molecular Weight: 36kDa<br />

Positive Control: Mantle cell lymphoma<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

12mL<br />

1mL<br />

100µL<br />

IVD†<br />

RabbitMAb<br />

FFPE human mantle cell lymphoma<br />

stained with rabbit monoclonal anti –Cyclin<br />

D1 antibody.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cyclin D1/Bcl-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from C-terminus of<br />

human cyclin D1<br />

Molecular Weight: 36kDa<br />

Positive Control: Breast CA or mantle cell lymphoma<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Cat. No.<br />

RM-2113-R7<br />

RM-2113-RQ<br />

RM-2113-S<br />

RM-2113-S0<br />

FFPE human mantle cell lymphoma stained<br />

with Cyclin D1 antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9041-P0<br />

RB-9041-P1<br />

RB-9041-P<br />

RB-9041-R7<br />

Cyclin D2 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-3.1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human recombinant full-length cyclin D2 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: U-2-OS, C82, RD, Bristol-8 or LoVo36 cells. Note that<br />

T47D, ZR75, SKBR3, MCF-7, BT-20, MDA468, HBL100, BT5549, HeLa,<br />

Saos2 and HT29 cells are negative for cyclin D2.<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Biological Blockade<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Cyclin D2 Ab-4, Mouse Monoclonal Antibody<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Cyclin<br />

D2, Native IP<br />

Cat. No.<br />

MS-213-P0<br />

MS-213-P1<br />

MS-213-P<br />

MS-213-P1ABX<br />

MS-213-PABX<br />

Host Species: Mouse<br />

Clone: DCS-3.1 + DCS-5.2<br />

Isotype: IgG2a (DCS-3.1), IgG2b (DCS-5.2)<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified histidine-tagged human recombinant full-length cyclin D2 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: U-2-OS, C82, RD, Bristol-8 or LoVo36 cells. Note that T47D, ZR75,<br />

SKBR3, MCF-7, BT-20, MDA468, HBL100, BT5549, HeLa, Saos2 and HT29 cells are<br />

negative for cyclin D2.1.<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-221-P0<br />

MS-221-P1<br />

MS-221-P<br />

MS-221-P1ABX<br />

MS-221-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

111


Cyclin D3 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-22<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Monkey, Mouse and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human<br />

recombinant full-length cyclin<br />

D3 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: LS174T cells,<br />

Breast CA or tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Flow Cytometry<br />

FFPE human tonsil stained with Cyclin D3 anti–Cyclin D3 anti–Cyclin D3<br />

Ab–1.<br />

Ab–1, Native<br />

IP<br />

Ab–1, WB<br />

Cyclin E Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived<br />

from the C-terminus of human cyclin E<br />

Molecular Weight: 50kDa (in normal<br />

tissues), and up to 12 proteins ranging<br />

20-50kDa (in tumor samples)<br />

Positive Control: SKBR3 and MAD109 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and<br />

denatured)<br />

• Kinase Assay<br />

anti–Cyclin E<br />

Ab–1, Native<br />

IP<br />

anti–Cyclin E<br />

Ab–1, Denatured<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cyclin D3 Ab-2, Mouse Monoclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL MS-215-P0<br />

200µg/mL MS-215-P1<br />

200µg/mL MS-215-P<br />

1mg/mL MS-215-P1ABX<br />

1mg/mL MS-215-PABX<br />

n/a MS-215-R7<br />

n/a MS-215-PCS<br />

250µg/100µL MS-215-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Cyclin E Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-012-P0<br />

1mg/mL RB-012-P1<br />

1mg/mL RB-012-P<br />

1mg/mL RB-012-P1ABX<br />

1mg/mL RB-012-PABX<br />

250µg/100µL RB-012-PCL<br />

Host Species: Mouse<br />

Clone: DCS-28.1<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human recombinant full-length cyclin<br />

D3 protein<br />

Molecular Weight: 34kDa<br />

Positive Control: Ls174T and PC12 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Kinase Assay (Not verified)<br />

anti–Cyclin D3 anti–Cyclin D3<br />

Ab–2, Native Ab–2, WB<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-216-P0<br />

200µg/mL MS-216-P1<br />

200µg/mL MS-216-P<br />

1mg/mL MS-216-P1ABX<br />

1mg/mL MS-216-PABX<br />

200µg/mL MS-216-B0<br />

200µg/mL MS-216-B1<br />

200µg/mL MS-216-B<br />

250µg/100µL MS-216-PCL<br />

112<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cyclin E Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HE12<br />

Isotype: IgG1<br />

Species Reactivity: Human.<br />

Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

human cyclin E protein<br />

Molecular Weight: Doublet of<br />

50kDa and a single band of<br />

42kDa<br />

FFPE human breast carcinoma stained with anti–Cyclin E<br />

Cyclin E Ab–2.<br />

Ab–2, WB<br />

Positive Control: SKBR3 or LS174T cells; Breast CA or placenta<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not suitable)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Cyclin E Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 13A3<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

human cyclin E protein<br />

Molecular Weight: Doublet of<br />

50kDa and a single band of<br />

42kDa<br />

Positive Control: SKBR3 and<br />

LS174T cells; Breast CA or placenta<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunoprecipitation (Native and Denatured)<br />

anti–Cyclin E<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-870-P0<br />

200µg/mL MS-870-P1<br />

200µg/mL MS-870-P<br />

1mg/mL MS-870-P1ABX<br />

1mg/mL MS-870-PABX<br />

200µg/mL MS-870-B0<br />

200µg/mL MS-870-B1<br />

200µg/mL MS-870-B<br />

n/a MS-870-PCS<br />

250µg/100µL MS-870-PCL<br />

FFPE human placenta stained with Cyclin E anti–Cyclin E,<br />

Ab–5.<br />

Native IP<br />

anti–Cyclin E,<br />

Denatured IP<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-3, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: L12B4<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: aa 386-412<br />

Immunogen: Recombinant protein encoding NBF1 domain of human CFTR<br />

Molecular Weight: 165-170kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1248-P0<br />

MS-1248-P1<br />

MS-1248-P<br />

MS-1248-P1ABX<br />

MS-1248-PABX<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-4, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M3A7<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: aa 1370-1380<br />

Immunogen: Recombinant protein encoding NBF2<br />

domain of human CFTR<br />

Molecular Weight: 165-170kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human pancreas stained with CFTR<br />

Ab–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1249-P0<br />

MS-1249-P1<br />

MS-1249-P<br />

MS-1249-P1ABX<br />

MS-1249-PABX<br />

MS-1249-R7<br />

MS-1249-PCS<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1060-S0<br />

MS-1060-S1<br />

MS-1060-S<br />

MS-1060-R7<br />

MS-1060-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

113


Cytochrome c Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin 5, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 7H8.2C12<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human, Mouse, Rat, Horse, Dog,<br />

Pigeon, Frog and Drosophila. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Synthetic peptides corresponding to<br />

amino acids 1-80, 81-104 and 66-104 of pigeon<br />

cytochrome c<br />

Molecular Weight: 15kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human heart stained with cytochrome<br />

c Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cytochrome c Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CTC03; same as 2B5<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Cow, Horse and Dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Equine cytochrome c<br />

Molecular Weight: 15kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• ELISA<br />

• Flow Cytometry<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-1192-P0<br />

MS-1192-P1<br />

MS-1192-P<br />

MS-1192-P1ABX<br />

MS-1192-PABX<br />

MS-1192-R7<br />

MS-1192-PCS<br />

anti–Cytochrome<br />

c,<br />

Native IP<br />

Cat. No.<br />

MS-1273-P0<br />

MS-1273-P1<br />

MS-1273-P<br />

MS-1273-P1ABX<br />

MS-1273-PABX<br />

MS-1273-B0<br />

MS-1273-B1<br />

MS-1273-B<br />

Host Species: Rabbit<br />

Clone: EP1601Y<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues on the C-terminus of human CK5<br />

Molecular Weight: 59kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human mesothelioma stained with<br />

Keratin 5<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cytokeratin 5 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: XM26<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant protein corresponding to<br />

C-terminal 103 aa of cytokeratin 5<br />

Molecular Weight: 58kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

RM-2106-S0<br />

RM-2106-S<br />

RM-2106-R7<br />

RM-2106-RQ<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Cytokeratin 5 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1896-S0<br />

MS-1896-S1<br />

MS-1896-S<br />

MS-1896-R7<br />

MS-1896-PCS<br />

USA: RUO; Int'l: RUO<br />

114<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cytokeratin 5/6 Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin 7 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D5/16 B4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Isolated cytokeratin 5<br />

Molecular Weight: 58kDa (Cytokeratin 5), 56kDa<br />

(Cytokeratin 6)<br />

Positive Control: Mesothelioma, Squamous Cell Ca<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Cytokeratin 5/6 Ab–2.<br />

Host Species: Mouse<br />

Clone: OV-TL 12/30<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: OTN II ovarian carcinoma cell line<br />

Molecular Weight: 54kDa<br />

Positive Control: Ovarian CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human ovarian carcinoma stained<br />

with Cytokeratin 7 Ab–2.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1814-S0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1352-P0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1814-S1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1352-P1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1814-S<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1352-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1814-R7<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1352-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

MS-1814-RQ<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

MS-1352-RQ<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1814-PCS<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1352-PCS<br />

†USA: IVD; Int'l: IVD<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

200µL<br />

1mg/mL<br />

1mg/mL<br />

MS-1352-P1ABX<br />

MS-1352-PABX<br />

Cytokeratin 6 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LHK6B<br />

Isotype: IgG2a<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide (GSSTIKYTTTS) from the C-terminus of human<br />

Cytokeratin 6<br />

Molecular Weight: 56kDa<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (not qualified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-766-P0<br />

MS-766-P1<br />

MS-766-P<br />

MS-766-P1ABX<br />

MS-766-PABX<br />

†USA: IVD; Int'l: IVD<br />

Cytokeratin 8, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP1628Y<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues on the C-terminus of human CK8<br />

Molecular Weight: 52kDa<br />

Positive Control: Pancreas, Mesothelioma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human colon adenocarcinoma<br />

stained with Cytokeratin 8.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2107-S0<br />

RM-2107-S<br />

RM-2107-R7<br />

RM-2107-RQ<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

115


Cytokeratin 8 Ab-4, Mouse Monoclonal Antibody<br />

Cytokeratin 8/18 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TS1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: aa 343-357<br />

Immunogen: Keratin preparation from a human<br />

carcinoma<br />

Molecular Weight: 52.5kDa<br />

Positive Control: MCF-7 or A431 cells; Skin; Colon,<br />

Lung or Breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE human breast carcinoma stained<br />

with Cytokeratin 8 Ab–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-997-P0<br />

MS-997-P1<br />

MS-997-P<br />

MS-997-R7<br />

MS-997-PCS<br />

MS-997-P1ABX<br />

MS-997-PABX<br />

MS-997-B0<br />

MS-997-B1<br />

MS-997-B<br />

Host Species: Mouse<br />

Clone: K8.8 + DC10<br />

Isotype: IgG1/κ + IgG1<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Semi-purified human cytokeratin<br />

preparation<br />

Molecular Weight: 52.5kDa (Cytokeratin 8) and 45kDa<br />

(Cytokeratin 18)<br />

Positive Control: Skin or Breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human breast cancer stained with<br />

Cytokeratin 8/18 Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cytokeratin 10 Ab-2, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-1603-P0<br />

MS-1603-P1<br />

MS-1603-P<br />

MS-1603-R7<br />

MS-1603-PCS<br />

MS-1603-P1ABX<br />

MS-1603-PABX<br />

†USA: IVD; Int'l: IVD<br />

Cytokeratin 8/18 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5D3<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Cytokeratins purified from breast cancer<br />

MCF-7 cells<br />

Molecular Weight: 52.5kDa (Cytokeratin 8) and 45kDa<br />

(Cytokeratin 18)<br />

Positive Control: Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human skin stained with Cytokeratin<br />

8/18 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-743-S0<br />

MS-743-S1<br />

MS-743-S<br />

MS-743-R7<br />

MS-743-RQ<br />

MS-743-PCS<br />

Host Species: Mouse<br />

Clone: DE-K10<br />

Isotype: IgG1<br />

Species Reactivity: Human, Rat, Dog and<br />

Cat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Cytoskeletal preparation<br />

extracted from human ectocervical<br />

epithelium<br />

Molecular Weight: 56.5kDa<br />

Positive Control: A431 cells, Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab wthout BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

IVD†<br />

FFPE human skin stained with Cytokeratin anti–Cytokeratin<br />

10 Ab–2,<br />

10 Ab–2.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc. Cat. No.<br />

200µg/mL MS-611-P0<br />

200µg/mL MS-611-P1<br />

200µg/mL MS-611-P<br />

n/a MS-611-R7<br />

n/a MS-611-PCS<br />

250µg/100µL MS-611-PCL<br />

1mg/mL MS-611-P1ABX<br />

1mg/mL MS-611-PABX<br />

200µg/mL MS-611-B0<br />

200µg/mL MS-611-B1<br />

200µg/mL MS-611-B<br />

†USA: IVD; Int'l: IVD<br />

116<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cytokeratin 14, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived<br />

from C-terminal of human Cytokeratin 14<br />

Molecular Weight: 50kDa<br />

Positive Control: A431 cells; Skin or<br />

Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

FFPE human squamous cell carcinoma<br />

stained with Cytokeratin 14 antibody.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cytokeratin 14 Ab-1, Mouse Monoclonal Antibody<br />

IVD†<br />

anti–Cytokeratin<br />

14, WB<br />

Cat. No.<br />

RB-9020-P0<br />

RB-9020-P1<br />

RB-9020-P<br />

RB-9020-R7<br />

Host Species: Mouse<br />

Clone: LL002<br />

Isotype: IgG3<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide of 15<br />

amino acid residues from the C-terminus<br />

of human Cytokeratin 14<br />

Molecular Weight: 50kDa<br />

Positive Control: A431 cells; Skin or FFPE human squamous cell carcinoma of anti–Cytokeratin<br />

14 Ab–1,<br />

Squamous cell CA<br />

lung stained with Cytokeratin 14 Ab–1.<br />

Cellular Localization: Cytoplasmic<br />

WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-115-P0<br />

200µg/mL MS-115-P1<br />

200µg/mL MS-115-P<br />

1mg/mL MS-115-P1ABX<br />

1mg/mL MS-115-PABX<br />

200µg/mL MS-115-B0<br />

200µg/mL MS-115-B1<br />

200µg/mL MS-115-B<br />

n/a MS-115-R7<br />

n/a MS-115-PCS<br />

250µg/100µL MS-115-PCL<br />

Cytokeratin 15 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LHK15<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Cow, Mouse and Rat. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A 17-mer synthetic peptide from the C-terminus of human cytokeratin<br />

15<br />

Positive Control: Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cytokeratin 16 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LL025<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the C-terminus<br />

of human cytokeratin 16<br />

Molecular Weight: 48kDa<br />

Positive Control: Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

MS-1068-P0<br />

MS-1068-P1<br />

MS-1068-P<br />

MS-1068-P1ABX<br />

MS-1068-PABX<br />

FFPE human squamous carcinoma of lung<br />

stained with Cytokeratin–16 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-620-P0<br />

MS-620-P1<br />

MS-620-P<br />

MS-620-P1ABX<br />

MS-620-PABX<br />

MS-620-R7<br />

MS-620-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

117


Cytokeratin 17 Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 18 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: E3<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Cytokeratin preparation from rat<br />

enterocytes<br />

Molecular Weight: 46kDa<br />

Positive Control: Squamous cell CA, Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

IVD†<br />

FFPE human squamous cell carcinoma<br />

stained with Cytokeratin 17 Ab–1.<br />

Host Species: Mouse<br />

Clone: DC10<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not<br />

react with rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human breast cancer PMC<br />

42 cells<br />

Molecular Weight: 45kDa<br />

Positive Control: HT29 cells, Skin, Breast<br />

or Lung CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

FFPE human breast cancer stained with Cytokeratin<br />

18 Ab–1.<br />

IVD†<br />

anti–Cytokeratin<br />

18 Ab–1,<br />

WB<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE rat breast carcinoma stained with Cytokeratin<br />

17 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cytokeratin 18, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: E431-1<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues of the human CK18<br />

Molecular Weight: 45kDa<br />

Positive Control: Mesothelioma, Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

Cat. No.<br />

MS-489-S0<br />

MS-489-S1<br />

MS-489-S<br />

MS-489-R7<br />

MS-489-PCS<br />

RabbitMAb<br />

FFPE human breast carcinoma stained with<br />

Cytokeratin 18.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2108-S0<br />

RM-2108-S<br />

RM-2108-R7<br />

RM-2108-RQ<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Cytokeratin 19, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived<br />

from C-terminal of human Cytokeratin 19<br />

Molecular Weight: 40kDa<br />

Positive Control: LS174T<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Conc. Cat. No.<br />

200µg/mL MS-142-P0<br />

200µg/mL MS-142-P1<br />

200µg/mL MS-142-P<br />

n/a MS-142-R7<br />

n/a MS-142-PCS<br />

250µg/100µL MS-142-PCL<br />

1mg/mL MS-142-P1ABX<br />

1mg/mL MS-142-PABX<br />

200µg/mL MS-142-B0<br />

200µg/mL MS-142-B1<br />

200µg/mL MS-142-B<br />

FFPE human colon carcinoma stained with anti–Cytokeratin<br />

19, Cytokeratin 19.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9021-P0<br />

200µg/mL RB-9021-P1<br />

200µg/mL RB-9021-P<br />

n/a RB-9021-R7<br />

250µg/100µL RB-9021-PCL<br />

118<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cytokeratin 19 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A53-B/A2.26; also known as Ks19.1<br />

Isotype: IgG2a/λ<br />

Species Reactivity: Human. Reacts<br />

weakly with Rat, Mouse and Guinea Pig.<br />

Others not known.<br />

Epitope: aa 312-335<br />

Immunogen: Human breast cancer MCF-7<br />

cells<br />

Molecular Weight: 40kDa<br />

Positive Control: HT29 and LS174T cells,<br />

skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

FFPE human skin stained with Cytokeratin anti–Cytokeratin<br />

19 Ab–1,<br />

19 Ab–1.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

Cytokeratin 19 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BA17<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Detergent soluble extract of<br />

human mammary epithelium<br />

Molecular Weight: 40kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Conc. Cat. No.<br />

200µg/mL MS-198-P0<br />

200µg/mL MS-198-P1<br />

200µg/mL MS-198-P<br />

n/a MS-198-R7<br />

n/a MS-198-PCS<br />

250µg/100µL MS-198-PCL<br />

1mg/mL MS-198-P1ABX<br />

1mg/mL MS-198-PABX<br />

FFPE human colon carcinoma stained with anti–Cytokeratin<br />

19 Ab–4,<br />

Cytokeratin–19 Ab–4.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1671-P0<br />

200µg/mL MS-1671-P1<br />

200µg/mL MS-1671-P<br />

1mg/mL MS-1671-P1ABX<br />

1mg/mL MS-1671-PABX<br />

n/a MS-1671-R7<br />

n/a MS-1671-PCS<br />

250µg/100µL MS-1671-PCL<br />

Cytokeratin 19 Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: RCK108<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Cytoskeleton preparation<br />

of T24 cells<br />

Molecular Weight: 40kDa<br />

Positive Control: LS174T and HT29 cells,<br />

Colon CA<br />

FFPE human colon carcinoma stained with anti–Cytokeratin<br />

Cellular Localization: Cytoplasmic Cytokeratin 19 Ab–5.<br />

19 Ab–5, WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cytokeratin 20 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Ks20.8<br />

Isotype: IgG2a<br />

Species Reactivity: Human and Mouse.<br />

Does not react with rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Semi-purified human<br />

cytokeratin preparation<br />

Molecular Weight: 46kDa<br />

Positive Control: HT29 cells, Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

Conc. Cat. No.<br />

200µg/mL MS-1902-P0<br />

200µg/mL MS-1902-P1<br />

200µg/mL MS-1902-P<br />

1mg/mL MS-1902-P1ABX<br />

1mg/mL MS-1902-PABX<br />

n/a MS-1902-R7<br />

n/a MS-1902-PCS<br />

250µg/100µL MS-1902-PCL<br />

IVD†<br />

FFPE human colonic carcinoma stained withanti–Cytoker-<br />

atin 20 Ab–1,<br />

Cytokeratin 20 Ab–1.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

n/a MS-377-S0<br />

n/a MS-377-S1<br />

n/a MS-377-S<br />

n/a MS-377-R7<br />

n/a MS-377-RQ<br />

n/a MS-377-PCS<br />

250µg/100µL MS-377-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

119


Cytokeratin 20 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Q6<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others not known.<br />

Epitope: Not determined<br />

Molecular Weight: 46kDa<br />

Positive Control: HT29 cells, Colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1854-P0<br />

MS-1854-P1<br />

MS-1854-P<br />

MS-1854-P1ABX<br />

MS-1854-PABX<br />

MS-1854-R7<br />

MS-1854-PCS<br />

Cytokeratin, High Molecular Weight Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: AE3<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Cow, Rabbit,<br />

Mouse, Rat and Chicken. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human epidermal Keratin<br />

Positive Control: Skin, Lung CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human skin stained with Cytokeratin,<br />

HMW Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-342-P0<br />

MS-342-P1<br />

MS-342-P<br />

MS-342-R7<br />

MS-342-PCS<br />

MS-342-P1ABX<br />

MS-342-PABX<br />

Cytokeratin, High Molecular Weight Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: DE-SQ<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Cytoskeletal fraction prepared from<br />

human gingiva by detergent/salt extraction<br />

Positive Control: Prostate, Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human prostate stained with Cytokeratin,<br />

HMW Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-346-P0<br />

MS-346-P1<br />

MS-346-P<br />

MS-346-P1ABX<br />

MS-346-PABX<br />

MS-346-R7<br />

MS-346-PCS<br />

Cytokeratin, High Molecular Weight Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 34βE12<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Horse and<br />

Rabbit. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Solubilized keratin extracted from<br />

human stratum corneum<br />

Molecular Weight: 68kDa (Cytokeratin 1), 58kDa<br />

(Cytokeratin 5), 56.5kDa (Cytokeratin 10) and 50kDa<br />

(Cytokeratin 14)<br />

Positive Control: Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

IVD†<br />

FFPE human Prostate stained with Cytokeratin<br />

HMW Ab–3.<br />

FFPE human breast cancer stained with<br />

Keratin HMW Ab–3<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1447-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1447-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1447-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1447-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

MS-1447-RQ<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1447-PCS<br />

†USA: IVD; Int'l: IVD<br />

120<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cytokeratin, Low Molecular Weight Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: AE1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Cow, Rabbit,<br />

Mouse, Rat and Chicken. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human epidermal Cytokeratin<br />

Positive Control: Skin, Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human squamous cell carcinoma of<br />

lung stained with Cytokeratin, LMW Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cytokeratin, Multi Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: C-11<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Rat, Mouse and<br />

Frog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Cytokeratin-enriched preparation from<br />

cultured human A431<br />

Positive Control: Skin or colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

MS-341-P0<br />

MS-341-P1<br />

MS-341-P<br />

MS-341-R7<br />

MS-341-RQ<br />

MS-341-PCS<br />

MS-341-P1ABX<br />

MS-341-PABX<br />

FFPE human colon carcinoma stained with<br />

Cytokeratin, Multi Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-149-P0<br />

MS-149-P1<br />

MS-149-P<br />

MS-149-P1ABX<br />

MS-149-PABX<br />

MS-149-R7<br />

MS-149-PCS<br />

Cytokeratin, Pan Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AE1/AE3<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human, Monkey, Cow, Rabbit,<br />

Mouse, Rat and Chicken. Others not known.<br />

Immunogen: Human epidermal keratin<br />

Positive Control: Skin, Lung CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human skin stained with Cytokeratin,<br />

Pan Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cytokeratin, Pan Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PAN-CK<br />

Isotype: IgGs<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Positive Control: Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

MS-343-P0<br />

MS-343-P1<br />

MS-343-P<br />

MS-343-R7<br />

MS-343-RQ<br />

MS-343-PCS<br />

MS-343-P1ABX<br />

MS-343-PABX<br />

FFPE human skin stained with Cytokeratin,<br />

Pan Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-356-P0<br />

MS-356-P1<br />

MS-356-P<br />

MS-356-P1ABX<br />

MS-356-PABX<br />

MS-356-R7<br />

MS-356-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

121


Cytokeratin, Pan Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Lu-5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Rat, Chicken, Snake<br />

and Frog. Shows a very wide reactivity in vertebrates.<br />

Epitope: Not determined<br />

Immunogen: Lung cancer cell line<br />

Positive Control: Skin or Squamous cell CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human squamous cell carcinoma of<br />

lung stained with Cytokeratin, Pan Ab–3.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cytomegalovirus Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CMV01<br />

Isotype: IgG1<br />

Species Reactivity: Cytomegalovirus<br />

Epitope: Not determied<br />

Immunogen: Killed Cytomegalovirus<br />

Positive Control: CMV infected tissue<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: ASR; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

100µL<br />

200µL<br />

Cat. No.<br />

MS-744-A0<br />

MS-744-A1<br />

MS-744-A<br />

MS-744-R7<br />

MS-744-PCS<br />

IVD†<br />

FFPE human CMV–infected lung stainred<br />

with anti–CMV.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-717-P0<br />

MS-717-P1<br />

MS-717-P<br />

MS-717-R7<br />

MS-717-RQ<br />

MS-717-P1ABX<br />

MS-717-PABX<br />

D4-GDI, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length human D4-GDI<br />

protein<br />

Molecular Weight: 28kDa<br />

Positive Control: Placenta and tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Delta-Heavy Chain, see IgD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human placenta stained with D4–GDI<br />

antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-9042-P0<br />

RB-9042-P1<br />

RB-9042-P<br />

RB-9042-R7<br />

RB-9042-PCS<br />

Desmin (Muscle Cell Marker), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not tested.<br />

Epitope: Near C-terminus<br />

Immunogen: A synthetic peptide mapping<br />

near the C-terminus of human desmin<br />

Molecular Weight: 53kDa<br />

Positive Control: Muscle or Sarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

FFPE human leiomyoma stained with<br />

Desmin.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

IVD†<br />

anti–Desmin<br />

(Muscle Cell<br />

Marker), WB<br />

Cat. No.<br />

RB-9014-P0<br />

RB-9014-P1<br />

RB-9014-P<br />

RB-9014-R7<br />

Cytovillin, see Ezrin<br />

122<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D33<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Baboon, Monkey, Cow,<br />

Cat, Dog, Hamster, Rat and Chicken. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Desmin from human muscle<br />

Molecular Weight: 53kDa<br />

Positive Control: Muscle or Sarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

DNAJ, see HDJ-2<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human leiomyoma stained with<br />

Desmin Ab–1.<br />

FFPE rat bladder stained with Desmin Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-376-S0<br />

MS-376-S1<br />

MS-376-S<br />

MS-376-R7<br />

MS-376-RQ<br />

MS-376-PCS<br />

DNA-PKcs Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 18-2<br />

Isotype: IgG1<br />

Species Reactivity: Human<br />

and Rat. Others not known.<br />

Epitope: aa 1-2713<br />

Immunogen: Human<br />

DNA-dependent Protein<br />

Kinase purified from HeLa<br />

cells<br />

Molecular Weight: 460kDa<br />

Positive Control: LS174T<br />

cells, Tonsil<br />

Cellular Localization:<br />

Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Inhibits (50%)<br />

DNA-dependent<br />

Phosphorylation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with DNA–PKcs<br />

Ab–1.<br />

anti–DNA–PKcs<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–DNA–PKcti–DNA–PKcs<br />

an-<br />

Ab–1, Native Ab–1, Denatured<br />

IP<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-369-P0<br />

200µg/mL MS-369-P1<br />

200µg/mL MS-369-P<br />

1mg/mL MS-369-P1ABX<br />

1mg/mL MS-369-PABX<br />

200µg/mL MS-369-B0<br />

200µg/mL MS-369-B1<br />

200µg/mL MS-369-B<br />

n/a MS-369-R7<br />

n/a MS-369-PCS<br />

250µg/100µL MS-369-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

123


DNA-PKcs Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 25-4<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 3198-4127<br />

Immunogen: Human DNA-dependent Protein Kinase<br />

purified from HeLa cells<br />

Molecular Weight: 460kDa<br />

Positive Control: LS174T cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Gel Supershift (Not optimum)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–DNA–PKcs<br />

Ab–2, Native<br />

IP<br />

DNA-PKcs Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 42-psc; same as 42-26 or 42-27<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 2713-3198<br />

Immunogen: Human DNA-dependent Protein Kinase<br />

purified from HeLa cells<br />

Molecular Weight: 460kDa<br />

Positive Control: Testis<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

anti–DNA–PKcs<br />

Ab–2, Denatured<br />

IP<br />

anti–DNA–PKcs<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-370-P0<br />

200µg/mL MS-370-P1<br />

200µg/mL MS-370-P<br />

1mg/mL MS-370-P1ABX<br />

1mg/mL MS-370-PABX<br />

250µg/100µL MS-370-PCL<br />

FFPE human testis stained with DNA–PKcs<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-371-P0<br />

MS-371-P1<br />

MS-371-P<br />

MS-371-P1ABX<br />

MS-371-PABX<br />

DNA-PKcs Ab-4 (Cocktail), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 18-2 + 25-4 + 42-psc<br />

Isotype: IgG1 + IgG2a + IgG1<br />

Species Reactivity: Human,<br />

Mouse, Hamster, Xenopus and<br />

Chicken. Others not known.<br />

Immunogen: Human<br />

DNA-dependent Protein Kinase<br />

purified from HeLa cells<br />

Molecular Weight: 460kDa<br />

Positive Control: LS174T cells,<br />

Tonsil or testis<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human testis stained with DNA–PKcs anti–DNA–PKcti–DNA–PKcs<br />

an-<br />

Ab–4.<br />

Ab–4 (Cocktail),<br />

Native IP tail), Dena-<br />

Ab–4 (Cocktured<br />

IP<br />

anti–DNA–PKcs<br />

Ab–4 (Cocktail),<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-423-P0<br />

200µg/mL MS-423-P1<br />

200µg/mL MS-423-P<br />

1mg/mL MS-423-P1ABX<br />

1mg/mL MS-423-PABX<br />

250µg/100µL MS-423-PCL<br />

DNA Polymerase, β Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 18S<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Mouse, Rat, Hamster and<br />

Xenopus. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Rat DNA polymerase β protein<br />

Molecular Weight: 39kDa<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

• Effect on Polymerase Activity (Noninhibitory)<br />

anti–Rat DNA<br />

Polymerase,<br />

Denatured IP<br />

anti–Rat DNA<br />

Polymerase,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-669-P0<br />

MS-669-P1<br />

MS-669-P<br />

MS-669-P1ABX<br />

MS-669-PABX<br />

MS-669-B0<br />

MS-669-B1<br />

MS-669-B<br />

USA: RUO; Int'l: RUO<br />

124<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


DNA Polymerase, β Ab-2, Mouse Monoclonal Antibody<br />

DOG1, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 61<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: DNA polymerase β protein<br />

Molecular Weight: 39kDa<br />

Positive Control: HeLa cells, Testis<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–DNA<br />

Polymerase,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1402-P0<br />

200µg/mL MS-1402-P1<br />

200µg/mL MS-1402-P<br />

1mg/mL MS-1402-P1ABX<br />

1mg/mL MS-1402-PABX<br />

250µg/100µL MS-1402-PCL<br />

Host Species: Rabbit<br />

Clone: SP31<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Synthetic peptide of human DOG1<br />

Molecular Weight: 78kDa<br />

Positive Control: Gastrointestinal Stromal Tumors<br />

Cellular Localization: Cytoplasmic and Membranous<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human gastrointestinal stromal tumor<br />

stained with rabbit monoclonal DOG1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9132-S0<br />

RM-9132-S<br />

RM-9132-R7<br />

RM-9132-RQ<br />

USA: RUO; Int'l: RUO<br />

DNA Polymerase, ε Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 93H3A<br />

Isotype: IgG1/κ<br />

Species Reactivity: Detects both polε and polε of Human,<br />

Monkey, Cow and Mouse. A mixture of Ab-1 & Ab-2 reacts with<br />

D. melanogaster (polε only), T. ni insect cells (polε only), S.<br />

cerevisiae (both polε and polε), X. laevis (polε)<br />

Epitope: aa 1-176<br />

Immunogen: Purified recombinant human DNA polymerase ε<br />

corresponding to aa1-176<br />

Molecular Weight: >200kDa identified as DNA polymerase ε<br />

(polε) and 140kDa polε<br />

Positive Control: 293 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–DNA<br />

Polymerase,<br />

Denatured IP<br />

anti–DNA<br />

Polymerase,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-576-P0<br />

200µg/mL MS-576-P1<br />

200µg/mL MS-576-P<br />

1mg/mL MS-576-P1ABX<br />

1mg/mL MS-576-PABX<br />

200µg/mL MS-576-B0<br />

200µg/mL MS-576-B1<br />

200µg/mL MS-576-B<br />

250µg/100µL MS-576-PCL<br />

DOG1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1.1<br />

Isotype: Unknown<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Synthetic peptide of human DOG1<br />

Molecular Weight: 78kDa<br />

Positive Control: Gastrointestinal Stromal Tumors<br />

Cellular Localization: Cytoplasmic and Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

1mL<br />

100µL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human gastrointestinal stromal tumor<br />

stained with mouse monoclonal Dog1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-1933-P<br />

MS-1933-P0<br />

MS-1933-R7<br />

MS-1933-RQ<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

125


DP-1 Transcription Factor Ab-6, Mouse Monoclonal Antibody<br />

Dystrophin, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1DP06 (TFD10)<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not known.<br />

Epitope: aa 83-204<br />

Immunogen: Recombinant DP-1 protein<br />

Molecular Weight: 45kDa<br />

Positive Control: MAD109 or Raji cells,<br />

Tonsil<br />

Cellular Localization: Cytoplasm and<br />

nucleus<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with DP–1<br />

Transcription Factor Ab–6.<br />

Quantity<br />

100µL<br />

200µL<br />

100µL<br />

100µL<br />

500µL<br />

1mL<br />

anti–DP–1<br />

Transcription<br />

Factor Ab–6,<br />

WB<br />

Conc. Cat. No.<br />

1mg/mL MS-1056-P1ABX<br />

1mg/mL MS-1056-PABX<br />

250µg/100µL MS-1056-PCL<br />

200µg/mL MS-1056-P0<br />

200µg/mL MS-1056-P1<br />

200µg/mL MS-1056-P<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide corresponding to<br />

C-terminal of human Dystrophin<br />

Molecular Weight: 427kDa<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human skeletal muscle stained with<br />

Dystrophin.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Dystrophin Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

RB-9024-P0<br />

RB-9024-P1<br />

RB-9024-P<br />

RB-9024-R7<br />

DPC4, see SMAD4<br />

DPP IV, see CD26<br />

Dysferlin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Ham1/7B6<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Rat, Rabbit,<br />

Hamster, Pig and Dog. Does not react with chicken.<br />

Others not known.<br />

Epitope: aa 1999-2016<br />

Immunogen: A synthetic peptide corresponding to aa<br />

1999-2016 of human dysferlin<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Membrane staining of muscle<br />

fiber<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human skeletal muscle stained with<br />

Dysferlin Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1874-S0<br />

MS-1874-S1<br />

MS-1874-S<br />

MS-1874-R7<br />

MS-1874-PCS<br />

Host Species: Mouse<br />

Clone: 1808<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse, Rat, Chicken,<br />

Xenopus and Torpedo. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Acetylcholine receptor (AChR)-enriched<br />

membranes and peripheral membrane proteins from<br />

Torpedo nobiliana electric organ<br />

Molecular Weight: 427kDa<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Affinity Purification<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human skeletal muscle stained with<br />

Dystrophin Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-486-P0<br />

MS-486-P1<br />

MS-486-P<br />

MS-486-P1ABX<br />

MS-486-PABX<br />

MS-486-R7<br />

MS-486-PCS<br />

126<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


E2F-1 Transcription Factor Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: KH95<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human<br />

and Mouse. Does not react with<br />

rat. Others not known.<br />

Epitope: aa 342-386<br />

Immunogen: Recombinant<br />

human E2F-1 protein<br />

Molecular Weight: ~60kDa<br />

Positive Control: HeLa or<br />

MAD109 cells, Tonsil or Breast<br />

CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with E2F–1<br />

Ab–6.<br />

anti–E2F–1 anti–E2F–1<br />

Transcription Transcription<br />

Factor Ab–6, Factor Ab–6,<br />

WB WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–E2F–1<br />

Transcription<br />

anti–E2F–1<br />

Transcription<br />

Factor Ab–6, Factor Ab–6,<br />

Native IP Denatured IP<br />

Conc. Cat. No.<br />

200µg/mL MS-879-P0<br />

200µg/mL MS-879-P1<br />

200µg/mL MS-879-P<br />

1mg/mL MS-879-P1ABX<br />

1mg/mL MS-879-PABX<br />

200µg/mL MS-879-B0<br />

200µg/mL MS-879-B1<br />

200µg/mL MS-879-B<br />

n/a MS-879-R7<br />

n/a MS-879-PCS<br />

250µg/100µL MS-879-PCL<br />

E2F-3 Transcription Factor Ab-4, Mouse Monoclonal Antibody<br />

E2F-4 Transcription Factor Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4E2F04; Same as WUF10<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human E2F-4<br />

protein<br />

Molecular Weight: ~56kDa<br />

Positive Control: Raji cells, Tonsil<br />

Cellular Localization: Nuclear and<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Early T-Cell Marker, see CD3<br />

E-Cadherin, see Cadherin E<br />

EGFR, see Epidermal Growth Factor Receptor<br />

EMA, see Epithelial Membrane Antigen<br />

FFPE human tonsil stained with E2F–4<br />

Ab–4.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–E2F–4<br />

Transcription<br />

Factor Ab–4,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1057-P0<br />

200µg/mL MS-1057-P1<br />

200µg/mL MS-1057-P<br />

1mg/mL MS-1057-P1ABX<br />

1mg/mL MS-1057-PABX<br />

200µg/mL MS-1057-B0<br />

200µg/mL MS-1057-B1<br />

200µg/mL MS-1057-B<br />

n/a MS-1057-R7<br />

n/a MS-1057-PCS<br />

250µg/100µL MS-1057-PCL<br />

Host Species: Mouse<br />

Clone: 3E2F04; same as PF37<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human E2F-3 protein<br />

Molecular Weight: ~58kDa<br />

Positive Control: Raji cells<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• Immunofluorescence<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1063-P0<br />

MS-1063-P1<br />

MS-1063-P<br />

MS-1063-P1ABX<br />

MS-1063-PABX<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

127


Emerin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4G5<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Near N-terminus<br />

Immunogen: Recombinant protein corresponding to<br />

222 amino acid fragment near N-terminus of human<br />

emerin protein<br />

Molecular Weight: 34kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Perinuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Emt, see ITK<br />

Endoglin, see CD105<br />

Endothelial Cell Marker, see CD31<br />

eNOS, see Nitric Oxide Synthase, Endothelial<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human skeletal muscle stained with<br />

Emerin Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1751-S0<br />

MS-1751-S1<br />

MS-1751-S<br />

MS-1751-R7<br />

MS-1751-PCS<br />

Epidermal Growth Factor Receptor/EGFR Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 528<br />

Isotype: IgG2a<br />

Species Reactivity: Human and Dog. Does not react with mouse and rat.<br />

Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Purified EGFR from A431 cells<br />

Molecular Weight: 170kDa (wild type) and 145kDa (vIII variant)<br />

Positive Control: A431 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Affinity Purification<br />

• Blocks EGF/TGFα-induced Activation of EGFR<br />

• Inhibits Binding of EGFR Ab-2 (clone 225) to EGFR<br />

• Inhibits Proliferation of A431 Cells<br />

• Arrests Tumor Growth in vivo<br />

• Immunoprecipitation (Native only)<br />

• Flow Cytometry<br />

Format<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Epidermal<br />

Growth<br />

Factor Receptor<br />

(EGFR)<br />

MAb, Native<br />

IP<br />

Cat. No.<br />

MS-268-B0<br />

MS-268-B1<br />

MS-268-B<br />

MS-268-P0<br />

MS-268-P1<br />

MS-268-P<br />

MS-268-P1ABX<br />

MS-268-PABX<br />

Ep-CAM, see Epithelial Specific Antigen<br />

Epidermal Growth Factor Receptor (EGFR), Rabbit Monoclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Clone: EP38Y<br />

Species Reactivity: Human. Others not tested.<br />

Ig Isotype: Rabbit IgG<br />

Epitope: Not determined<br />

Immunogen: A synthetic phospho-peptide<br />

corresponding to residues surrounding Tyr1068 of<br />

human EGFR<br />

Molecular Weight: 175kDa<br />

Positive Control: Squamous carcinoma<br />

Cellular Localization: Cell membrane and occasional<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

12mL<br />

1mL<br />

100µL<br />

IVD†<br />

FFPE human squamous cell carcinoma<br />

stained with rabbit monoclonal anti–EGFR<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2111-R7<br />

RM-2111-RQ<br />

RM-2111-S<br />

RM-2111-S0<br />

Epidermal Growth Factor Receptor/EGFR Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 225<br />

Isotype: IgG1<br />

Species Reactivity: Human, Chimpanzee and Monkey. Does not react with<br />

mouse and rat. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Purified EGFR from A431 cells<br />

Molecular Weight: 170kDa (wild type) and 145kDa (vIII variant)<br />

Positive Control: A431 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation (Native only)<br />

• Blocks EGF/TGFα-Induced Activation of EGFR<br />

• Arrests Tumor Growth in vivo<br />

• Inhibits Binding of Ab-1 (clone 528) to EGFR<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Epidermal<br />

Growth<br />

Factor Receptor<br />

(EGFR)<br />

Mab, Native<br />

IP<br />

Cat. No.<br />

MS-269-P0<br />

MS-269-P1<br />

MS-269-P<br />

MS-269-P1ABX<br />

MS-269-PABX<br />

128<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Epidermal Growth Factor Receptor/EGFR Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: EGFR.1<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Horse. Does not react with mouse. Others<br />

not known.<br />

Epitope: aa 6-273<br />

Immunogen: A431 human epidermoid cells<br />

Molecular Weight: 170kDa (wild type)<br />

Positive Control: A431 cells express only the intact and not the vIII variant<br />

of EGFR. HC2 20 d2 cells express the vIII variant. In normal breast, ducts<br />

and lobules show diffuse cytoplasmic staining.<br />

anti–Epidermal<br />

Growth<br />

Cellular Localization: Membrane<br />

Applications:<br />

Factor Receptor<br />

(EGFR),<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

Native IP<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-311-P0<br />

MS-311-P1<br />

MS-311-P<br />

MS-311-P1ABX<br />

MS-311-PABX<br />

MS-311-B0<br />

MS-311-B1<br />

MS-311-B<br />

Epidermal Growth Factor Receptor/EGFR Ab-5, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: H11<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human.<br />

Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: HC2 20 d2 cells<br />

Molecular Weight: 170kDa<br />

(wild type) and 145kDa (vIII<br />

variant)<br />

FFPE human squamous cell CA of lung<br />

Positive Control: A431 cells, stained with EGFR Ab–5.<br />

Placenta or Squamous cell CA<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

100µL<br />

anti–Epidermal<br />

Growth mal Growth<br />

anti–Epider-<br />

Factor Receptor/EGFR<br />

Factor Receptor/EGFR<br />

Ab–5, Native Ab–5, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-316-P0<br />

200µg/mL MS-316-P1<br />

200µg/mL MS-316-P<br />

1mg/mL MS-316-P1ABX<br />

1mg/mL MS-316-PABX<br />

n/a MS-316-PCS<br />

250µg/100µL MS-316-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

129


Epidermal Growth Factor Receptor/EGFR Ab-10, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 111.6<br />

Isotype: IgG1<br />

Species Reactivity: Human.<br />

Not mouse and rat.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular<br />

domain of human recombinant<br />

EGFR protein<br />

Molecular Weight: 170kDa<br />

(wild type) and 145kDa (vIII FFPE human lung squamous cell CA stainedanti–Epider-<br />

mal Growth mal Growth<br />

anti–Epider-<br />

variant)<br />

with EGFR Ab–10.<br />

Positive Control: A431 cells;<br />

Factor Receptor/EGFR<br />

Factor Receptor/EGFR<br />

Skin, Placenta or Squamous cell<br />

Ab–10, Native Ab–10, WB<br />

CA<br />

IP<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native only)<br />

• Effect on EGF Binding (Inhibitory)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-378-P0<br />

200µg/mL MS-378-P1<br />

200µg/mL MS-378-P<br />

1mg/mL MS-378-P1ABX<br />

1mg/mL MS-378-PABX<br />

200µg/mL MS-378-B0<br />

200µg/mL MS-378-B1<br />

200µg/mL MS-378-B<br />

n/a MS-378-R7<br />

n/a MS-378-PCS<br />

250µg/100µL MS-378-PCL<br />

Epidermal Growth Factor Receptor/EGFR Ab-11, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 199.12<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular domain of human recombinant EGFR<br />

protein<br />

Molecular Weight: 170kDa (wild type) and 145kDa (vIII variant)<br />

Positive Control: A431 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

anti–Epidermal<br />

Growth mal Growth<br />

anti–Epider-<br />

• Western Blotting<br />

• Immunoprecipitation (Native only)<br />

Factor Receptor/EGFR<br />

Factor Receptor/EGFR<br />

• Effect on EGF Binding (Noninhibitory)<br />

Ab–11, Native Ab–11, WB<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-396-P0<br />

200µg/mL MS-396-P1<br />

200µg/mL MS-396-P<br />

1mg/mL MS-396-P1ABX<br />

1mg/mL MS-396-PABX<br />

250µg/100µL MS-396-PCL<br />

Epidermal Growth Factor Receptor/EGFR Ab-12 (Cocktail R19/48),<br />

Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 111.6 + 199.12 + F4 + 11E8<br />

Isotype: IgG1 + IgG2a<br />

Species Reactivity: Human. Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: Extracellular and cytoplasmic domain<br />

Immunogen: Extracellular and cytoplasmic domains of<br />

recombinant human EGFR protein<br />

Molecular Weight: 170kDa (wild type) and 145kDa (vIII variant)<br />

Positive Control: A431 cells<br />

Cellular Localization: Membrane<br />

anti–Epidermal<br />

Growth mal Growth<br />

anti–Epider-<br />

Applications:<br />

• Western Blotting<br />

Factor Receptor/EGFR<br />

Factor Receptor/EGFR<br />

• Immunoprecipitation (Native only)<br />

Ab–12 (Cocktail<br />

R19/48),<br />

Ab–12 (Cocktail<br />

R19/48).<br />

Native IP WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-400-P0<br />

200µg/mL MS-400-P1<br />

200µg/mL MS-400-P<br />

1mg/mL MS-400-P1ABX<br />

1mg/mL MS-400-PABX<br />

250µg/100µL MS-400-PCL<br />

130<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Epidermal Growth Factor Receptor/EGFR Ab-13, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 528 + 199.12<br />

Isotype: IgG2a + IgG2a<br />

Species Reactivity: Human. Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: Extracellular domain<br />

Immunogen: Partially purified EGFR from A431 cells (clone<br />

528) and extracellular domain of recombinant human EGFR<br />

protein (clone 199.12)<br />

Molecular Weight: 170kDa (wild type) and 145kDa (vIII variant)<br />

Positive Control: A431 cells<br />

anti–Epidermal<br />

Growth mal Growth<br />

anti–Epider-<br />

Cellular Localization: Membrane<br />

Applications:<br />

Factor Receptor<br />

(EGFR)<br />

Factor Receptor<br />

(EGFR)<br />

• Immunoprecipitation (Native and denatured)<br />

Ab–13, Native Ab–13, Denatured<br />

IP<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Epidermal Growth Factor Receptor/EGFR Ab-15, Mouse<br />

Monoclonal Antibody<br />

Cat. No.<br />

MS-609-P0<br />

MS-609-P1<br />

MS-609-P<br />

MS-609-P1ABX<br />

MS-609-PABX<br />

MS-609-B0<br />

MS-609-B1<br />

MS-609-B<br />

Host Species: Mouse<br />

Clone: H9B4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with<br />

mouse and rat. Others not known.<br />

Epitope: Cytoplasmic domain<br />

Immunogen: Purified EGFR from A431 cells<br />

Molecular Weight: 170kDa (wild type) and 145kDa<br />

(vIII variant)<br />

Positive Control: A431 cells<br />

Cellular Localization: Membrane<br />

anti–Epidermal<br />

Growth mal Growth mal Growth<br />

anti–Epider-<br />

anti–Epider-<br />

Applications:<br />

• Western Blotting<br />

Factor Receptor/EGFR<br />

Factor Recep- Factor Receptor/EGFR<br />

tor/EGFR<br />

• Immunoprecipitation (Native and denatured) Ab–15, Native Ab–15, Denatured<br />

Ab–15,, WB<br />

IP<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-665-P0<br />

200µg/mL MS-665-P1<br />

200µg/mL MS-665-P<br />

1mg/mL MS-665-P1ABX<br />

1mg/mL MS-665-PABX<br />

250µg/100µL MS-665-PCL<br />

Epithelial Membrane Antigen/EMA Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: GP1.4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: DTRP<br />

Immunogen: Human milk fat globule membranes<br />

Molecular Weight: 265-400kDa<br />

Positive Control: Breast or Colon CA<br />

Cellular Localization: Cytoplasmic and Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

200µL<br />

5 Slides<br />

IVD†<br />

FFPE human breast CA stained with EMA<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-348-P0<br />

MS-348-P1<br />

MS-348-P<br />

MS-348-R7<br />

MS-348-P1ABX<br />

MS-348-PABX<br />

MS-348-PCS<br />

Epithelial Membrane Antigen/EMA Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: E29<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: RPAP<br />

Immunogen: Delipidated extract of human milk fat<br />

globule membranes<br />

Molecular Weight: 265-400kDa<br />

Positive Control: Breast or Colon CA<br />

Cellular Localization: Cytoplasmic and Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human breast CA stained with EMA<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-741-P0<br />

MS-741-P1<br />

MS-741-P<br />

MS-741-R7<br />

MS-741-PCS<br />

MS-741-P1ABX<br />

MS-741-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

131


Epithelial Specific Antigen/Ep-CAM Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: VU-1D9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Small cell lung carcinoma cells<br />

Molecular Weight: 40-43kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE human breast CA stained with ESA<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-144-P0<br />

MS-144-P1<br />

MS-144-P<br />

MS-144-R7<br />

MS-144-PCS<br />

MS-144-P1ABX<br />

MS-144-PABX<br />

MS-144-B0<br />

MS-144-B1<br />

MS-144-B<br />

Epithelial Specific Antigen/Ep-CAM Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 323/A3<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: MCF-7 human breast cancer cells<br />

Molecular Weight: 40-43kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Radioimaging<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

FFPE human breast CA stained with ESA<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-181-P0<br />

MS-181-P1<br />

MS-181-P<br />

MS-181-P1ABX<br />

MS-181-PABX<br />

MS-181-PCS<br />

Epithelial Specific Antigen/Ep-CAM Ab-7, Mouse Monoclonal<br />

Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: AUA1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Colon carcinoma LoVo cell line<br />

Molecular Weight: 40-43kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with ESA<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-675-P0<br />

MS-675-P1<br />

MS-675-P<br />

MS-675-P1ABX<br />

MS-675-PABX<br />

MS-675-R7<br />

MS-675-PCS<br />

Host Species: Mouse<br />

Clone: MOC-31<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Neuraminidase treated cells from a<br />

variant small cell lung carcinoma cell line (GLS-1)<br />

Molecular Weight: 40kDa<br />

Positive Control: Colon CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

FFPE human colon CA stained with ESA<br />

Ab–7.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1825-S0<br />

MS-1825-S1<br />

MS-1825-S<br />

MS-1825-R7<br />

MS-1825-RQ<br />

MS-1825-PCS<br />

132<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Epithelial Specific Antigen/Ep-CAM Ab-9, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: Ber-EP4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: MCF-7 human breast carcinoma cell line<br />

Molecular Weight: ~34 and 39kDa (reducing); 39 and<br />

41kDa (nonreducing); 31 and 36kDa (deglycosylated)<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human breast CA stained with ESA<br />

Ab–9.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1898-S0<br />

MS-1898-S1<br />

MS-1898-S<br />

MS-1898-R7<br />

MS-1898-PCS<br />

Epithelial Specific ETS3 (ESE3), Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: 5A5.5<br />

Species Reactivity: Human. Does not cross-react with mouse. Others not tested.<br />

Immunogen: Purified His-tagged recombinant ESE-3 expressed in E. coli<br />

Molecular Weight: 36kDa<br />

Positive Control: LnCAP<br />

Cellular Localization: Nuclear staining<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

400µg/mL<br />

400µg/mL<br />

400µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RT-1912-P0<br />

RT-1912-P1<br />

RT-1912-P<br />

RT-1912-P1ABX<br />

RT-1912-PABX<br />

Epstein-Barr Virus/LMP Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CS1 + CS2 + CS3 + CS4<br />

Isotype: IgG1/κ<br />

Species Reactivity: EBV-positive cells<br />

Epitope: Located in the internal part of the<br />

membrane-associated viral LMP<br />

Immunogen: EBV-encoded recombinant latent<br />

membrane protein<br />

Molecular Weight: 60kDa (LMP)<br />

Positive Control: EBV-positive lymphoblastoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

†ASR: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

ERCC1 Ab-1, Mouse Monoclonal Antibody<br />

IVD†<br />

FFPE human lymphoma stained with EBV<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Host Species: Mouse<br />

Clone: 3H11<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Full-length recombinant human ERCC1 protein<br />

Molecular Weight: 33-36kDa<br />

Positive Control: A431 or HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Cat. No.<br />

MS-1458-S0<br />

MS-1458-S1<br />

MS-1458-S<br />

MS-1458-R7<br />

anti–ERCC1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-647-P0<br />

200µg/mL MS-647-P1<br />

200µg/mL MS-647-P<br />

1mg/mL MS-647-P1ABX<br />

1mg/mL MS-647-PABX<br />

200µg/mL MS-647-B0<br />

200µg/mL MS-647-B1<br />

200µg/mL MS-647-B<br />

250µg/100µL MS-647-PCL<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

133


ERCC1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 8F1<br />

Isotype: IgG2b<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length human ERCC1 protein<br />

Molecular Weight: 33-36kDa<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

ESE3, see Epithelial Specific ETS3<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Estrogen Receptor (SP1), Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP1<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and<br />

Hamster. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: Synthetic peptide derived<br />

from C-terminal of human estrogen<br />

receptor<br />

Molecular Weight: 67kDa<br />

Positive Control: Breast CA, MCF-7 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence (Not verified)<br />

• Flow Cytometery (Not verified)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control Lysate<br />

FITC-Conjugated Ab<br />

FITC-Conjugated Ab<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

Cat. No.<br />

MS-671-P0<br />

MS-671-P1<br />

MS-671-P<br />

MS-671-P1ABX<br />

MS-671-PABX<br />

RabbitMAb<br />

FFPE human breast CA stained with Estrogen<br />

Receptor.<br />

Receptor,<br />

anti–Estrogen<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

100µL<br />

100µL<br />

1mL<br />

Conc. Cat. No.<br />

n/a RM-9101-S0<br />

n/a RM-9101-S1<br />

n/a RM-9101-S<br />

n/a RM-9101-R7<br />

n/a RM-9101-RQ<br />

250µg/100µL RM-9101-PCL<br />

n/a RM-9101-F0<br />

n/a RM-9101-F<br />

Estrogen Receptor Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AER314<br />

Isotype: IgG1/λ<br />

Species Reactivity: Human, Cow, Rabbit, Mouse and Rat.<br />

Others not known.<br />

Epitope: aa 125-165<br />

Immunogen: Purified, SDS-denatured calf uterus estrogen<br />

receptor (ER)<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Affinity Purification<br />

• Gel Supershift<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Estrogen Receptor Ab-10, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TE111.5D11<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Pig, Dog, Mouse,<br />

Rat, Sheep, Rabbit, Hamster and Chicken. Others<br />

not known.<br />

Epitope: aa 302-553<br />

Immunogen: 35kDa, C-terminal fragment (aa<br />

302-595) of human ER expressed in E. coli<br />

Molecular Weight: 67kDa<br />

Positive Control: T47D cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

• Gel Supershift<br />

• Blocks Binding of Estrogen to ER<br />

• Chromatin Precipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Estrogen<br />

Receptor<br />

Ab–10, Native<br />

IP<br />

anti–Estrogen anti–Estrogen<br />

Receptor, Native<br />

IP natured<br />

Receptor, De-<br />

IP<br />

Cat. No.<br />

MS-168-P0<br />

MS-168-P1<br />

MS-168-P<br />

MS-168-P1ABX<br />

MS-168-PABX<br />

MS-168-B0<br />

MS-168-B1<br />

MS-168-B<br />

anti–Estrogen anti–Estrogen<br />

Receptor Receptor<br />

Ab–10, Denatured<br />

Ab–10, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-315-P0<br />

200µg/mL MS-315-P1<br />

200µg/mL MS-315-P<br />

1mg/mL MS-315-P1ABX<br />

1mg/mL MS-315-PABX<br />

200µg/mL MS-315-B0<br />

200µg/mL MS-315-B1<br />

200µg/mL MS-315-B<br />

250µg/100µL MS-315-PCL<br />

134<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Estrogen Receptor Ab-11, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1D5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey,<br />

Mouse and Rat. Others not known.<br />

Epitope: N-terminal domain<br />

Immunogen: Recombinant human<br />

estrogen receptor protein<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

†USA: ASR; Int'l: IVD<br />

IVD†<br />

FFPE human breast CA stained with Estrogen<br />

Receptor Ab–11.<br />

Receptor<br />

anti–Estrogen<br />

Ab–11, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-354-P0<br />

200µg/mL MS-354-P1<br />

200µg/mL MS-354-P<br />

n/a MS-354-R7<br />

n/a MS-354-PCS<br />

1mg/mL MS-354-P1ABX<br />

1mg/mL MS-354-PABX<br />

250µg/100µL MS-354-PCL<br />

Estrogen Receptor Ab-12, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 6F11<br />

Isotype: IgG1<br />

Species Reactivity: Human<br />

and Rat. Others not known.<br />

Immunogen: Recombinant<br />

full-length estrogen receptor<br />

protein<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells,<br />

Breast CA<br />

FFPE human breast CA stained with Estrogenanti–Estrogen<br />

anti–Estrogen<br />

Cellular Localization: Nuclear Receptor Ab–12.<br />

Receptor Receptor<br />

Applications:<br />

Ab–12, Denatured<br />

IP<br />

Ab–12, WB<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Estrogen Receptor Ab-14, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1D5 + 6F11<br />

Isotype: IgG1 + IgG1/κ<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human<br />

estrogen receptor protein<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: ASR; Int'l: IVD†<br />

IVD†<br />

FFPE human breast CA stained with Estrogen<br />

Receptor Ab–14.<br />

Receptor<br />

anti–Estrogen<br />

Ab–14, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

n/a MS-750-S0<br />

n/a MS-750-S1<br />

n/a MS-750-S<br />

n/a MS-750-R7<br />

n/a MS-750-PCS<br />

250µg/100µL MS-750-PCL<br />

Estrogen Receptor Ab-16, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Hamster. Does not<br />

react with rat. Others not<br />

known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic<br />

peptide derived from the<br />

C-terminus of human estrogen<br />

receptor, α protein<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells,<br />

Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

• Gel Supershift (Not verified)<br />

FFPE human breast CA stained with Estrogen<br />

Receptor, α Ab–16.<br />

anti–Estrogen<br />

Receptor<br />

Ab–16, Denatured<br />

IP<br />

anti–Estrogen<br />

Receptor<br />

Ab–16, WB<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

n/a MS-391-S0<br />

n/a MS-391-S1<br />

n/a MS-391-S<br />

n/a MS-391-R7<br />

n/a MS-391-PCS<br />

250µg/100µL MS-391-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1493-P0<br />

1mg/mL RB-1493-P1<br />

1mg/mL RB-1493-P<br />

1mg/mL RB-1493-P1ABX<br />

1mg/mL RB-1493-PABX<br />

n/a RB-1493-R7<br />

n/a RB-1493-PCS<br />

250µg/100µL RB-1493-PCL<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

135


Estrogen Receptor Ab-17, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Rat, Mouse, Rabbit, Sheep, Pig<br />

and Cow. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic<br />

peptide from the N-terminus of<br />

human estrogen receptor, α<br />

protein<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells,<br />

Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast CA stained with Estrogen<br />

Receptor, α Ab–17.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Estrogen Receptor Ab-21, Rat Monoclonal Antibody<br />

anti–Estrogen anti–Estrogen<br />

Receptor Receptor<br />

Ab–17, Denatured<br />

Ab–17, WB<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-1521-P0<br />

1mg/mL RB-1521-P1<br />

1mg/mL RB-1521-P<br />

1mg/mL RB-1521-P1ABX<br />

1mg/mL RB-1521-PABX<br />

n/a RB-1521-PCS<br />

250µg/100µL RB-1521-PCL<br />

Host Species: Rat<br />

Clone: H222<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Shows broad species reactivity.<br />

Immunogen: Estrogen receptor purified from MCF-7 cells<br />

Molecular Weight: 67kDa<br />

Positive Control: MCF-7 cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• ELISA<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Estrogen<br />

Receptor<br />

Ab–21, WB<br />

Conc. Cat. No.<br />

200µg/mL RT-1641-P0<br />

200µg/mL RT-1641-P1<br />

200µg/mL RT-1641-P<br />

1mg/mL RT-1641-P1ABX<br />

1mg/mL RT-1641-PABX<br />

250µg/100µL RT-1641-PCL<br />

Estrogen Sulfotransferase (Anti-Rat) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: EST.1<br />

Isotype: IgG1<br />

Species Reactivity: Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified rat liver estrogen<br />

sulfotransferase<br />

Molecular Weight: ~31kDa<br />

Positive Control: Rat liver<br />

Cellular Localization: Cytoplasmic with some nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Ets-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1G11<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 226-454<br />

Immunogen: Recombinant oncoprotein corresponding<br />

to aa 226-454 of human Ets-1<br />

Molecular Weight: 51kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE rat liver stained with Estrogen Sulfotransferase<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-233-P0<br />

MS-233-P1<br />

MS-233-P<br />

MS-233-P1ABX<br />

MS-233-PABX<br />

MS-233-R7<br />

MS-233-PCS<br />

FFPE human tonsil stained with Ets–1<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1762-S0<br />

MS-1762-S1<br />

MS-1762-S<br />

MS-1762-R7<br />

MS-1762-PCS<br />

136<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Excitatory Amino Acid Transporter 2 Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 1H8<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal cytoplasmic domain<br />

Immunogen: Recombinant protein corresponding to<br />

C-terminal cytoplasmic domain of human EAAT2<br />

Positive Control: Brain<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Ewing's Sarcoma Marker, see CD99<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Exo1 Ab-4, Mouse Monoclonal Antibody<br />

FFPE human brain stained with EAAT2<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Host Species: Mouse<br />

Clone: 266<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Immunogen: Recombinant full-length mouse Exo1 protein<br />

Molecular Weight: ~92kDa<br />

Positive Control: MCF-7 and MAD109<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Cat. No.<br />

MS-1750-S0<br />

MS-1750-S1<br />

MS-1750-S<br />

MS-1750-R7<br />

MS-1750-PCS<br />

anti–Exo1<br />

Ab–4, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1534-P0<br />

200µg/mL MS-1534-P1<br />

200µg/mL MS-1534-P<br />

1mg/mL MS-1534-P1ABX<br />

1mg/mL MS-1534-PABX<br />

250µg/100µL MS-1534-PCL<br />

Ezrin/p81/80K/Cytovillin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3C12<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Monkey, Cow, Kangaroo, Rat,<br />

Mouse and Hamster. Others not<br />

known.<br />

Epitope: aa 362-585<br />

Immunogen: A recombinant<br />

fragment of human ezrin<br />

corresponding to aa 362-585 FFPE human lung stained with Ezrin Ab–1. anti–Ezrin/ anti–Ezrin/<br />

Molecular Weight: 81kDa<br />

p81/80K /Cy- p81/80K/ Cy-<br />

Positive Control: Raji cells,<br />

Lung<br />

tovillin Ab–1,<br />

Native IP<br />

tovillin Ab–1, ,<br />

Denatured IP<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Ezrin/ anti–Ezrin/<br />

p81/80K/ Cytovillin<br />

Ab–1,<br />

p81/80K/ Cy-<br />

tovillin Ab–1,<br />

WB WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-661-P0<br />

200µg/mL MS-661-P1<br />

200µg/mL MS-661-P<br />

1mg/mL MS-661-P1ABX<br />

1mg/mL MS-661-PABX<br />

200µg/mL MS-661-B0<br />

200µg/mL MS-661-B1<br />

200µg/mL MS-661-B<br />

n/a MS-661-R7<br />

n/a MS-661-PCS<br />

250µg/100µL MS-661-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

137


Factor VIII Related Antigen/von Willebrand Factor Ab-1, Rabbit<br />

Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified factor VIII related antigen/von<br />

Willebrand factor<br />

Molecular Weight: 270kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with Factor VIII<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-281-A0<br />

RB-281-A1<br />

RB-281-A<br />

RB-281-R7<br />

RB-281-PCS<br />

Factor VIII Related Antigen/von Willebrand Factor Ab-2, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: F8/86<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Partially purified von Willebrand factor<br />

from human placenta<br />

Molecular Weight: 270kDa<br />

Positive Control: Blood vessels in tonsil or intestine<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with Factor VIII<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-722-P0<br />

MS-722-P1<br />

MS-722-P<br />

MS-722-R7<br />

MS-722-RQ<br />

MS-722-PCS<br />

MS-722-P1ABX<br />

MS-722-PABX<br />

Factor XIII A Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AC-1A1<br />

IVD†<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein<br />

corresponding to A-subunit of coagulation<br />

Factor XIII<br />

Molecular Weight: 160kDa (unreduced<br />

dimmer); 80kDa (reduced monomer)<br />

Positive Control: Recombinant human<br />

Factor XIII A-subunit; Capillary<br />

hemangioma, dermatofibroma and<br />

placenta<br />

FFPE human placenta stained with Factor<br />

XIII A Ab–1.<br />

anti–Factor XI-<br />

II A Ab–1, WB<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

Factor XIII A Ab-2, Rabbit Polyclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL MS-1237-P0<br />

200µg/mL MS-1237-P1<br />

200µg/mL MS-1237-P<br />

n/a MS-1237-R7<br />

n/a MS-1237-RQ<br />

n/a MS-1237-PCS<br />

250µg/100µL MS-1237-PCL<br />

1mg/mL MS-1237-P1ABX<br />

1mg/mL MS-1237-PABX<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein corresponding to A-subunit of<br />

coagulation Factor XIII<br />

Molecular Weight: 160kDa (unreduced dimer); 80kDa (reduced monomer)<br />

Positive Control: Human recombinant Factor XIII A-subunit; Capillary<br />

hemangioma, dermatofibroma and placenta<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Factor<br />

XIII A Ab–2,<br />

WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1464-P0<br />

1mg/mL RB-1464-P1<br />

1mg/mL RB-1464-P<br />

1mg/mL RB-1464-P1ABX<br />

1mg/mL RB-1464-PABX<br />

n/a RB-1464-R7<br />

n/a RB-1464-PCS<br />

250µg/100µL RB-1464-PCL<br />

USA: RUO; Int'l: RUO<br />

138<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


FAK (Focal Adhesion Kinase) Ab-1, Rabbit Polyclonal Antibody<br />

Fascin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Dog and Frog. Others not known.<br />

Epitope: aa 853-1052<br />

Immunogen: Recombinant protein corresponding to aa 853-1052 from<br />

the C-terminus of human FAK<br />

Molecular Weight: 125kDa<br />

Positive Control: U118, SW156, HUVEC or IMR-5 cells<br />

Cellular Localization: Cytoplasmic and focal contacts<br />

Applications:<br />

• Western Blotting<br />

anti–FAK (Focal<br />

Adhesion<br />

• Immunofluorescence<br />

Kinase)<br />

Ab–1, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Fas, see CD95<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-477-P0<br />

1mg/mL RB-477-P1<br />

1mg/mL RB-477-P<br />

1mg/mL RB-477-P1ABX<br />

1mg/mL RB-477-PABX<br />

250µg/100µL RB-477-PCL<br />

Host Species: Mouse<br />

Clone: FCN01; same as 55K-2<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Fascin purified from HeLa cells<br />

Molecular Weight: 55kDa<br />

Positive Control: Hodgkin's lymphoma or spleen<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Fcγ Receptor III, see CD16<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE rat spleen stained with Fascin Ab–1.<br />

Conc. Cat. No.<br />

n/a MS-1112-S0<br />

n/a MS-1112-S1<br />

n/a MS-1112-S<br />

n/a MS-1112-R7<br />

n/a MS-1112-RQ<br />

n/a MS-1112-PCS<br />

Fas Ligand, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not tested.<br />

Epitope: N-terminus<br />

Immunogen: A synthetic peptide derived<br />

from N-terminal of human Fas ligand<br />

Molecular Weight: 37kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Membrane and<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

FFPE human prostate CA stained with Fas anti–Fas Ligand,<br />

ligand antibody.<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-9029-P0<br />

RB-9029-P1<br />

RB-9029-P<br />

RB-9029-R7<br />

RB-9029-PCS<br />

α-Fetoprotein (AFP) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: C3<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Dog and Pig. It does not react with cow, cat, mouse and<br />

rat.<br />

Epitope: Not determined<br />

Immunogen: Raised against affinity purified α-fetoprotein (AFP) from serum of a<br />

hepatoma patient<br />

Molecular Weight: 70kDa<br />

Positive Control: Fetal liver or hepatocellular CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-226-P0<br />

MS-226-P1<br />

MS-226-P<br />

MS-226-P1ABX<br />

MS-226-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

139


Fibrillin-1 Ab-1, Mouse Monoclonal Antibody<br />

Fibronectin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 11C1.3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Cow. Others not known.<br />

Epitope: aa 451-909<br />

Immunogen: Microfibrils from zonular apparatus of bovine eye<br />

Molecular Weight: 350kDa<br />

Positive Control: Normal skin fibroblasts<br />

Cellular Localization: Extracellular microfibrils<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Fibrinogen, FITC Labeled Antibody<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-231-P0<br />

MS-231-P1<br />

MS-231-P<br />

MS-231-P1ABX<br />

MS-231-PABX<br />

Host Species: Rabbit<br />

Species Reactivity: Reacts with fibrinogen plasma protein including fibrinogen<br />

fragments D, E, X and Y.<br />

Immunogen: Fibrinogen isolated from human serum<br />

Positive Control: Lymph node, spleen, liver, kidney or skin fixed and processed in the<br />

same manner as the test specimen<br />

Cellular Localization: Lymphatic tissues, liver or in various types of diseased skin or<br />

kidney tissue<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1924-R2<br />

Host Species: Mouse<br />

Clone: HFN 7.1<br />

Isotype: IgG1<br />

Species Reactivity: Human specific<br />

Epitope: Peptide core<br />

Immunogen: Human fibronectin purified from serum<br />

by affinity chromatography on gelatin-sepharose<br />

Molecular Weight: 440kDa (nonreduced) and<br />

220kDa (reduced)<br />

Positive Control: SW156 cells<br />

Cellular Localization: Connective tissue matrix and<br />

basement membrane<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Biological Blockade (Order Ab without azide)<br />

Format<br />

Positive Control Lysate<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

anti–Fibronectin<br />

Ab–1, Native<br />

IP<br />

Fibronectin Ab-11, Mouse Monoclonal Antibody<br />

anti–Fibronectin<br />

Ab–1, Denatured<br />

IP<br />

anti–Fibronectin<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

250µg/100µL MS-165-PCL<br />

200µg/mL MS-165-P0<br />

200µg/mL MS-165-P1<br />

200µg/mL MS-165-P<br />

1mg/mL MS-165-P1ABX<br />

1mg/mL MS-165-PABX<br />

Host Species: Mouse<br />

Clone: FBN11<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: Not known<br />

Immunogen: Recombinant fibronectin protein<br />

Molecular Weight: 440kDa (nonreduced) and 220kDa (reduced)<br />

Cellular Localization: Connective tissue matrix and basement membrane<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1351-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1351-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1351-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1351-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-1351-PABX<br />

USA: RUO; Int'l: RUO<br />

140<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Filaggrin Ab-1, Mouse Monoclonal Antibody<br />

Fli-1, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: FLG01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant filaggrin protein<br />

Molecular Weight: 38kDa (Filaggrin) and 400kDa<br />

(Profilaggrin)<br />

Positive Control: Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human skin stained with Filaggrin<br />

Ab–1.<br />

Host Species: Rabbit<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide derived from C-terminus of human Fli-1<br />

Molecular Weight: ~50kDa<br />

Positive Control: Ewing's sarcoma, Angiosarcoma, Jurkat cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

anti–Fli–1,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Filamin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: FLMN01; same as PM6/317<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse,<br />

Rabbit, Guinea Pig, Chicken and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Platelet filamin<br />

Molecular Weight: 250kDa<br />

Positive Control: NIH3T3 cells, Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• ELISA<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

FFPE human skin stained with Filamin<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cat. No.<br />

MS-449-P0<br />

MS-449-P1<br />

MS-449-P<br />

MS-449-P1ABX<br />

MS-449-PABX<br />

MS-449-R7<br />

MS-449-PCS<br />

anti–Filamin<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1211-P0<br />

200µg/mL MS-1211-P1<br />

200µg/mL MS-1211-P<br />

1mg/mL MS-1211-P1ABX<br />

1mg/mL MS-1211-PABX<br />

n/a MS-1211-R7<br />

n/a MS-1211-PCS<br />

250µg/100µL MS-1211-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FLICE, see Caspase 8<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9295-P0<br />

200µg/mL RB-9295-P1<br />

200µg/mL RB-9295-P<br />

250µg/100µL RB-9295-PCL<br />

Flk-1/KDR/VEGFR2 Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from<br />

C-terminus of the precursor form of the<br />

mouse Flk-1<br />

Molecular Weight: ~180kDa<br />

Positive Control: Hey cells, Angiosarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

FFPE human angiosarcoma stained with<br />

Flk–1/ VEGFR2 Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

anti–Flk–1/KDR/<br />

VEGFR2<br />

Ab–1, WB<br />

Cat. No.<br />

RB-1526-P0<br />

RB-1526-P1<br />

RB-1526-P<br />

RB-1526-P1ABX<br />

RB-1526-PABX<br />

RB-1526-R7<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

141


Flt-1/VEGFR1 Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the<br />

C-terminus of the Flt-1 precursor of human<br />

origin<br />

Molecular Weight: 180kDa<br />

Positive Control: Hey cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Flt-4, Rabbit Polyclonal Antibody<br />

FFPE human angiosarcoma stained with<br />

Flt–1/ VEGFR1 Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Host Species: Rabbit<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from<br />

C-terminus of human Flt-4<br />

Molecular Weight: 150kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Focal Adhesion Kinase, see FAK<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

an-<br />

ti–Flt–1/VEG-<br />

FR1 Ab–1,<br />

WB<br />

Cat. No.<br />

RB-1527-P0<br />

RB-1527-P1<br />

RB-1527-P<br />

RB-1527-P1ABX<br />

RB-1527-PABX<br />

IVD†<br />

FFPE human placenta stained with Flt–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9255-P0<br />

RB-9255-P1<br />

RB-9255-P<br />

RB-9255-R7<br />

Follicle Stimulating Hormone (FSH) Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: FSH03<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Cow. Others not<br />

known.<br />

Immunogen: Purified human FSH-β<br />

Positive Control: Anterior pituitary<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Follicular Dendritic Cell Marker, see CD35<br />

FSH, see Follicle Stimulating Hormone<br />

Fusin, see CXCR4<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human pituitary stained with FSH<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Fyn (p59 fyn ) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1S<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: aa 26-75<br />

Immunogen: Recombinant protein corresponding to<br />

aa 1-206 of murine p59 fyn protein<br />

Molecular Weight: 59kDa<br />

Positive Control: Jurkat cells, Lymphoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Kinase Assay (Not verified)<br />

Cat. No.<br />

MS-1449-P0<br />

MS-1449-P1<br />

MS-1449-P<br />

MS-1449-R7<br />

MS-1449-PCS<br />

MS-1449-P1ABX<br />

MS-1449-PABX<br />

FFPE human lymphoma stained with Fyn<br />

Ab–1.<br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

7mL<br />

5 Slides<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

n/a<br />

n/a<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-339-R7<br />

MS-339-PCS<br />

MS-339-P0<br />

MS-339-P1<br />

MS-339-P<br />

MS-339-P1ABX<br />

MS-339-PABX<br />

USA: RUO; Int'l: RUO<br />

142<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


β -Galactosidase Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: BGAL01<br />

Isotype: IgG1<br />

Species Reactivity: Proteins from all species which are tagged with β-galactosidase.<br />

Epitope: Not determined<br />

Immunogen: E. coli β-galactosidase<br />

Molecular Weight: 116kDa<br />

Positive Control: Purified recombinant β-galactosidase protein or transfected cell lines<br />

expressing β-galactosidase-tagged proteins<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

β-galactosidase<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

• Protein purification<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Galectin-3 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 9C4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein corresponding to full-length Galectin-3<br />

Molecular Weight: 31kDa<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1329-P0<br />

MS-1329-P1<br />

MS-1329-P<br />

MS-1329-P1ABX<br />

MS-1329-PABX<br />

MS-1329-B0<br />

MS-1329-B1<br />

MS-1329-B<br />

Cat. No.<br />

MS-1756-S0<br />

MS-1756-S1<br />

MS-1756-S<br />

Gα i1 G-Protein Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: R4.5<br />

Isotype: IgG2b<br />

Species Reactivity: Human, Rat, Mouse, Cow, and Guinea Pig. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Partially purified rat brain Gαi1 protein<br />

Molecular Weight: 39-42kDa<br />

Positive Control: IMR-5 cells<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Galphai1<br />

G–Protein,<br />

WB<br />

Cat. No.<br />

MS-243-P0<br />

MS-243-P1<br />

MS-243-P<br />

MS-243-P1ABX<br />

MS-243-PABX<br />

γ Glutamylcysteine Synthetase (GCS)/Glutamate-cysteine Ligase<br />

Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Mouse and Rat, Cow (weak). Others<br />

not known.<br />

Epitope: aa 295-313<br />

Immunogen: A synthetic peptide corresponding to aa 295-313 of rat GCLC<br />

(heavy subunit of GCS)<br />

Molecular Weight: 73kDa<br />

Positive Control: Jurkat, MAD109, PC12 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–γ Glutamylcysteine<br />

Synthetase/Glutamate–cysteine<br />

Ligase<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1697-P0<br />

1mg/mL RB-1697-P1<br />

1mg/mL RB-1697-P<br />

1mg/mL RB-1697-P1ABX<br />

1mg/mL RB-1697-PABX<br />

250µg/100µL RB-1697-PCL<br />

Gastric Mucin, see Mucin 5AC<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

143


Gastrin Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Immunogen: A synthetic peptide from human gastrin<br />

Positive Control: Stomach<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin )<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human stomach stained with Gastrin<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1459-A0<br />

RB-1459-A1<br />

RB-1459-A<br />

RB-1459-R7<br />

RB-1459-PCS<br />

GCDFP-15 (Gross Cystic Disease Fluid Protein-15) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 23A3<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Immunogen: Recombinant protein encoding the<br />

excreted domain of human GCDFP-15<br />

Molecular Weight: 15kDa<br />

Positive Control: Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human skin stained with GCDFP–15<br />

Ab–1.<br />

GFAP/Glial Fibrillary Acidic Protein Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: GA-5<br />

IVD†<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Pig, Rat and Chicken. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Porcine spinal<br />

cord<br />

Molecular Weight: 51-52kDa<br />

Positive Control: IMR5 cells,<br />

Brain or astrocytoma<br />

Cellular Localization:<br />

FFPE human astrocytoma stained with GFAPan-<br />

an-<br />

ti–GFAP/Glial ti–GFAP/Glial<br />

Ab–1.<br />

Cytoplasmic<br />

Fibrillary Fibrillary<br />

Applications:<br />

Acidic Protein Acidic Protein<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Ab–1, Denatured<br />

IP<br />

Ab–1, Native<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc. Cat. No.<br />

200µg/mL MS-280-P0<br />

200µg/mL MS-280-P1<br />

200µg/mL MS-280-P<br />

n/a MS-280-R7<br />

n/a MS-280-RQ<br />

n/a MS-280-PCS<br />

250µg/100µL MS-280-PCL<br />

1mg/mL MS-280-P1ABX<br />

1mg/mL MS-280-PABX<br />

200µg/mL MS-280-B0<br />

200µg/mL MS-280-B1<br />

200µg/mL MS-280-B<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1170-S0<br />

MS-1170-S1<br />

MS-1170-S<br />

MS-1170-R7<br />

MS-1170-RQ<br />

MS-1170-PCS<br />

†USA: IVD; Int'l: IVD<br />

GCS, see Gamma Glutamylcysteine Synthetase<br />

144<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


GFAP (Glial Fibrillary Acidic Protein), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: ASTRO6<br />

Isotype: IgG1<br />

Species Reactivity: Human, Pig, Rat and<br />

Chicken. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Glial Fibrillary Acidic Protein<br />

Molecular Weight: 51-52kDa<br />

Positive Control: IMR-5 cells, Brain or<br />

astrocytoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

FFPE human brain stained with GFAP.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

IVD†<br />

anti–GFAP<br />

(Glial Fibrillary<br />

Acidic Protein),<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1376-P0<br />

200µg/mL MS-1376-P1<br />

200µg/mL MS-1376-P<br />

n/a MS-1376-R7<br />

n/a MS-1376-PCS<br />

250µg/100µL MS-1376-PCL<br />

1mg/mL MS-1376-P1ABX<br />

1mg/mL MS-1376-PABX<br />

GFAP (Glial Fibrillary Acidic Protein), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Cow, Sheep,<br />

Guinea Pig, Chicken, Mouse, Rat and Hamster. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: GFAP isolated from cow spinal cord<br />

Molecular Weight: 51-52kDa<br />

Positive Control: Brain or astrocytoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human astrocytoma stained with<br />

GFAP.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-087-A0<br />

RB-087-A1<br />

RB-087-A<br />

RB-087-R7<br />

RB-087-PCS<br />

GFAP/Ki-67, MultiVision Antibody Cocktail<br />

Host Species: GFAP — Mouse; Ki-67 — Rabbit<br />

Clone: GFAP — GA5; Ki-67 — SP6<br />

Isotype: GFAP Mouse IgG1; Ki-67 — Rabbit IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: GFAP — Not determined; Ki-67 — treminus<br />

Immunogen: GFAP — Porcine spinal cord; Ki-67 —<br />

A synthetic peptide derived from the human Ki-67<br />

protein<br />

Molecular Weight: GFAP — 51-52KDa; Ki-67 —<br />

unknown<br />

Positive Control: Some high grade astrocytomas<br />

Cellular Localization: GFAP — Cytoplasmic; Ki-67<br />

— Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

7mL<br />

IVD†<br />

FFPE human Astrocytoma stained with<br />

MV–2007–R7 using the MultiVision anti–Mouse/<br />

HRP + anti–Rabbit/ AP<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2007-R7<br />

GFP (Green Fluorescent Protein) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: GFP01; same as B34<br />

Isotype: IgG1/κ<br />

Species Reactivity: Proteins from all species that are tagged with GFP.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant GFP protein<br />

Molecular Weight: 27kDa<br />

Positive Control: Purified recombinant GFP protein, transfected cell lines expressing<br />

GFP-tagged proteins<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

GFP<br />

Applications:<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1288-P0<br />

MS-1288-P1<br />

MS-1288-P<br />

MS-1288-P1ABX<br />

MS-1288-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

145


GFP (Green Fluorescent Protein) Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: GFP02; same as C163<br />

Isotype: IgG1/κ<br />

Species Reactivity: Proteins from all species that are tagged with GFP.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant GFP protein<br />

Molecular Weight: 27kDa<br />

Positive Control: Purified recombinant GFP protein, transfected cell lines expressing<br />

GFP-tagged proteins<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

GFP<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

GGF, see Heregulin<br />

GI Tumor Marker, see CA19-9<br />

Glial Fibrillary Acidic Protein, see GFAP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Glucagon Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Shows<br />

broad reactivity in mammals.<br />

Epitope: Not determined<br />

Immunogen: Human glucagon<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1315-P0<br />

MS-1315-P1<br />

MS-1315-P<br />

MS-1315-P1ABX<br />

MS-1315-PABX<br />

FFPE human pancreas stained with<br />

Glucagon Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Glucocorticoid Receptor Interacting Protein 1, see GRIP1<br />

IVD†<br />

Cat. No.<br />

RB-1422-A0<br />

RB-1422-A1<br />

RB-1422-A<br />

RB-1422-R7<br />

RB-1422-PCS<br />

Glucose-Regulated Protein 94 (Grp94)/gp96 Ab-1, Rat Monoclonal<br />

Antibody<br />

Host Species: Rat<br />

Clone: 9G10.F8.2<br />

Isotype: IgG2a<br />

Species Reactivity: Human,<br />

Monkey, Horse, Cow, Sheep,<br />

Pig, Dog, Rabbit, Rat, Mouse,<br />

Hamster, Guinea Pig, Chicken<br />

and Xenopus. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified<br />

glucose-regulated protein 94<br />

(grp94) from chicken oviducts<br />

Molecular Weight: 94kDa<br />

Positive Control: SKBR-3 cells,<br />

Tonsil and Breast Carcinomas.<br />

Cellular Localization:<br />

Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native only)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with Grp 94<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

GLUT-1, Rabbit Polyclonal Antibody<br />

anti–Glu-<br />

anti–Glucose–Regulatcose–Regulat-<br />

ed Protein 94 ed Protein 94<br />

(Grp94)/gp96 (Grp94)/gp96<br />

Ab–1, Native Ab–1, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL RT-102-P0<br />

200µg/mL RT-102-P1<br />

200µg/mL RT-102-P<br />

1mg/mL RT-102-P1ABX<br />

1mg/mL RT-102-PABX<br />

200µg/mL RT-102-B0<br />

200µg/mL RT-102-B1<br />

200µg/mL RT-102-B<br />

n/a RT-102-R7<br />

n/a RT-102-PCS<br />

250µg/100µL RT-102-PCL<br />

Host Species: Rabbit<br />

IVD†<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat.<br />

Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived<br />

from C-terminal of human GLUT-1<br />

Molecular Weight: 55kDa, 45kDa<br />

depending on the extent of glycosylation<br />

Positive Control: Rat brain lysate; Breast<br />

CA, squamous cell CA, nonsmall-cell lung<br />

CA and esophageal CA<br />

Cellular Localization: Membrane and FFPE human squamous cell CA stained withanti–GLUT–1,<br />

GLUT–1.<br />

WB<br />

focal cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9052-P0<br />

RB-9052-P1<br />

RB-9052-P<br />

RB-9052-R7<br />

146<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


GLUT-1, Mouse Monoclonal Antibody<br />

Glycophorin A Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM498<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from<br />

C-terminal of human GLUT-1<br />

Molecular Weight: 55kDa<br />

Positive Control: Esophageal CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human esophageal CA stained with<br />

GLUT–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-10637-P0<br />

MS-10637-P1<br />

MS-10637-P<br />

MS-10637-R7<br />

Host Species: Mouse<br />

Clone: JC159<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Extracellular domain<br />

Molecular Weight: 39kDa<br />

Positive Control: Human erythrocytes in placenta<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

IVD†<br />

Cat. No.<br />

MS-1843-P0<br />

MS-1843-P1<br />

MS-1843-P<br />

MS-1843-R7<br />

MS-1843-PCS<br />

MS-1843-P1ABX<br />

MS-1843-PABX<br />

†USA: IVD; Int'l: IVD<br />

†USA: IVD; Int'l: IVD<br />

Glutamate-Cysteine Ligase, see Gamma Glutamylcysteine Synthetase<br />

GnRH Receptor/LH-RH Receptor Ab-3, Mouse Monoclonal Antibody<br />

Glutamyl Transferase, γ Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 138H11<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with pig<br />

and cow. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human kidney GGT<br />

Molecular Weight: 90kDa<br />

Positive Control: CAKi renal tumor cells, Renal cell<br />

CA or kidney<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting<br />

• Flow Cytometry<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Glutathione-S-Transferase, see GST<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Frozen human tonsil section stained with<br />

GT–&γ; Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1272-P0<br />

MS-1272-P1<br />

MS-1272-P<br />

MS-1272-P1ABX<br />

MS-1272-PABX<br />

Host Species: Mouse<br />

Clone: GNRH03; same as F1G4<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 1-29<br />

Immunogen: A synthetic peptide aa 1-29<br />

(MAN-SASPEQNQNHCSAINNSIPLMQGNLPY) from the<br />

N-terminal of human GnRH receptor<br />

Molecular Weight: 54-60kDa<br />

Positive Control: Pituitary or normal ovary<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

gp75, see Tyrosinase Related Protein 75<br />

gp96, see Glucose-Regulated Protein 94<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human pituitary stained with<br />

GnRH–Receptor Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1139-P0<br />

MS-1139-P1<br />

MS-1139-P<br />

MS-1139-P1ABX<br />

MS-1139-PABX<br />

MS-1139-R7<br />

MS-1139-PCS<br />

gp100, see Melanoma<br />

gp200, see Renal Cell Carcinoma Marker<br />

GPIb, see CD42b<br />

GPIIIa, see CD61<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

147


GPIIIb, see CD36<br />

GPI-Linked Surface Mucin, see CD24<br />

GPIV, see CD36<br />

Granulocyte (Myeloid Cell Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: BM-2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Immunogen: Nuclei from pokeweed mitogen<br />

stimulated human peripheral blood lymphocytes<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human tonsil stained with Granulocyte<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-189-P0<br />

MS-189-P1<br />

MS-189-P<br />

MS-189-R7<br />

MS-189-PCS<br />

MS-189-P1ABX<br />

MS-189-PABX<br />

Grb2/sem5/ASH Signaling Protein Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 2GB04 (C1.4)<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Mouse, Rat and<br />

Xenopus. Others not known.<br />

Epitope: aa 54-62<br />

Immunogen: Purified recombinant human Grb2 protein<br />

Molecular Weight: 24-25kDa<br />

Positive Control: HeLa cells, Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Green Fluorescent Protein, see GFP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Grb2<br />

Ab–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1457-P0<br />

MS-1457-P1<br />

MS-1457-P<br />

MS-1457-P1ABX<br />

MS-1457-PABX<br />

MS-1457-R7<br />

MS-1457-PCS<br />

GRIP1 (Glucocorticoid Receptor Interacting Protein 1), Mouse<br />

Monoclonal Antibody<br />

†USA: IVD; Int'l: IVD<br />

Granzyme B Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: GZB01<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant protein encoding the<br />

N-terminus of the mature granzyme B<br />

Molecular Weight: 32kDa<br />

Positive Control: Hodgkin's lymphoma, Tonsil<br />

Cellular Localization: Granular cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human lymphoma stained with<br />

Granzyme B Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1157-S0<br />

MS-1157-S1<br />

MS-1157-S<br />

MS-1157-R7<br />

MS-1157-RQ<br />

MS-1157-PCS<br />

Host Species: Mouse<br />

Clone: GRP01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human GRIP1 protein<br />

Molecular Weight: ~160kDa<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

• Gel Supershift (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Gross Cystic Disease Fluid Protein-15, see GCDFP-15<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1140-P0<br />

MS-1140-P1<br />

MS-1140-P<br />

MS-1140-P1ABX<br />

MS-1140-PABX<br />

148<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Growth Hormone, Human/hGH Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: GH01/#2 + GH02/#7<br />

Isotype: IgG2a/κ + IgG2a/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant human<br />

growth hormone<br />

Molecular Weight: ~22kDa<br />

Positive Control: Recombinant human<br />

growth hormone, Human anterior pituitary<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

GRP94, Rabbit Polyclonal Antibody<br />

FFPE human pituitary stained with Growth<br />

Hormone Ab–3.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

100µL<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide corresponding to<br />

C-terminal of human GRP94<br />

Molecular Weight: 94kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

anti–Growth<br />

Hormone, Human/hGH<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1328-P0<br />

200µg/mL MS-1328-P1<br />

200µg/mL MS-1328-P<br />

1mg/mL MS-1328-P1ABX<br />

1mg/mL MS-1328-PABX<br />

n/a MS-1328-R7<br />

250µg/100µL MS-1328-PCL<br />

FFPE human breast CA stained with<br />

GRP94.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-10642-P0<br />

RB-10642-P1<br />

RB-10642-P<br />

RB-10642-R7<br />

RB-10642-PCS<br />

GST (Epitope Tag) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: GST01; same as 794<br />

Isotype: IgG1<br />

Species Reactivity: Proteins from all species that are tagged with GST<br />

Immunogen: Purified recombinant GST protein<br />

Cellular Localization: Depends upon the localization of the parent protein<br />

tagged with GST<br />

Applications:<br />

• Western Blotting<br />

• Affinity Purification<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

GST, π Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified protein from the cytosol of a<br />

human chronic lymphoblastic leukaemic spleen<br />

Molecular Weight: 24-26kDa<br />

Positive Control: Bile ducts in liver<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC<br />

Positive Control for Histology<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–GST<br />

(Epitope Tagging)<br />

Ab–1,<br />

WB<br />

Cat. No.<br />

MS-707-P0<br />

MS-707-P1<br />

MS-707-P<br />

MS-707-P1ABX<br />

MS-707-PABX<br />

FFPE human liver stained with GST–π<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-050-A0<br />

RB-050-A1<br />

RB-050-A<br />

RB-050-R7<br />

RB-050-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

149


HA (Hemagglutinin) Ab-1, Rabbit Polyclonal Antibody<br />

HDJ-2/DNAJ Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Proteins displaying the YPYDVPDYA HA-tag.<br />

Epitope: aa YPYDVPDYA (HA-tag)<br />

Immunogen: Synthetic peptide of sequence CYPYDVPDYASL<br />

Positive Control: Proteins displaying the YPYDVPDYA HA-tag<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

the HA tag<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

HBVcAg, see Hepatitis B Virus Core Antigen<br />

H-CAM, see CD44 Std.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1438-P0<br />

RB-1438-P1<br />

RB-1438-P<br />

RB-1438-P1ABX<br />

RB-1438-PABX<br />

Host Species: Mouse<br />

Clone: KA2A5.6<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Monkey, Pig, Rabbit, Mouse,<br />

Rat, Hamster and Bacteria.<br />

Epitope: aa 1-179<br />

Immunogen: N-terminal<br />

purified recombinant fragment<br />

(aa 1-179) of HDJ-2 fusion<br />

protein<br />

Molecular Weight: 44-47kDa<br />

Positive Control: MAD109, Raji<br />

cells, Tonsil<br />

Cellular Localization:<br />

Cytoplasm (ground state) and<br />

Golgi complex, Nucleolus, and<br />

Nuclear membrane (upon heat<br />

shock)<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry<br />

FFPE human tonsil stained with HDJ–2<br />

Ab–1.<br />

anti–HDJ–2/<br />

DNAJ Ab–1,<br />

WB<br />

anti–HDJ–2/<br />

DNAJ Ab–1,<br />

Native IP<br />

anti–HDJ–2/<br />

DNAJ Ab–1,<br />

Denatured IP<br />

hCG, see Chorionic Gonadotropin, Human<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-225-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-225-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-225-P<br />

Ab Without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-225-P1ABX<br />

Ab Without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-225-PABX<br />

Biotinylated Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-225-B0<br />

Biotinylated Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-225-B1<br />

Biotinylated Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-225-B<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-225-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-225-PCS<br />

Positive Control Lysate<br />

100µL<br />

250µg/100µL MS-225-PCL<br />

USA: RUO; Int'l: RUO<br />

150<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Heat Shock Factor 1 (HSF1) Ab-1, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: 4B4<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: aa 425-439 of mouse<br />

HSF1<br />

Immunogen: Recombinant<br />

mouse HSF1 protein (aa 1-503)<br />

Molecular Weight: 70-85kDa<br />

(depending upon the source and<br />

state of cells)<br />

Positive Control: LS174T or<br />

MAD109 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Heat<br />

Shock Factor<br />

1 (HSF1)<br />

Ab–1, Native<br />

IP<br />

anti–Heat Shock Factor 1 (HSF1) Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RT-405-P0<br />

200µg/mL RT-405-P1<br />

200µg/mL RT-405-P<br />

1mg/mL RT-405-P1ABX<br />

1mg/mL RT-405-PABX<br />

250µg/100µL RT-405-PCL<br />

Heat Shock Factor 1 (HSF1) Ab-4, Rat Monoclonal Antibody<br />

Heat Shock Protein 27 (HSP27) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: G3.1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Chimpanzee<br />

and Monkey. Does not react with mouse<br />

and rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Partially purified HSP27<br />

(earlier called 24K) protein from breast<br />

cancer MCF-7 cells<br />

Molecular Weight: 24-27kDa<br />

Positive Control: BT474 or MDA-MB-453<br />

cells, Breast CA<br />

Cellular Localization: Cytoplasmic/nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast CA stained with Heat<br />

Shock Protein 27 Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Heat<br />

Shock Protein<br />

27 (HSP27)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-101-P0<br />

200µg/mL MS-101-P1<br />

200µg/mL MS-101-P<br />

1mg/mL MS-101-P1ABX<br />

1mg/mL MS-101-PABX<br />

200µg/mL MS-101-B0<br />

200µg/mL MS-101-B1<br />

200µg/mL MS-101-B<br />

n/a MS-101-R7<br />

n/a MS-101-PCS<br />

250µg/100µL MS-101-PCL<br />

Host Species: Rat<br />

Clone: 4B4 + 10H4 + 10H8<br />

Isotype: IgG1 + IgG1 + IgG1<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not known.<br />

Epitope: aa 288-439<br />

Immunogen: Recombinant mouse HSF1<br />

protein (aa 1-503)<br />

Molecular Weight: 70-85kDa (depending<br />

upon the source and state of cells)<br />

Positive Control: LS174T cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Gel Supershift<br />

FFPE human breast CA stained with Heat<br />

Shock Factor 1 Ab–4.<br />

anti–Heat<br />

Shock Factor<br />

1 (HSF1)<br />

Ab–4, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RT-629-P0<br />

200µg/mL RT-629-P1<br />

200µg/mL RT-629-P<br />

1mg/mL RT-629-P1ABX<br />

1mg/mL RT-629-PABX<br />

n/a RT-629-R7<br />

n/a RT-629-PCS<br />

250µg/100µL RT-629-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

151


Heat Shock Protein 60 (HSP60) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LK1<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse, Rat, Hamster and<br />

Chicken. Does not react with<br />

bacteria, helminths and<br />

spinach. Others not known.<br />

Epitope: aa 383-447<br />

Immunogen: Recombinant<br />

HSP60 protein<br />

FFPE human breast CA stained with Heat<br />

Molecular Weight: 60kDa Shock Protein 60 Ab–1.<br />

Positive Control: BT474 or<br />

MAD109 cells, Breast CA<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Heat anti–Heat<br />

Shock Protein Shock Protein<br />

60 (HSP60)<br />

Ab–1, WB<br />

60 (HSP60)<br />

Ab–1, Native<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-120-P0<br />

200µg/mL MS-120-P1<br />

200µg/mL MS-120-P<br />

1mg/mL MS-120-P1ABX<br />

1mg/mL MS-120-PABX<br />

200µg/mL MS-120-B0<br />

200µg/mL MS-120-B1<br />

200µg/mL MS-120-B<br />

n/a MS-120-R7<br />

n/a MS-120-PCS<br />

250µg/100µL MS-120-PCL<br />

Heat Shock Protein 70 (HSP70) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: W27<br />

Isotype: IgG2a<br />

Species Reactivity: Human,<br />

Monkey and Cow. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: HSP70 protein<br />

from HeLa cells<br />

Molecular Weight: 73kDa<br />

(constitutive), 72kDa (inducible)<br />

Positive Control: BT474 or<br />

HeLa cells, Breast CA<br />

Cellular Localization: Nuclear<br />

and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast CA stained with Heat<br />

Shock Protein 70 Ab–2.<br />

anti–Heat<br />

Shock Protein<br />

70 (HSP70)<br />

Ab–2, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Heat anti–Heat<br />

Shock Protein Shock Protein<br />

70 (HSP70) 70 (HSP70)<br />

Ab–2, Denatured<br />

Ab–2, Native<br />

IP<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-482-P0<br />

200µg/mL MS-482-P1<br />

200µg/mL MS-482-P<br />

1mg/mL MS-482-P1ABX<br />

1mg/mL MS-482-PABX<br />

200µg/mL MS-482-B0<br />

200µg/mL MS-482-B1<br />

200µg/mL MS-482-B<br />

n/a MS-482-R7<br />

n/a MS-482-PCS<br />

250µg/100µL MS-482-PCL<br />

152<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Heat Shock Protein 90α /hsp90α (HSP86) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: aa 2-12<br />

Immunogen: A synthetic<br />

11-mer peptide, corresponding<br />

to aa 2-12<br />

(PEETQTQDQPM-Cys) from the<br />

N-terminus end of mouse heat FFPE human breast CA stained with Heat<br />

shock protein 90α (hsp90α) Shock Protein 90α Ab–1.<br />

Molecular Weight: 86kDa<br />

Positive Control: LS174T cells,<br />

MAD109 cells or breast CA<br />

Cellular Localization:<br />

Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Heat anti–Heat<br />

Shock Protein Shock Protein<br />

90al-<br />

90alpha/hsp90alpha/hsp90alpha<br />

(HSP86)<br />

Ab–1, WB<br />

pha (HSP86)<br />

Ab–1, Native<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-119-P0<br />

1mg/mL RB-119-P1<br />

1mg/mL RB-119-P<br />

1mg/mL RB-119-P1ABX<br />

1mg/mL RB-119-PABX<br />

n/a RB-119-R7<br />

n/a RB-119-PCS<br />

250µg/100µL RB-119-PCL<br />

Heat Shock Protein 90β /hsp90β (HSP84) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: aa 2-13<br />

Immunogen: A synthetic peptide corresponding to aa 2-13<br />

(PEEVHHGEEEVE-Cys) from the N-terminus of mouse heat shock<br />

protein 90β<br />

Molecular Weight: 84kDa<br />

Positive Control: MAD109 cells or breast CA<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Heat anti–Heat<br />

Shock Protein Shock Protein<br />

90beta/hsp90beta<br />

90beta/hsp90beta<br />

(HSP84)<br />

Ab–1, WB<br />

(HSP84)<br />

Ab–1, Native<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-118-P0<br />

1mg/mL RB-118-P1<br />

1mg/mL RB-118-P<br />

1mg/mL RB-118-P1ABX<br />

1mg/mL RB-118-PABX<br />

250µg/100µL RB-118-PCL<br />

Helicobacter pylori Antigen, Recombinant Protein<br />

Source: Helicobacter pylori antigen purified from whole H. pylori cell sonicates<br />

Characterization: H. pylori antibody reactive.<br />

Format<br />

Ab without BSA/Azide (Frozen)<br />

Ab wthout BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

50µL<br />

100µL<br />

Conc.<br />

100µg/mL<br />

100µg/mL<br />

Helicobacter pylori, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Helicobacter pylori<br />

Epitope: Not determined<br />

Immunogen: Purified Helicobacter pylori<br />

Positive Control: Helicobacter pylori infected tissue<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Cat. No.<br />

RP-9326-P1ABX<br />

RP-9326-PABX<br />

IVD†<br />

FFPE human stomach stained with anti –Helicobacter<br />

pylori<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Helicobacter pylori Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Helicobacter pylori<br />

Epitope: Not determined<br />

Immunogen: Total lyaste of Helicobacter pylori<br />

Positive Control: Helicobacter pylori infected tissue<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Hemagglutinin, see HA<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

Cat. No.<br />

RB-9070-P0<br />

RB-9070-P1<br />

RB-9070-P<br />

RB-9070-R7<br />

RB-9070-RQ<br />

FFPE human stomach stained with Helicobacter<br />

pylori Ab–1.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

RB-1875-P0<br />

RB-1875-P1<br />

RB-1875-P<br />

RB-1875-P1ABX<br />

RB-1875-PABX<br />

RB-1875-R7<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

153


Heparan Sulfate Proteoglycan/Perlecan Ab-1, Rat Monoclonal<br />

Antibody<br />

Hepatitis B Virus Surface Antigen (HBVsAg) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: A7L6<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Cow, Pig, Mouse. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Murine EHS laminin preparation<br />

Molecular Weight: High<br />

Positive Control: Tonsil<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen and<br />

acid-alcohol-fixed, paraffin-embedded)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Frozen human tonsil stained with Heparan<br />

Sulfate Proteoglycan Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

RT-794-P0<br />

RT-794-P1<br />

RT-794-P<br />

RT-794-P1ABX<br />

RT-794-PABX<br />

RT-794-B0<br />

RT-794-B1<br />

RT-794-B<br />

Host Species: Mouse<br />

Clone: T9; same as 3E7<br />

Isotype: IgG1/λ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified HBVsAg, subtype ayw3<br />

Positive Control: Hepatitis B virus infected liver<br />

Cellular Localization: Cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: ASR; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human infected liver stained with HB-<br />

VsAg Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Hepatocyte Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-314-S0<br />

MS-314-S1<br />

MS-314-S<br />

MS-314-R7<br />

MS-314-RQ<br />

USA: RUO; Int'l: RUO<br />

Hepatitis B Virus Core Antigen (HBVcAg) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Hepatitis B virus<br />

Positive Control: Hepatitis B virus infected liver<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: ASR; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human infected liver stained with<br />

HBVcAg Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1413-A0<br />

RB-1413-A1<br />

RB-1413-A<br />

RB-1413-R7<br />

Host Species: Mouse<br />

Clone: OCH1E5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Formalin-fixed failed human allograft<br />

liver that was mechanically disrupted<br />

Positive Control: Liver CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human liver stained with Hepatocyte<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1810-S0<br />

MS-1810-S1<br />

MS-1810-S<br />

MS-1810-R7<br />

MS-1810-RQ<br />

MS-1810-PCS<br />

154<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Hepatocyte Growth Factor Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4C12.1<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human HGF protein<br />

Molecular Weight: ~82kDa<br />

Applications:<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-651-P0<br />

MS-651-P1<br />

MS-651-P<br />

MS-651-P1ABX<br />

MS-651-PABX<br />

Hepatocyte Growth Factor Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SBF5<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human HGF protein<br />

Molecular Weight: ~82kDa<br />

Applications:<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

HER-2/c-erB-2/neu, Rabbit Monoclonal Antibody<br />

Cat. No.<br />

MS-775-P0<br />

MS-775-P1<br />

MS-775-P<br />

MS-775-P1ABX<br />

MS-775-PABX<br />

HER-2/c-erbB-2/neu, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Rat and Mouse. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from C-terminus of human HER-2 protein.<br />

This sequence is identical in rat neu protein.<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR3 cells<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

anti–HER–2/c–<br />

erbB–2/neu,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

HER-2/c-erbB-2/neu Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Monkey, Rat<br />

and Mouse. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide derived<br />

from C-terminus of human HER-2/c-erbB-2<br />

protein. This sequence is identical in rat<br />

neu protein.<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells, or T47D<br />

cells, or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

FFPE human breast CA stained with HER–2<br />

Ab–1.<br />

Cat. No.<br />

RB-9040-P0<br />

RB-9040-P1<br />

RB-9040-P<br />

anti–HER–2/c–<br />

erbB–2/neu<br />

Ab–1, Denatured<br />

IP<br />

Host Species: Rabbit<br />

Clone: SP3<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Recombinant protein encoding<br />

extracellular domain of human HER-2<br />

Molecular Weight: 185kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD† RabbitMAb<br />

FFPE Breast CA stained wtih Her 2<br />

Conc. Cat. No.<br />

n/a RM-9103-S0<br />

n/a RM-9103-S1<br />

n/a RM-9103-S<br />

n/a RM-9103-R7<br />

n/a RM-9103-RQ<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control dor IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–HER–2/c– erbB–2/neu Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-103-P0<br />

1mg/mL RB-103-P1<br />

1mg/mL RB-103-P<br />

1mg/mL RB-103-P1ABX<br />

1mg/mL RB-103-PABX<br />

n/a RB-103-PCS<br />

250µg/100µL RB-103-PCL<br />

†USA: ASR; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

155


HER-2/c-erbB-2/neu Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 9G6.10<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with<br />

mouse and rat. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: RAC311 cells transfected with SV40-neu<br />

construct, expressing human neu protein<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells, or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only) Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• Inhibits Colony Formation<br />

• Partially Inhibits Tyrosine Kinase Activity<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Paraformaldehyde–fixed, human colon CA<br />

cells stained with HER–2 Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

HER-2/c-erbB-2/neu Ab-4, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-229-P0<br />

MS-229-P1<br />

MS-229-P<br />

MS-229-P1ABX<br />

MS-229-PABX<br />

Host Species: Mouse<br />

Clone: N12<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Intact SKBR-3 breast cancer cells<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells, or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not suitable)<br />

• Inhibits Tumor Growth (~90%)<br />

• Inhibits Cell Proliferation<br />

• Effect on HER-2 Internalization (Moderate)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-301-P0<br />

MS-301-P1<br />

MS-301-P<br />

MS-301-P1ABX<br />

MS-301-PABX<br />

MS-301-B0<br />

MS-301-B1<br />

MS-301-B<br />

HER-2/c-erbB-2/neu Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: N24<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Intact SKBR-3 breast cancer cells<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells, or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Accelerates (~50%) HER-2 Internalization<br />

• Inhibits (~80%) Tumorigenic Cell Growth<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

HER-2/c-erbB-2/neu Ab-6, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-302-P0<br />

MS-302-P1<br />

MS-302-P<br />

MS-302-P1ABX<br />

MS-302-PABX<br />

Host Species: Mouse<br />

Clone: N28<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Intact SKBR-3 breast cancer cells<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation (Native and denatured)<br />

• Stimulates (10-fold) Tyrosine Kinase Activity<br />

• Effect on Tumor Growth (~40% stimulatory)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-307-P0<br />

MS-307-P1<br />

MS-307-P<br />

MS-307-P1ABX<br />

MS-307-PABX<br />

156<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


HER-2/c-erbB-2/neu Ab-8, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: e2-4001<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

tested.<br />

Epitope: Cytoplasmic domain<br />

Immunogen: Cytoplasmic<br />

domain of recombinant human<br />

HER-2/c-erbB-2 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells,<br />

or T47D cells, or Breast CA<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunoprecipitation (Native and Denatured)<br />

FFPE human breast CA stained with HER–2<br />

Ab–8.<br />

anti–HER–2/c–<br />

erbB–2/neu<br />

Ab–8, WB<br />

anti–HER–2/c–<br />

erbB–2/neu<br />

Ab–8, Denatured<br />

IP<br />

HER-2/c-erbB-2/neu5 Ab-15, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3B5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey,<br />

Mouse and Rat. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide from the<br />

C-terminus of human HER-2 protein. This<br />

sequence is identical in rat neu protein.<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 or MAD109 cells, anti–HER–2/cti–HER–2/c–<br />

an-<br />

or Breast CA<br />

Cellular Localization: Membrane<br />

erbB–2/neu5 erbB–2/neu5<br />

Ab–15, Native Ab–15, Denatured<br />

IP<br />

Applications:<br />

IP<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunoprecipitation (Native and<br />

Denatured)<br />

Format<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc. Cat. No.<br />

200µg/mL MS-325-B0<br />

200µg/mL MS-325-B1<br />

200µg/mL MS-325-B<br />

n/a MS-325-PCS<br />

250µg/100µL MS-325-PCL<br />

200µg/mL MS-325-P0<br />

200µg/mL MS-325-P1<br />

200µg/mL MS-325-P<br />

1mg/mL MS-325-P1ABX<br />

1mg/mL MS-325-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

anti–HER–2/c– erbB–2/neu5 Ab–15, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-599-P0<br />

200µg/mL MS-599-P1<br />

200µg/mL MS-599-P<br />

1mg/mL MS-599-P1ABX<br />

1mg/mL MS-599-PABX<br />

200µg/mL MS-599-B0<br />

200µg/mL MS-599-B1<br />

200µg/mL MS-599-B<br />

n/a MS-599-PCS<br />

250µg/100µL MS-599-PCL<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

157


HER-2/c-erbB-2/neu Ab-16, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: L26<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Involved in the formation of heterodimers<br />

Immunogen: Extracellular domain of recombinant human HER-2/c-erbB-2 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation (Native only)<br />

• Inhibits Binding of EGF (~70%), NDF (~40%)<br />

• Reduces Affinity of EGF (3-fold) and NDF (2-fold)<br />

Format<br />

Purified Ab with BSA<br />

Purified Ab with BSA<br />

Purified Ab with BSA<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

HER-2/c-erbB-2/neu Ab-17, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-600-P0A<br />

MS-600-P1A<br />

MS-600-PA<br />

MS-600-P1ABX<br />

MS-600-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-730-P0<br />

200µg/mL MS-730-P1<br />

200µg/mL MS-730-P<br />

n/a MS-730-R7<br />

n/a MS-730-PCS<br />

1mg/mL MS-730-P1ABX<br />

1mg/mL MS-730-PABX<br />

250µg/100µL MS-730-PCL<br />

HER-2/c-erbB-2/neu (Phospho-specific) Ab-18, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: PN2A<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: aa 1242-1255 with pTyr<br />

Immunogen: Tyrosine-phosphorylated synthetic peptide corresponding to aa 1242-1255<br />

[Lys-TAENPE-pY-LGLDVPV] from the C-terminus of human HER-2 protein (P-Tyr1248)<br />

Molecular Weight: 185kDa<br />

Positive Control: EGF-treated SKBR-3 cells. About 5% of breast CA are positive for<br />

phospho-HER-2/c-erbB-2/neu oncoprotein.<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not verified)<br />

• Flow Cytometry (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

HER-2/c-erbB-2/neu Ab-20, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: L87 + 2ERB19<br />

Isotype: IgG1 (L87); IgG1 (2ERB19)<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular domain of recombinant human HER-2<br />

oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: SKBR-3 cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Extracellular)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Cat. No.<br />

MS-1072-P0<br />

MS-1072-P1<br />

MS-1072-P<br />

MS-1072-P1ABX<br />

MS-1072-PABX<br />

MS-1072-B0<br />

MS-1072-B1<br />

MS-1072-B<br />

Host Species: Mouse<br />

IVD†<br />

Clone: e2-4001 + 3B5<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Cytoplasmic<br />

Immunogen: Cytoplasmic domain of<br />

recombinant human HER-2/c-erbB-2<br />

oncoprotein (e2-4001) and a synthetic<br />

peptide from the C-terminus of human<br />

HER-2 protein (3B5)<br />

Molecular Weight: 185kDa<br />

Positive Control: LS174T cells, or Breast FFPE human breast carcinoma stained withan-<br />

ti–HER–2/c–<br />

HER–2 Ab–17.<br />

CA<br />

erbB–2/neu<br />

Cellular Localization: Membrane<br />

Ab–17, WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (For cytoplasmic)<br />

anti–HER–2/c–<br />

erbB–2/neu<br />

Ab–20, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1350-P0<br />

200µg/mL MS-1350-P1<br />

200µg/mL MS-1350-P<br />

1mg/mL MS-1350-P1ABX<br />

1mg/mL MS-1350-PABX<br />

250µg/100µL MS-1350-PCL<br />

158<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


HER-2/c-erbB-2/neu, Rabbit Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP1045Y<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: A synthetic peptide corresponding to the<br />

c-terminus of human Her2<br />

Molecular Weight: 185kDa<br />

Positive Control: Breast carcinomas<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE Breast CA stained with rabbit monoclonal<br />

anti–HER–2.<br />

Host Species: Mouse<br />

Clone: 2F12<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Cow, Rat and Mouse. Others not tested.<br />

Epitope: aa 1295-1323<br />

Immunogen: Recombinant rat HER-3/c-erbB-3 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D cells<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

anti–HER–3/c–<br />

erbB–3<br />

Ab–2, WB<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RM-2112-R7<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-201-P0<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

RM-2112-RQ<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-201-P1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

RM-2112-S<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-201-P<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

RM-2112-S0<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-201-P1ABX<br />

†USA: ASR; Int'l: IVD<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

200µL<br />

100µL<br />

1mg/mL MS-201-PABX<br />

250µg/100µL MS-201-PCL<br />

HER-3/c-erbB-3, Rabbit Polyclonal Antibody<br />

USA: RUO; Int'l: RUO<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide from N-terminus of<br />

human HER-3 protein<br />

Molecular Weight: 185kDa<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC<br />

Positive Control for Histology<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human heart muscle stained with<br />

HER–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-9211-P0<br />

RB-9211-P1<br />

RB-9211-P<br />

RB-9211-R7<br />

RB-9211-PCS<br />

HER-3/c-erbB-3 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: H3.90.6; same as Ab90<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular fragment of recombinant human HER-3/c-erbB-3 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D cells<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• Effect on Heregulin (NDF) Binding (Noninhibitory)<br />

• Effect on Tumor Growth (Noninhibitory)<br />

Format<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-262-B0<br />

MS-262-B1<br />

MS-262-B<br />

MS-262-P0<br />

MS-262-P1<br />

MS-262-P<br />

MS-262-P1ABX<br />

MS-262-PABX<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

159


HER-3/c-erbB-3 Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: H3.105.5; same as Ab105<br />

Isotype: IgG1<br />

Species Reactivity: Human and Mouse. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular domain of recombinant human HER-3/c-erbB-3 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• Inhibits Heregulin (NDF) Binding<br />

• Effect on Tumor Growth (Noninhibitory)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

c-erbB-3/HER-3 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2B5<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Rat, Mouse. Others not tested.<br />

Epitope: aa 1234-1259<br />

Immunogen: Recombinant rat<br />

HER-3/c-erbB-3 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D or<br />

MAD109 cells<br />

anti–HER–3/c–<br />

anti–HER–3/c– erbB–3 Ab–6, WB<br />

Cellular Localization:<br />

Cytoplasmic and membrane erbB–3 Ab–6,<br />

Denatured IP<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Cat. No.<br />

MS-303-P0<br />

MS-303-P1<br />

MS-303-P<br />

MS-303-P1ABX<br />

MS-303-PABX<br />

Conc. Cat. No.<br />

200µg/mL MS-310-P0<br />

200µg/mL MS-310-P1<br />

200µg/mL MS-310-P<br />

1mg/mL MS-310-P1ABX<br />

1mg/mL MS-310-PABX<br />

200µg/mL MS-310-B0<br />

200µg/mL MS-310-B1<br />

200µg/mL MS-310-B<br />

250µg/100µL MS-310-PCL<br />

HER-3/c-erbB-3 Ab-7, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2C3<br />

Isotype: IgG1<br />

Species Reactivity: Human, Rat<br />

and Mouse. Others not tested.<br />

Epitope: aa 1234-1259<br />

Immunogen: Recombinant rat<br />

HER-3/c-erbB-3 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D, SKBR3<br />

or MAD109 cells<br />

anti–HER–3/c–<br />

anti–HER–3/c– erbB–3 Ab–7, WB<br />

Cellular Localization:<br />

Cytoplasmic and membrane erbB–3 Ab–7,<br />

Denatured IP<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

HER-3/c-erbB-3 Ab-8, Mouse Monoclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL MS-313-P0<br />

200µg/mL MS-313-P1<br />

200µg/mL MS-313-P<br />

1mg/mL MS-313-P1ABX<br />

1mg/mL MS-313-PABX<br />

250µg/100µL MS-313-PCL<br />

Host Species: Mouse<br />

Clone: SGP1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: HER-3/c-erbB-3 oncoprotein purified from transfected human kidney<br />

fibroblasts<br />

Molecular Weight: 185kDa<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Flow Cytometry<br />

• Effect on Heregulin (NDF) Binding (Noninhibitory)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-725-P0<br />

MS-725-P1<br />

MS-725-P<br />

MS-725-P1ABX<br />

MS-725-PABX<br />

160<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


HER-4/c-erbB-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse.<br />

Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from<br />

C-terminus of human HER-4 protein<br />

Molecular Weight: 185kDa<br />

Positive Control: Breast CA T47D cells<br />

Cellular Localization: Cytoplasmic and<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast CA stained with HER–4. anti–HER–4/c–<br />

erbB–4, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

HER-4/c-erbB-4 Ab-1, Mouse Monoclonal Antibody<br />

Conc. Cat. No.<br />

200µg/mL RB-9045-P0<br />

200µg/mL RB-9045-P1<br />

200µg/mL RB-9045-P<br />

n/a RB-9045-R7<br />

250µg/100µL RB-9045-PCL<br />

Host Species: Mouse<br />

Clone: H4.77.16; same as Ab77<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular fragment of recombinant human HER-4/c-erbB-4 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D or MDA-MB-453 cells<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• Accelerates Internalization of HER-1<br />

• Stimulates Tyrosine Kinase Activity<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-270-P0<br />

MS-270-P1<br />

MS-270-P<br />

MS-270-P1ABX<br />

MS-270-PABX<br />

MS-270-B0<br />

MS-270-B1<br />

MS-270-B<br />

HER-4/c-erbB-4 Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Rat and Mouse. Others not tested.<br />

Epitope: aa 1285-1308<br />

Immunogen: A synthetic peptide (aa 1285-1308) from the C-terminus of human<br />

HER-4/c-erbB-4 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D or MDA-MB-453 cells<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

HER-4/c-erbB-4 Ab-3, Mouse Monoclonal Antibody<br />

Cat. No.<br />

RB-284-P0<br />

RB-284-P1<br />

RB-284-P<br />

RB-284-P1ABX<br />

RB-284-PABX<br />

Host Species: Mouse<br />

Clone: H4.72.8; same as Ab72<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Extracellular domain<br />

Immunogen: Extracellular domain of recombinant human HER-4/c-erbB-4 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: T47D or MDA-MB-453 cells<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Flow Cytometry<br />

• Inhibits Heregulin (NDF) Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-304-P0<br />

MS-304-P1<br />

MS-304-P<br />

MS-304-P1ABX<br />

MS-304-PABX<br />

MS-304-B0<br />

MS-304-B1<br />

MS-304-B<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

161


HER-4/c-erbB-4, Mouse Monoclonal Antibody<br />

Heregulin/NDF/GGF/Neuregulin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HFR-1<br />

Isotype: IgG2b<br />

Species Reactivity: Human and Mouse. Others not tested.<br />

Epitope: aa 1249-1264<br />

Immunogen: A synthetic peptide corresponding to aa 1249-1264<br />

(Cys-RSTLQHPDYLQEYST) from the human HER-4/c-erbB-4 oncoprotein<br />

Molecular Weight: 185kDa<br />

Positive Control: Breast CA or Skeletal muscle<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-637-P0<br />

MS-637-P1<br />

MS-637-P<br />

MS-637-P1ABX<br />

MS-637-PABX<br />

Host Species: Mouse<br />

Clone: 7D5<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Rat and<br />

Mouse.<br />

Epitope: Extracellular<br />

Immunogen: Recombinant extracellular<br />

domain of rat NDF protein<br />

Molecular Weight: 44kDa<br />

Positive Control: HRGα1 or HRGβ1<br />

recombinant protein, Prostate CA<br />

Cellular Localization: Cytoplasmic and<br />

intercellular spaces<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

FFPE human prostate CA stained with<br />

Heregulin Ab–1.<br />

USA: RUO; Int'l: RUO<br />

Heregulin β1 (HRGβ1), Recombinant Protein<br />

Species Reactivity: Human, Mouse<br />

Positive Control: T47-D breast cancer cells<br />

Formula Weight: 44kDa (full length) and 30kDa (extracellular domain)<br />

Applications:<br />

• Cell Proliferation and Differentiation<br />

• Stimulation of Tyrosine Kinase Activity of erbs<br />

• Western Blotting (As a positive control)<br />

Format<br />

Purified RP with BSA<br />

Purified RP with BSA<br />

Purified RP with BSA<br />

Purified RP with BSA<br />

Purified RP with BSA<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

50µL<br />

100µL<br />

Conc.<br />

10µg/mL<br />

10µg/mL<br />

10µg/mL<br />

100µg/mL<br />

100µg/mL<br />

Cat. No.<br />

RP-318-P0A<br />

RP-318-P1A<br />

RP-318-PA<br />

RP-318-P1AX<br />

RP-318-PAX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Heregulin/NDF/GGF/ Neuregulin Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-272-P0<br />

200µg/mL MS-272-P1<br />

200µg/mL MS-272-P<br />

1mg/mL MS-272-P1ABX<br />

1mg/mL MS-272-PABX<br />

200µg/mL MS-272-B0<br />

200µg/mL MS-272-B1<br />

200µg/mL MS-272-B<br />

n/a MS-272-R7<br />

n/a MS-272-PCS<br />

250µg/100µL MS-272-PCL<br />

Heregulin α1 (HRGα1), Recombinant Protein<br />

Species Reactivity: Human and Mouse<br />

Positive Control: T47-D breast cancer cells<br />

Formula Weight: 44kDa (full length) and 30kDa (extracellular domain)<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified RP with BSA<br />

100µL<br />

50µg/mL<br />

RP-317-P0A<br />

Purified RP with BSA<br />

500µL<br />

50µg/mL<br />

RP-317-P1A<br />

Purified RP with BSA<br />

1mL<br />

50µg/mL<br />

RP-317-PA<br />

Purified RP with BSA<br />

250µL<br />

100µg/mL<br />

RP-317-P1AX<br />

Purified RP with BSA<br />

500µL<br />

100µg/mL<br />

RP-317-PAX<br />

USA: RUO; Int'l: RUO<br />

162<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Heregulin/NDF/GGF/Neuregulin Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: EGF-like domain<br />

Immunogen: A highly antigenic synthetic peptide from the EGF-like domain<br />

of human heregulin<br />

Molecular Weight: 44kDa<br />

Positive Control: HRGβ1 recombinant protein or LS174T cells<br />

Cellular Localization: Cytoplasmic and intercellular spaces<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

anti–Heregulin/NDF/GGF/<br />

• Western Blotting<br />

• Biological Blockade<br />

Neuregulin<br />

Ab–2, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-276-P0<br />

1mg/mL RB-276-P1<br />

1mg/mL RB-276-P<br />

1mg/mL RB-276-P1ABX<br />

1mg/mL RB-276-PABX<br />

1mg/mL RB-276-B0<br />

1mg/mL RB-276-B1<br />

1mg/mL RB-276-B<br />

250µg/100µL RB-276-PCL<br />

Herpes Simplex Virus Type 2 (HSV II) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Herpes Simplex Virus infected<br />

tissues and cells.<br />

Epitope: Not determined<br />

Immunogen: Detergent-solubilized Herpes Simplex<br />

Virus (HSV) type 2 (strain MS) infected whole rabbit<br />

cornea cells<br />

Positive Control: Herpes Simplex Virus infected cells<br />

or tissues<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human infected liver stained with HSV<br />

II Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1426-A0<br />

RB-1426-A1<br />

RB-1426-A<br />

RB-1426-R7<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: OZ12<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 530-826<br />

Immunogen: hHIF-1α (aa 530-826) protein<br />

Molecular Weight: 120kDa<br />

Positive Control: Mammalian cells cultured under reduced O 2 tension<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-701-P0<br />

MS-701-P1<br />

MS-701-P<br />

MS-701-P1ABX<br />

MS-701-PABX<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: H1α67<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human, Sheep, Mouse, Rat and Ferret. Others not known.<br />

Epitope: aa 432-528<br />

Immunogen: Recombinant hHIF-1α (aa 432-528) protein<br />

Molecular Weight: 120kDa<br />

Positive Control: Mammalian cells cultured under reduced O 2 tension<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunoprecipitation (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1164-P0<br />

MS-1164-P1<br />

MS-1164-P<br />

MS-1164-P1ABX<br />

MS-1164-PABX<br />

†USA: ASR; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

163


Histone H1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1415-1<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Nuclei of myeloid leukemia biopsy cells<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

FFPE human tonsil stained with Histone H1<br />

Ab–1.<br />

Human Papilloma Virus (HPV) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

IVD†<br />

Clone: K1H8<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human Papilloma Virus type 6, 11, 16, 18, 31, 33, 42, 51, 52, 56<br />

and 58.<br />

Epitope: Nonconfirmational internal linear epitope of major capsid protein<br />

Immunogen: Alkaline disrupted HPV type 1<br />

Molecular Weight: 57kDa (major band)<br />

Positive Control: Infected cells and tissue<br />

Cellular Localization: Nuclei of infected cells<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-628-P0<br />

MS-628-P1<br />

MS-628-P<br />

MS-628-P1ABX<br />

MS-628-PABX<br />

MS-628-R7<br />

MS-628-PCS<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1826-S0<br />

MS-1826-S1<br />

MS-1826-S<br />

MS-1826-R7<br />

MS-1826-RQ<br />

USA: RUO; Int'l: RUO<br />

HLA, see MHC<br />

HMFG1, see Milk Fat Globule<br />

hNIS, see Human Sodium Iodide Symporter<br />

hPL, see Placental Lactogen<br />

HPV, see Human Papilloma Virus<br />

Human Papilloma Virus Type 16-E7 (HPV 16-E7) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TVG701Y<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Type 16 of human Papilloma Virus (HPV-16).<br />

Immunogen: Recombinant HPV-16 E7 protein<br />

Molecular Weight: 15kDa<br />

Positive Control: Cervical tissue infected with HPV-16<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

HPV 16-E7, see Human Papilloma Virus Type 16-E7<br />

HSF1, see Heat Shock Factor 1<br />

HSF2, see Heat Shock Factor 2<br />

HSP27, see Heat Shock Protein 27<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-768-P0<br />

MS-768-P1<br />

MS-768-P<br />

MS-768-P1ABX<br />

MS-768-PABX<br />

HSP60, see Heat Shock Protein 60<br />

hGH, see Growth Hormone, Human<br />

HSP70, see Heat Shock Protein 70<br />

HUMSTR, see CXCR4<br />

HSP84, see Heat Shock Protein 90β<br />

HVEM, see TR2<br />

HSP86, see Heat Shock Protein 90α<br />

Hypoxia-Inducible Factor-1α, see HIF-1α<br />

hsp90α, see Heat Shock Protein 90α<br />

hsp90β, see Heat Shock Protein 90β<br />

HSV II, see Herpes Simplex Virus Type 2<br />

164<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Human Sodium Iodide Symporter (hNIS) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: FP5A<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with<br />

mouse and rat. Others not tested.<br />

Epitope: aa 625-643<br />

Immunogen: A synthetic peptide corresponding to aa<br />

625-643 of hNIS protein<br />

Molecular Weight: 97kDa<br />

Positive Control: Thyroid<br />

Cellular Localization: Membrane and cytoplasm<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

IFN-α (II), see Interferon-α (II)<br />

ICAM-1, see CD54<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human thyroid gland stained with<br />

Sodium Iodide Symporter Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

IgA (α -Heavy Chain) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: GA01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Third constant domain (CH3) of the α-chain<br />

of IgA<br />

Immunogen: Purified human α-heavy chain<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Cat. No.<br />

MS-1653-P0<br />

MS-1653-P1<br />

MS-1653-P<br />

MS-1653-P1ABX<br />

MS-1653-PABX<br />

MS-1653-R7<br />

MS-1653-PCS<br />

FFPE human tonsil stained with IgA Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1008-P0<br />

MS-1008-P1<br />

MS-1008-P<br />

MS-1008-P1ABX<br />

MS-1008-PABX<br />

IgA (α -Heavy Chain) Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: IgA isolated from a pool of normal human<br />

sera<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

IgA, FITC Labeled Antibody<br />

Quantity<br />

7mL<br />

5 Slides<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE human tonsil stained with IgA Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1433-R7<br />

RB-1433-PCS<br />

RB-1433-A0<br />

RB-1433-A1<br />

RB-1433-A<br />

Host Species: Sheep<br />

Species Reactivity: Recognizes the α-chain of human IgA. Cross-reactivity seen with<br />

bovine, mouse and rat serum.<br />

Immunogen: IgA isolated from human serum<br />

Positive Control: Normal tonsil fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Aggregates found in tonsil, lymph node and spleen<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

IgD (δ -Heavy Chain) Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: IgD isolated from a pool of normal human<br />

sera<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

SH-1920-R2<br />

IVD†<br />

FFPE human tonsil stained with IgD Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1436-A0<br />

RB-1436-A1<br />

RB-1436-A<br />

RB-1436-R7<br />

RB-1436-PCS<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

165


IgE (ε -Heavy Chain), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Clone: Polyclonal<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: IgE isolated from a pool of normal human<br />

sera<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with IgE Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

IGF-1R (α -Subunit) Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

RB-1435-A0<br />

RB-1435-A1<br />

RB-1435-A<br />

RB-1435-R7<br />

RB-1435-PCS<br />

Host Species: Mouse<br />

Clone: 24-31<br />

Isotype: IgG1<br />

Species Reactivity: Human. Weakly reacts with Rabbit. Does not react with rat. Pig<br />

unknown.<br />

Epitope: aa 283-440 (exon 4-6)<br />

Immunogen: IGF-1R/3T3 mouse fibroblasts transfected with human type I IGF-receptor<br />

cDNA<br />

Molecular Weight: 125kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation<br />

• ELISA<br />

• Acts as a Weak IGF-like Agonist in Bioassays (Thymidine incorporation into DNA)<br />

• Does Not Significantly Inhibit IGF-1 Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-641-P0<br />

MS-641-P1<br />

MS-641-P<br />

MS-641-P1ABX<br />

MS-641-PABX<br />

MS-641-B0<br />

MS-641-B1<br />

MS-641-B<br />

IGF-1 R (α -Subunit) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 17-69<br />

Isotype: IgG1<br />

Species Reactivity: Human, Pig and Rabbit. Does not react with rat. Others not known.<br />

Epitope: aa 514-586 (exon 7/8)<br />

Immunogen: IGF-1R/3T3 mouse fibroblasts transfected with human type I IGF-receptor<br />

cDNA<br />

Molecular Weight: 125kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation<br />

• Acts as a Weak IGF-like Agonist in Bioassays (Thymidine incorporation into DNA)<br />

• Does Not Significantly Inhibit IGF Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

IGF-1R (α -Subunit) Ab-3, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-642-P0<br />

MS-642-P1<br />

MS-642-P<br />

MS-642-P1ABX<br />

MS-642-PABX<br />

Host Species: Mouse<br />

Clone: 24-57<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rabbit. Weakly reacts with Pig. Does not react with<br />

rat.<br />

Epitope: aa 440-514 (exon 7/8)<br />

Immunogen: IGF-1R/3T3 mouse fibroblasts transfected with human type I IGF-receptor<br />

cDNA<br />

Molecular Weight: 125kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation (Not optimum)<br />

• Affinity Purification of Hybrid Receptors<br />

• Acts as a Weak IGF-like Agonist in Bioassays (Thymidine incorporation into DNA)<br />

• Inhibits (>90%) IGF-1 Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-643-P0<br />

MS-643-P1<br />

MS-643-P<br />

MS-643-P1ABX<br />

MS-643-PABX<br />

USA: RUO; Int'l: RUO<br />

166<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


IGF-1R (α -Subunit) Ab-4, Mouse Monoclonal Antibody<br />

IGF-I Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 24-60<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Weakly reacts with Rabbit and Pig (Ab-2 is better). Does<br />

not react with rat.<br />

Epitope: aa 184-283<br />

Immunogen: IGF-1R/3T3 mouse fibroblasts transfected with human type I IGF-receptor<br />

cDNA<br />

Molecular Weight: 125kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation<br />

• Acts as a Weak IGF-like Agonist in Bioassays (Thymidine incorporation into DNA)<br />

• Substantially (>80%) Inhibits IGF-1 Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

IGF-1R (β -Subunit) Ab-5, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-644-P0<br />

MS-644-P1<br />

MS-644-P<br />

MS-644-P1ABX<br />

MS-644-PABX<br />

Host Species: Mouse<br />

Clone: 1-2<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: aa 1323-1337<br />

Immunogen: A 15-mer peptide corresponding to aa 1323-1337<br />

(Tyr-RKNERALPLPQSSTC) from the C-terminal of β-subunit of human IGF-1R<br />

Molecular Weight: 95kDa<br />

Positive Control: Placenta or Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Not optimum)<br />

• Affinity Purification of HYBRID and IGF-1R<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-645-P0<br />

MS-645-P1<br />

MS-645-P<br />

MS-645-P1ABX<br />

MS-645-PABX<br />

Host Species: Mouse<br />

Clone: M23<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Immunogen: Purified human IGF-1<br />

Molecular Weight: ~7.6kDa<br />

Positive Control: Pancreas, IGF-1 recombinant protein<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab without BSA (Frozen)<br />

Purified Ab without BSA (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

IgG (γ -Heavy Chain) Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: IgG isolated from a pool of normal human<br />

sera<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

IgG, FITC Labeled Antibody<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

anti–IGF–I<br />

Ab–1, WB<br />

Cat. No.<br />

MS-1508-P0<br />

MS-1508-P1<br />

MS-1508-P<br />

MS-1508-P1BX<br />

MS-1508-PBX<br />

IVD†<br />

FFPE human tonsil stained with IgG Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1432-A0<br />

RB-1432-A1<br />

RB-1432-A<br />

RB-1432-R7<br />

RB-1432-PCS<br />

Host Species: Sheep<br />

Species Reactivity: Reacts with human γ-chain IgG.<br />

Immunogen: IgG from human serum<br />

Positive Control: Normal tonsil fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Large aggregates found in tonsil, lymph node, Peyer's patch<br />

and spleen<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

FITC-Conjugated Ab<br />

2mL<br />

n/a<br />

SH-1921-R2<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

167


IgM (µ-Heavy Chain) Ab-2, Rabbit Polyclonal Antibody<br />

Inhibin, α Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: IgM isolated from human serum of a<br />

patient with Waldenstrom's<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

IgM, FITC Labeled Antibody<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with IgM Ab–2.<br />

Conc. Cat. No.<br />

n/a RB-1434-A0<br />

n/a RB-1434-A1<br />

n/a RB-1434-A<br />

n/a RB-1434-R7<br />

n/a RB-1434-PCS<br />

Host Species: Mouse<br />

Clone: R1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Cow (weak) and Pig<br />

(weak). Others not known.<br />

Epitope: aa 1-32<br />

Immunogen: A synthetic peptide corresponding to aa<br />

1-32 of human inhibin α-subunit<br />

Positive Control: Testis and sex cord stromal tumors<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

iNOS, see Nitric Oxide Synthase, Inducible<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human testis stained with Inhibin α<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1863-S0<br />

MS-1863-S1<br />

MS-1863-S<br />

MS-1863-R7<br />

MS-1863-PCS<br />

Host Species: Rabbit<br />

Species Reactivity: Reacts with human µ-chain IgM.<br />

Immunogen: IgM from human serum<br />

Positive Control: Normal tonsil fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Aggregates found in tonsil, lymph node, Peyer's patch and<br />

spleen<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

†USA: IVD; Int'l: IVD<br />

IL-2Rα, see CD25<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1922-R2<br />

Insulin Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: INS04; same as E2-E3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Swine insulin<br />

Molecular Weight: 6kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

FFPE human pancreas stained with Insulin<br />

Ab–4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-1377-P0<br />

MS-1377-P1<br />

MS-1377-P<br />

MS-1377-P1ABX<br />

MS-1377-PABX<br />

MS-1377-B0<br />

MS-1377-B1<br />

MS-1377-B<br />

MS-1377-PCS<br />

USA: RUO; Int'l: RUO<br />

168<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Insulin Ab-5, Mouse Monoclonal Antibody<br />

Insulin Receptor (α -Subunit) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: INS05; same as 2D11-H5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Pig and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Purified Insulin protein<br />

Molecular Weight: 6kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

FFPE human pancreas stained with Insulin<br />

Ab–5.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-1378-P0<br />

MS-1378-P1<br />

MS-1378-P<br />

MS-1378-P1ABX<br />

MS-1378-PABX<br />

MS-1378-PCS<br />

Insulin Ab-6 (INS0 4 + INS0 5 ), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: INS0 4 + INS0 5<br />

Isotype: IgG1/κ + IgG1/κ<br />

Species Reactivity: Human, Rat and Pig. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Insulin protein<br />

Molecular Weight: 6kDa<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human pancreas stained with Insulin<br />

Ab–6.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1379-P0<br />

MS-1379-P1<br />

MS-1379-P<br />

MS-1379-R7<br />

MS-1379-PCS<br />

MS-1379-P1ABX<br />

MS-1379-PABX<br />

Host Species: Mouse<br />

Clone: 83-14<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Weakly with Cow, Pig and Sheep. Does not react with<br />

rabbit, mouse and rat. Others not known.<br />

Epitope: aa 469-592 (exon 7/8)<br />

Immunogen: IM-9 lymphocytes followed by purified insulin receptor<br />

Molecular Weight: 135kDa<br />

Positive Control: IM-9 lymphocyte cells, Placenta<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation<br />

• ELISA<br />

• Insulin-like Agonist<br />

• Inhibits (~80%) Insulin Binding (10nM)<br />

• Tyrosine Kinase Assay (Ab-mediated capture on microplates)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-631-P0<br />

MS-631-P1<br />

MS-631-P<br />

MS-631-P1ABX<br />

MS-631-PABX<br />

MS-631-B0<br />

MS-631-B1<br />

MS-631-B<br />

Insulin Receptor (α -Subunit) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 83-7<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Pig, Sheep and<br />

Rabbit. Does not react with mouse and rat.<br />

Epitope: Exon 3<br />

Immunogen: IM-9 lymphocytes followed by IR<br />

Molecular Weight: 135kDa<br />

Positive Control: IM-9 lymphocyte cells, Placenta<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

FFPE human placenta stained with Insulin<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Receptor Ab–2.<br />

• ELISA<br />

• Flow Cytometry<br />

• Insulin-like Agonist<br />

• Does Not Significantly Inhibit Insulin Binding<br />

• Tyrosine Kinase Assay (Ab-mediated capture on microplates)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-632-P0<br />

MS-632-P1<br />

MS-632-P<br />

MS-632-P1ABX<br />

MS-632-PABX<br />

MS-632-B0<br />

MS-632-B1<br />

MS-632-B<br />

MS-632-R7<br />

MS-632-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

169


Insulin Receptor (α -Subunit) Ab-3, Mouse Monoclonal Antibody<br />

Insulin Receptor (β -Subunit) Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 47-9<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Pig and Sheep. Weakly reacts with Rabbit. Does not<br />

react with mouse and rat. Others not known.<br />

Epitope: Exon 7/8<br />

Immunogen: IM-9 lymphocytes followed by purified insulin receptor<br />

Molecular Weight: 135kDa<br />

Positive Control: IM-9 lymphocyte cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation (Not suitable)<br />

• Antagonist (Blocks insulin action)<br />

• Completely Inhibits (>90%) Insulin Binding<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-633-P0<br />

MS-633-P1<br />

MS-633-P<br />

MS-633-P1ABX<br />

MS-633-PABX<br />

Insulin Receptor (β -Subunit) Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CT-1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and Rat.<br />

Epitope: aa-GRVLTLPRS- within the C-terminus<br />

Immunogen: A 15-mer synthetic peptide corresponding to aa Tyr-KKNGRILTLPRSNPS<br />

from the C-terminal of human insulin receptor β-subunit<br />

Molecular Weight: 95kDa<br />

Positive Control: IM-9 lymphocyte cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation<br />

• Affinity Purification (With peptide elution)<br />

• ELISA (As capture antibody only)<br />

• Tyrosine Kinase Assay (Ab-mediated capture on microplates)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-635-P0<br />

MS-635-P1<br />

MS-635-P<br />

MS-635-P1ABX<br />

MS-635-PABX<br />

Host Species: Mouse<br />

Clone: CT-3<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Mouse and Rat.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant fragment including the<br />

C-terminal 100 amino acids of human insulin receptor<br />

Molecular Weight: 95kDa<br />

Positive Control: HEP-G-2, IM-9 lymphocyte cells;<br />

Placenta or brain<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Not suitable)<br />

• Affinity Purification (With peptide elution)<br />

• ELISA (As capture antibody only)<br />

• Tyrosine Kinase Assay (Ab-mediated capture on<br />

microplates)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Integrin β-1, see CD29<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

FFPE rat brain stained with Insulin Receptor<br />

Ab–6.<br />

anti–Insulin Receptor (Beta–Subunit) Ab–6,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-636-P0<br />

200µg/mL MS-636-P1<br />

200µg/mL MS-636-P<br />

1mg/mL MS-636-P1ABX<br />

1mg/mL MS-636-PABX<br />

n/a MS-636-R7<br />

n/a MS-636-PCS<br />

250µg/100µL MS-636-PCL<br />

Interferon-α (II)/IFN-α (II), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: N27<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 43-53<br />

Immunogen: Purified recombinant IFN-α 2c<br />

Molecular Weight: 16-27kDa<br />

Positive Control: Stimulated human peripheral blood mononuclear cells<br />

Applications:<br />

• Blocking study<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-574-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-574-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-574-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-574-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-574-PABX<br />

USA: RUO; Int'l: RUO<br />

170<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Involucrin Ab-1, Mouse Monoclonal Antibody<br />

Kappa Light Chain Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: SY5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Gorilla, Owl,<br />

Monkey, Pig, Dog and Rat. Others not<br />

known.<br />

Epitope: Codon 421-568<br />

Immunogen: Human keratinocytes'<br />

involucrin<br />

Molecular Weight: 66-170kDa<br />

Positive Control: LS174T cells, Skin FFPE human skin stained with Involucrin<br />

Cellular Localization: Cytoplasmic Ab–1.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

• ELISA<br />

anti–Involucrin<br />

Ab–1, WB<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Monkey and<br />

Rat. Does not react with dog. Others not known.<br />

Immunogen: Kappa light chains purified from human<br />

Bence Jones proteins<br />

Molecular Weight: 25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with Kappa Light<br />

Chain Ab–2.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-126-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-126-P1<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µg/mL MS-126-P<br />

1mg/mL MS-126-P1ABX<br />

1mg/mL MS-126-PABX<br />

200µg/mL MS-126-B0<br />

200µg/mL MS-126-B1<br />

200µg/mL MS-126-B<br />

n/a MS-126-R7<br />

n/a MS-126-PCS<br />

250µg/100µL MS-126-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

FFPE rat spleen stained with Kappa Light<br />

Chain Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-333-A0<br />

RB-333-A1<br />

RB-333-A<br />

RB-333-R7<br />

RB-333-RQ<br />

RB-333-PCS<br />

†USA: IVD; Int'l: IVD<br />

Kappa Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: L1C1<br />

Isotype: IgG1/k<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: B-lymphoma cells<br />

Molecular Weight: 25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with Kappa<br />

Light Chain Ab–1.<br />

Kappa Light Chain, FITC Labeled Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Reacts with human kappa light chain plasma proteins.<br />

Immunogen: Kappa light chains isolated from human urine<br />

Positive Control: Normal tonsil fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Lymphatic tissues such as tonsil, lymph node, and spleen; used<br />

to assist in detecting certain types of kidney disease<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1929-R2<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

USA: RUO; Int'l: RUO<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-143-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-143-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-143-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-143-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-143-PCS<br />

Ab Without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-143-P1ABX<br />

Ab Without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-143-PABX<br />

Biotinylated Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-143-B0<br />

Biotinylated Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-143-B1<br />

Biotinylated Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-143-B<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

171


Kappa/Lambda, MultiVision Antibody Cocktail<br />

Host Species: Kappa — Mouse; Lambda — n/a<br />

Clone: Kappa — L1C1; Lambda — N/A<br />

Isotype: Kappa — Mouse IgG1/κ; Lambda — N/A<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Kappa — Not determined; Lambda — Not<br />

determined<br />

Immunogen: Kappa — B-lymphoma cells; Lambda<br />

— Lambda light chains purified from human<br />

Molecular Weight: Kappa — 25kDa; Lambda —<br />

25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Kappa — Cytoplasmic; Lambda<br />

— Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC<br />

†USA: IVD; Int'l: IVD<br />

KDR, see Flk-1<br />

Quantity<br />

7mL<br />

IVD†<br />

FFPE human tonsil stained with<br />

MV–2003–R7 using MultiVision anti–Mouse/HRP<br />

and anti–Rabbit/AP.<br />

Conc.<br />

n/a<br />

Cat. No.<br />

MV-2003-R7<br />

Ki-67, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from C-terminus of<br />

human Ki-67<br />

Molecular Weight: 345kDa and 395kDa<br />

Positive Control: Breast CA and lymph node<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Ki-67 Ab-4, Rabbit Polyclonal Antibody<br />

FFPE human tonsil stained with Ki–67 antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9043-P0<br />

RB-9043-P1<br />

RB-9043-P<br />

RB-9043-R7<br />

Keratin, see Cytokeratin<br />

Ki-67, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP6<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from the<br />

human Ki-67 protein<br />

Positive Control: Spleen, tonsil, or Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

FFPE human tonsil stained with rabbit<br />

monoclonal Ki–67.<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Middle of Ki-67 protein<br />

Immunogen: A synthetic peptide from the human<br />

Ki-67 protein<br />

Positive Control: Tonsil or Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

FFPE human tonsil stained with Ki–67<br />

Ab–4.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1510-P0<br />

RB-1510-P1<br />

RB-1510-P<br />

RB-1510-P1ABX<br />

RB-1510-PABX<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RB-1510-R7<br />

Ready to Use<br />

12mL<br />

n/a<br />

RB-1510-RQ<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

RB-1510-PCS<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast CAl stained with Ki–67<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

RM-9106-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

RM-9106-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

RM-9106-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RM-9106-R7<br />

Ready to Use<br />

12mL<br />

n/a<br />

RM-9106-RQ<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

RM-9106-PCS<br />

FITC-Conjugated Ab<br />

100µL<br />

n/a<br />

RM-9106-F0<br />

FITC-Conjugated Ab<br />

1mL<br />

n/a<br />

RM-9106-F<br />

†USA: IVD; Int'l: IVD<br />

172<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ku (p70) Ab-4, Mouse Monoclonal Antibody<br />

Ku (p70/p80) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: N3H10<br />

Isotype: IgG2b<br />

Species Reactivity: Human,<br />

Monkey and Xenopus. Mouse<br />

and Hamster (Western Blotting<br />

only). Does not react with cow,<br />

rabbit and sea urchin.<br />

Epitope: aa 506-541<br />

Immunogen: Human placental<br />

extract designated as PSE1-PL<br />

Molecular Weight: 70kDa<br />

Positive Control: BT474, T47D,<br />

HEP-G-2 or HeLa cells; Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with Ku Ab–4. anti–Ku (p70)<br />

Ab–4, Denatured<br />

IP<br />

anti–Ku (p70)<br />

Ab–4, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Ku (p70)<br />

Ab–4, Native<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-329-P0<br />

200µg/mL MS-329-P1<br />

200µg/mL MS-329-P<br />

1mg/mL MS-329-P1ABX<br />

1mg/mL MS-329-PABX<br />

n/a MS-329-R7<br />

n/a MS-329-PCS<br />

250µg/100µL MS-329-PCL<br />

Host Species: Mouse<br />

Clone: 162<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Monkey, Xenopus. Mouse<br />

and Rat (Immunoprecipitation only). Does not react<br />

with cow and rabbit.<br />

Epitope: A conformational epitope of p70/p80 dimer,<br />

which is destroyed during Western Blotting<br />

Immunogen: Human B-cell nuclei from plasmacytoid<br />

2p68 cells<br />

Molecular Weight: 70kDa and 80kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Affinity Purification<br />

• Flow Cytometry<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Ku (p80) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 111<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Monkey. Does not<br />

react with cow, rabbit, mouse and rat.<br />

Epitope: aa 610-705<br />

Immunogen: Human B-cell nuclei from plasmacytoid<br />

2p68 cells<br />

Molecular Weight: 80kDa<br />

Positive Control: HeLa, T47D or BT474 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Flow Cytometry<br />

FFPE human tonsil stained with Ku Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

anti–Ku (p80)<br />

Ab–2, Native<br />

IP<br />

Cat. No.<br />

MS-286-P0<br />

MS-286-P1<br />

MS-286-P<br />

MS-286-P1ABX<br />

MS-286-PABX<br />

MS-286-R7<br />

MS-286-PCS<br />

anti–Ku (p80) anti–Ku (p80)<br />

Ab–2, Denatured<br />

Ab–2, WB<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wthout BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-285-P0<br />

200µg/mL MS-285-P1<br />

200µg/mL MS-285-P<br />

1mg/mL MS-285-P1ABX<br />

1mg/mL MS-285-PABX<br />

200µg/mL MS-285-B0<br />

200µg/mL MS-285-B1<br />

200µg/mL MS-285-B<br />

n/a MS-285-PCS<br />

250µg/100µL MS-285-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

173


L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: UJ127<br />

Isotype: IgG1/k<br />

Species Reactivity: Human.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Homogenous<br />

suspension of 16-week human<br />

fetal brain<br />

Molecular Weight:<br />

220-240kDa<br />

Positive Control: IMR-5 cells<br />

Neuroblastoma<br />

Cellular Localization:<br />

Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

L1 Protein, see Macrophage<br />

FFPE human schwannoma stained with L1<br />

Cell Adhesion Molecule Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–L1 Cell anti–L1 Cell<br />

Adhesion Adhesion<br />

Molecule<br />

Ab–1, WB<br />

Molecule<br />

Ab–1, Native<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-770-P0<br />

200µg/mL MS-770-P1<br />

200µg/mL MS-770-P<br />

1mg/mL MS-770-P1ABX<br />

1mg/mL MS-770-PABX<br />

200µg/mL MS-770-B0<br />

200µg/mL MS-770-B1<br />

200µg/mL MS-770-B<br />

n/a MS-770-R7<br />

n/a MS-770-PCS<br />

250µg/100µL MS-770-PCL<br />

Lambda Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Lambda Light Chain, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Mouse and Rat.<br />

Does not react with dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Lambda light chains purified from human<br />

Bence Jones proteins<br />

Molecular Weight: 25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with Lambda<br />

Light Chain Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-334-A0<br />

RB-334-A1<br />

RB-334-A<br />

RB-334-R7<br />

RB-334-RQ<br />

RB-334-PCS<br />

Lambda Light Chain Ab-4 (Cocktail), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LAM03 + HP6054<br />

Isotype: IgG1/κ + IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human Lambda light chain, and<br />

purified human IgG myeloma proteins covalently<br />

coupled to polyaminostyrene micro beads<br />

Molecular Weight: 25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human tonsil stained with Lambda<br />

Light Chain Ab–4.<br />

Host Species: Mouse<br />

Clone: HP6054<br />

Isotype: IgG2a/k<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human IgG myeloma proteins<br />

covalently coupled to polyaminostyrene micro beads<br />

Molecular Weight: 25kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with Lambda<br />

Light Chain Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1158-P0<br />

MS-1158-P1<br />

MS-1158-P<br />

MS-1158-P1ABX<br />

MS-1158-PABX<br />

MS-1158-R7<br />

MS-1158-PCS<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Conc.<br />

50µg/mL<br />

50µg/mL<br />

50µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-180-P0<br />

MS-180-P1<br />

MS-180-P<br />

MS-180-R7<br />

MS-180-PCS<br />

MS-180-P1ABX<br />

MS-180-PABX<br />

†USA: IVD; Int'l: IVD<br />

174<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Lambda, FITC Labeled Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Reacts with human lambda light chain plasma proteins.<br />

Immunogen: Lambda light chains isolated from human urine<br />

Positive Control: Normal tonsil fixed and processed in the same manner as the test<br />

specimen<br />

Cellular Localization: Lymphatic tissues such as tonsil, lymph node and spleen; used<br />

to assist in detecting certain types of kidney disease<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

2mL<br />

Laminin Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Laminin isolated from a rat yolk sac<br />

tumor cell line<br />

Positive Control: Skin, Lung, Kidney or Tonsil<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Conc.<br />

n/a<br />

Cat. No.<br />

RB-1930-R2<br />

IVD†<br />

FFPE human skin stained with Laminin<br />

Ab–1.<br />

Laminin B1/β 1 Ab-1, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: LT3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Pig, Hamster, and Mouse. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Murine EHS laminin preparation<br />

Molecular Weight: ~210kDa<br />

Positive Control: LS174T cells, Normal colon or colon CA<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen and<br />

alcohol-fixed, paraffin-embedded)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Laminin<br />

B1/Beta1<br />

Ab–1, Native<br />

IP<br />

anti–Laminin<br />

B1/Beta1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL RT-796-P0<br />

200µg/mL RT-796-P1<br />

200µg/mL RT-796-P<br />

1mg/mL RT-796-P1ABX<br />

1mg/mL RT-796-PABX<br />

200µg/mL RT-796-B0<br />

200µg/mL RT-796-B1<br />

200µg/mL RT-796-B<br />

250µg/100µL RT-796-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-082-A0<br />

RB-082-A1<br />

RB-082-A<br />

RB-082-R7<br />

RB-082-RQ<br />

RB-082-PCS<br />

Laminin B2/γ 1 Ab-1, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: A5<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Mouse.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Murine EHS laminin<br />

preparation<br />

Molecular Weight: ~210kDa<br />

Positive Control: LS174T cells, Normal<br />

colon or colon CA<br />

Cellular Localization: Basement<br />

membrane<br />

Applications:<br />

Frozen human tonsil stained with Laminin anti–Laminin<br />

B2/&γ;1 Ab–1.<br />

B2/γ1, Native<br />

IP<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen and acid-alcohol-fixed,<br />

paraffin-embedded)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

RT-795-P0<br />

RT-795-P1<br />

RT-795-P<br />

RT-795-P1ABX<br />

RT-795-PABX<br />

RT-795-B0<br />

RT-795-B1<br />

RT-795-B<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

175


Laminin B2/γ 1 Ab-2, Mouse Monoclonal Antibody<br />

LCK (p56 lck ) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D18<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Rat and Guinea Pig.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Rat glomerular basement membrane<br />

Molecular Weight: ~210kDa<br />

Positive Control: LS174T cells, Skin<br />

Cellular Localization: Basement membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunoprecipitation (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human skin stained with Laminin<br />

B2/&γ;1 Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1356-P0<br />

MS-1356-P1<br />

MS-1356-P<br />

MS-1356-P1ABX<br />

MS-1356-PABX<br />

MS-1356-R7<br />

MS-1356-PCS<br />

Host Species: Mouse<br />

Clone: 3A5<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: aa 1-225<br />

Immunogen: Recombinant protein corresponding to aa 1-225<br />

of murine p56 lck protein<br />

Molecular Weight: 56kDa<br />

Positive Control: Jurkat cells<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

• Kinase Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–LCK<br />

(p56lck)<br />

Ab–1, Denatured<br />

IP<br />

anti–LCK<br />

(p56lck)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-164-P0<br />

200µg/mL MS-164-P1<br />

200µg/mL MS-164-P<br />

1mg/mL MS-164-P1ABX<br />

1mg/mL MS-164-PABX<br />

250µg/100µL MS-164-PCL<br />

Laminin Receptor Ab-1, Mouse Monoclonal Antibody<br />

LESTR, see CXCR4<br />

Host Species: Mouse<br />

Clone: MLuC5<br />

Isotype: IgM<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Small cell lung carcinoma N592 live<br />

cells<br />

Molecular Weight: 67kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane with some<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Inhibits (partially) the binding of soluble laminin<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with<br />

Laminin Receptor Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-259-P0<br />

MS-259-P1<br />

MS-259-P<br />

MS-259-P1ABX<br />

MS-259-PABX<br />

MS-259-R7<br />

MS-259-PCS<br />

Lewis x , see CD15<br />

LFA-2, see CD2<br />

LH (Luteinizing Hormone), Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM103<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: LH purified from human pituitary gland<br />

Molecular Weight: 14kDa (β), 28kDa (α/β)<br />

Positive Control: Anterior pituitary<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human pituitary stained with LH.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-9078-P0<br />

MS-9078-P1<br />

MS-9078-P<br />

MS-9078-R7<br />

LAP6, see Caspase 9<br />

LCA, see CD45<br />

176<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


LH (Luteinizing Hormone) Ab-1, Mouse Monoclonal Antibody<br />

LRP/MVP (Major Vault Protein) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LH01<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human LH-β<br />

Molecular Weight: 14kDa (β) and 28kDa (αβ)<br />

Positive Control: Anterior pituitary<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

LH-RH Receptor, see GnRH Receptor<br />

LMP, see Epstein-Barr Virus<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human pituitary stained with LH<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1448-P0<br />

MS-1448-P1<br />

MS-1448-P<br />

MS-1448-R7<br />

MS-1448-PCS<br />

MS-1448-P1ABX<br />

MS-1448-PABX<br />

Host Species: Mouse<br />

Clone: 1032<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Proteins precipitated with<br />

AER317 from the phosphocellulose column<br />

flow through of extract of human breast<br />

cancer MCF-7 cells<br />

Molecular Weight: 104-110kDa<br />

FFPE human breast CA stained with<br />

Positive Control: SKBR-3 cells, Breast LRP/MVP Ab–2.<br />

tumors<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Gel Supershift<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–LRP/MVP<br />

(Major Vault<br />

Protein) Ab–2,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-664-P0<br />

200µg/mL MS-664-P1<br />

200µg/mL MS-664-P<br />

1mg/mL MS-664-P1ABX<br />

1mg/mL MS-664-PABX<br />

200µg/mL MS-664-B0<br />

200µg/mL MS-664-B1<br />

200µg/mL MS-664-B<br />

n/a MS-664-R7<br />

n/a MS-664-PCS<br />

250µg/100µL MS-664-PCL<br />

Luteinizing Hormone, see LH<br />

Lysozyme/Muramidase Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Baboon, Monkey, Pig,<br />

Cat and Dog. Does not react with mouse and rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human lysozyme purified from the urine<br />

of patients with monocytic leukemia<br />

Positive Control: Tonsil, colon or skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human tonsil stained with Lysozyme<br />

Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-372-A1<br />

RB-372-A<br />

RB-372-R7<br />

RB-372-PCS<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

177


Calprtectin-Monocyte/Macrophage/L1 protein Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MAC 387<br />

Isotype: IgG1<br />

Species Reactivity: Human, Baboon, Monkey, Pig,<br />

Cat, Dog, Guinea pig, Rat, and Mouse. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Affinity purified monocyte membrane<br />

preparation<br />

Positive Control: Tonsil, lymph node, or spleen<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ab Without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Macrophage Marker, see CD68<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

200µL<br />

MAGE-1 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MA454<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Dog and Rat.<br />

Others not known.<br />

Immunogen: Partially purified, full-length<br />

recombinant human MAGE-1 protein<br />

Molecular Weight: 42-46kDa<br />

Positive Control: Colo32 cells germ cells<br />

in testis<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control For IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with<br />

Macrophage Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

IVD†<br />

Cat. No.<br />

MS-148-P0<br />

MS-148-P1<br />

MS-148-P<br />

MS-148-R7<br />

MS-148-P1ABX<br />

MS-148-PABX<br />

FFPE human testis stained with MAGE–1 anti–MAGE–1<br />

Ab–4.<br />

Ab–4, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1067-P0<br />

200µg/mL MS-1067-P1<br />

200µg/mL MS-1067-P<br />

1mg/mL MS-1067-P1ABX<br />

1mg/mL MS-1067-PABX<br />

200µg/mL MS-1067-B0<br />

200µg/mL MS-1067-B1<br />

200µg/mL MS-1067-B<br />

n/a MS-1067-R7<br />

n/a MS-1067-PCS<br />

250µg/100µL MS-1067-PCL<br />

MAGE-1 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 6C1<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Full-length recombinant human MAGE-1<br />

protein<br />

Molecular Weight: 42-46kDa<br />

Positive Control: Hepatocellular CA, normal testis<br />

Cellular Localization: Cytoplasmic, occasionally<br />

nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Major Vault Protein, see LRP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human testis stained with MAGE–1<br />

Ab–6.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1836-S0<br />

MS-1836-S1<br />

MS-1836-S<br />

MS-1836-R7<br />

MS-1836-PCS<br />

Maltose Binding Protein Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: R29<br />

Isotype: IgG1<br />

Species Reactivity: Bacteria. Proteins from all species which are tagged with MBP.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant MBP fusion protein<br />

Molecular Weight: 53kDa<br />

Positive Control: MBP fusion protein in bacteria, bacterial lysate, or cells and tissues<br />

transfected with an MBP fusion protein expressing vectors<br />

Cellular Localization: Depends upon the localization of the parent protein tagged with<br />

MBP<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Affinity Purification (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-765-P0<br />

MS-765-P1<br />

MS-765-P<br />

MS-765-P1ABX<br />

MS-765-PABX<br />

178<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Mammaglobin, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 304-1A5<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Recombinant full-length protein<br />

Molecular Weight: 10kDa<br />

Positive Control: Breast carcinoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human breast cancer stained with<br />

Mammaglobin.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1919-A0<br />

MS-1919-A1<br />

MS-1919-A<br />

MS-1919-R7<br />

MS-1919-RQ<br />

MS-1919-PCS<br />

MAP 2a,b,c (Microtubule-Associated Protein) Ab-3, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AP18<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Rat, Xenopus,<br />

Quail. Others not known.<br />

Epitope: aa 1-151<br />

Immunogen: Bovine brain microtubule associated<br />

protein 2<br />

Molecular Weight: ~280kDa doublet and a 70kDa<br />

singlet<br />

Positive Control: IMR-5 or T98G human glioblastoma<br />

cells or brain<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

IVD†<br />

FFPE human brain stained with MAP 2a,b,c<br />

Ab–3.<br />

†USA: ASR; Int'l: RUO<br />

MAP 2a,b (Microtubule-Associated Protein) Ab-2, Mouse<br />

Monoclonal Antibody<br />

Format<br />

Quantity<br />

FFPE rat brain stained with MAP 2a,b,c<br />

Ab–3.<br />

Conc.<br />

Cat. No.<br />

Host Species: Mouse<br />

Clone: AP20<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 997-1332<br />

Immunogen: Bovine brain microtubule associated<br />

protein 2<br />

Molecular Weight: ~280kDa Doublet<br />

Positive Control: Human glioblastoma T98G cells or<br />

brain<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

FFPE human brain stained with MAP 2a,b<br />

Ab–2.<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

MS-250-P0<br />

MS-250-P1<br />

MS-250-P<br />

MS-250-R7<br />

MS-250-PCS<br />

MS-250-P1ABX<br />

MS-250-PABX<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-249-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-249-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-249-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-249-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-249-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

179


MAP1B/MAP5 (Microtubule-Associated Protein) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3G5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow and Rat. Does not<br />

react with chicken. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified bovine brain MAPs<br />

Molecular Weight: 320kDa doublet<br />

Positive Control: Brain<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive control For IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

MAP5 (Microtubule-Associated Protein), see MAP1B<br />

FFPE human brain stained with MAP1B<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-248-P0<br />

MS-248-P1<br />

MS-248-P<br />

MS-248-P1ABX<br />

MS-248-PABX<br />

MS-248-B0<br />

MS-248-B1<br />

MS-248-B<br />

MS-248-R7<br />

MS-248-PCS<br />

MART-1/Melan-A (Melanoma Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: M2-7C10<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human<br />

and Horse. Does not react with<br />

mouse and rat. Others not<br />

tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

hMART-1 protein<br />

Molecular Weight: 18kDa<br />

Positive Control: CAC1<br />

melanoma cells and<br />

melanomas<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human melanoma stained with<br />

MART–1 Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

anti–MART–1/ anti–MART–1/<br />

Melan–A Melan–A<br />

(Melanoma (Melanoma<br />

Marker) Ab–1, Marker) Ab–1,<br />

Denatured IP WB<br />

Conc. Cat. No.<br />

200µg/mL MS-612-P0<br />

200µg/mL MS-612-P1<br />

200µg/mL MS-612-P<br />

1mg/mL MS-612-P1ABX<br />

1mg/mL MS-612-PABX<br />

n/a MS-612-R7<br />

n/a MS-612-RQ<br />

n/a MS-612-PCS<br />

250µg/100µL MS-612-PCL<br />

180<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MART-1/Melan-A (Melanoma Marker) (Cocktail) Ab-3, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M2-7C10 + M2-9E3<br />

Isotype: IgG2b/κ + IgG2b/κ<br />

Species Reactivity: Human<br />

and Horse. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

hMART-1 protein<br />

Molecular Weight: 18kDa<br />

Positive Control: CAC1<br />

melanoma cells and<br />

Melanomas<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human compound nevus stained with<br />

MART–1 Ab–3.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

anti–MART–1/ anti–MART–1/<br />

Melan–A Melan–A<br />

(Melanoma (Melanoma<br />

Marker) (Cocktail)<br />

Ab–3, Detail)<br />

Ab–3, WB<br />

Marker) (Cocknatured<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-716-P0<br />

200µg/mL MS-716-P1<br />

200µg/mL MS-716-P<br />

1mg/mL MS-716-P1ABX<br />

1mg/mL MS-716-PABX<br />

n/a MS-716-R7<br />

n/a MS-716-RQ<br />

n/a MS-716-PCS<br />

250µg/100µL MS-716-PCL<br />

MART-1/Melan-A (Melanoma Marker) Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: A103<br />

Isotype: IgG1<br />

Species Reactivity: Human and Dog.<br />

Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant MART-1 protein<br />

Molecular Weight: 18kDa<br />

Positive Control: CAC1 melanoma cells<br />

and Melanomas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

FFPE human melanoma stained with<br />

MART–1 Ab–4.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

anti–MART–1/<br />

Melan–A<br />

(Melanoma<br />

Marker) Ab–4,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-799-P0<br />

200µg/mL MS-799-P1<br />

200µg/mL MS-799-P<br />

n/a MS-799-R7<br />

n/a MS-799-RQ<br />

n/a MS-799-PCS<br />

250µg/100µL MS-799-PCL<br />

1mg/mL MS-799-P1ABX<br />

1mg/mL MS-799-PABX<br />

200µg/mL MS-799-B0<br />

200µg/mL MS-799-B1<br />

200µg/mL MS-799-B<br />

Maspin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: EAW24<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant protein corresponding to<br />

N-terminal region of human Maspin<br />

Molecular Weight: 42kDa<br />

Positive Control: Prostate<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human prostate stained with Maspin<br />

Ab–1.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1767-S0<br />

MS-1767-S1<br />

MS-1767-S<br />

MS-1767-R7<br />

MS-1767-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

181


Mast Cell Chymase Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CC1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human skin chymase<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Mast Cell<br />

Chymase Ab–1.<br />

Conc.<br />

80µg/mL<br />

80µg/mL<br />

80µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Mast Cell Tryptase Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: AA1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Dog and Cat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human mast cell tryptase purified from<br />

human lung tissues<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Matrilysin, see MMP-7<br />

mb-1, see CD79a<br />

Mch 2, see Caspase 6<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Cat. No.<br />

MS-1217-P0<br />

MS-1217-P1<br />

MS-1217-P<br />

MS-1217-P1ABX<br />

MS-1217-PABX<br />

MS-1217-R7<br />

MS-1217-PCS<br />

FFPE human tonsil stained with Mast Cell<br />

Tryptase Ab–2.<br />

Conc.<br />

50µg/mL<br />

50µg/mL<br />

50µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1216-P0<br />

MS-1216-P1<br />

MS-1216-P<br />

MS-1216-P1ABX<br />

MS-1216-PABX<br />

MS-1216-R7<br />

MS-1216-PCS<br />

Mcl-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: RC13<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: aa 1-327<br />

Immunogen: Recombinant human Mcl-1<br />

protein corresponding to aa 1-327<br />

Molecular Weight: 42kDa<br />

Positive Control: Raji cells, Spleen or<br />

tonsil<br />

FFPE human tonsil stained with Mcl–1<br />

Cellular Localization: Predominantly Ab–1.<br />

nuclear; occasionally cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

MCM2 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CRCT2.1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Bacterially expressed human<br />

MCM2<br />

Molecular Weight: 120-125kDa<br />

Positive Control: HeLa cells, Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Mcl–1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

400µg/mL MS-681-P0<br />

400µg/mL MS-681-P1<br />

400µg/mL MS-681-P<br />

1mg/mL MS-681-P1ABX<br />

1mg/mL MS-681-PABX<br />

400µg/mL MS-681-B0<br />

400µg/mL MS-681-B1<br />

400µg/mL MS-681-B<br />

250µg/100µL MS-681-PCL<br />

FFPE human tonsil stained with MCM2<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–MCM2<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1726-P0<br />

200µg/mL MS-1726-P1<br />

200µg/mL MS-1726-P<br />

1mg/mL MS-1726-P1ABX<br />

1mg/mL MS-1726-PABX<br />

n/a MS-1726-R7<br />

n/a MS-1726-PCS<br />

250µg/100µL MS-1726-PCL<br />

MCM7, see CDC47<br />

M-CSFR, see CD115<br />

182<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MDM2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: aa 154-167<br />

Immunogen: Synthetic peptide corresponding to aa 154-167 of human MDM2 protein<br />

Molecular Weight: 90-95kDa<br />

Postitive Control: Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

MDR, see p170<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

MEK-1 Ab-1, Rabbit Polyclonal Antibody<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Rat, Mouse and Xenopus. Others not tested.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide derived from the N-terminus of human<br />

MEK-1 protein<br />

Molecular Weight: 48kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Cat. No.<br />

RB-9218-P0<br />

RB-9218-P1<br />

RB-9218-P<br />

anti–MEK–1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1662-P0<br />

1mg/mL RB-1662-P1<br />

1mg/mL RB-1662-P<br />

1mg/mL RB-1662-P1ABX<br />

1mg/mL RB-1662-PABX<br />

250µg/100µL RB-1662-PCL<br />

Melanoma (gp100) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HMB45<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not<br />

react with dog and rat. Others not known.<br />

Immunogen: Extract of pigmented<br />

melanoma metastases from lymph nodes<br />

Molecular Weight: 100kDa<br />

Positive Control: Melanoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Melanoma Marker, see MART-1<br />

FFPE human melanoma stained with<br />

Melanoma Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

IVD†<br />

anti–Melanoma<br />

(gp100) Mab,<br />

WB<br />

Cat. No.<br />

MS-364-S0<br />

MS-364-S1<br />

MS-364-S<br />

MS-364-R7<br />

MS-364-RQ<br />

MS-364-PCS<br />

Melanoma Marker, Pan Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HMB45 (gp100), M2-7C10 (MART-1) and<br />

M2-9E3 (MART-1)<br />

Isotype: IgG1/κ + IgG2b/κ + IgG2b/κ<br />

Species Reactivity: Human and Horse. Others not<br />

known.<br />

Immunogen: Extract of pigmented melanoma<br />

metastases from lymph nodes (HMB45); Recombinant<br />

hMART-1 protein (M2-7C10 and M2-9E3)<br />

Molecular Weight: 100kDa (gp100) and 18kDa<br />

(MART-1)<br />

Positive Control: Melanoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human melanoma stained with<br />

Melanoma Marker, Pan Ab–1.<br />

Melan-A, see MART-1<br />

Melanocyte-Specific Protein 1, see CITED1<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-939-S0<br />

MS-939-S1<br />

MS-939-S<br />

MS-939-R7<br />

MS-939-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

183


Mesothelin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5B2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein corresponding to<br />

the membrane-bound form of the mesothelin molecule<br />

Molecular Weight: 40kDa<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Mesothelin Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Mesothelioma Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HBME-1<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A suspension of human mesotheliema<br />

cells from patients with malignant epithelial<br />

mesothelioma<br />

Positive Control: Mesothelioma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Cat. No.<br />

MS-1320-S0<br />

MS-1320-S1<br />

MS-1320-S<br />

MS-1320-R7<br />

IVD†<br />

FFPE human mesothelioma stained with<br />

Mesothelioma Ab–1.<br />

MGMT (O-methylguanine-DNA methyltransferase) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MT 3.1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Also reacts<br />

weakly with Mouse, Rat and Hamster.<br />

Others not known.<br />

Epitope: aa 8-221<br />

Immunogen: Purified recombinant human<br />

MGMT protein<br />

Molecular Weight: 25kDa<br />

Positive Control: Raji cells, Colon CA<br />

Cellular Localization: Nuclear and<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human colon CA stained with MGMT<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–MGMT<br />

(O–methylguanine–DNA<br />

methyltransferase)<br />

Ab–1,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-470-P0<br />

200µg/mL MS-470-P1<br />

200µg/mL MS-470-P<br />

1mg/mL MS-470-P1ABX<br />

1mg/mL MS-470-PABX<br />

200µg/mL MS-470-B0<br />

200µg/mL MS-470-B1<br />

200µg/mL MS-470-B<br />

n/a MS-470-R7<br />

n/a MS-470-PCS<br />

250µg/100µL MS-470-PCL<br />

MHC I (HLA-A, B, C) Ab-1, Mouse Monoclonal Antibody<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1494-S0<br />

MS-1494-S1<br />

MS-1494-S<br />

MS-1494-R7<br />

MS-1494-RQ<br />

Host Species: Mouse<br />

Clone: 246-B8.E7<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Primates. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Human peripheral blood leukocytes<br />

Positive Control: Human lymphocytes, Tonsil and<br />

lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Flow cytometry<br />

Frozen human tonsil section stained with<br />

MHC I Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200ug/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-557-P0<br />

MS-557-P1<br />

MS-557-P<br />

MS-557-P1ABX<br />

MS-557-PABX<br />

USA: RUO; Int'l: RUO<br />

184<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MHC I (HLA-A, B, C) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: W6/32<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Cell membranes of human tonsil<br />

lymphocytes<br />

Positive Control: Human lymphocytes, Tonsil and<br />

lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only; acetone fixation<br />

recommended)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Frozen human tonsil stained with MHC I<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

MHC II (HLA-DQ) Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-1218-P0<br />

MS-1218-P1<br />

MS-1218-P<br />

MS-1218-P1ABX<br />

MS-1218-PABX<br />

Host Species: Mouse<br />

Clone: SPV-L3<br />

Isotype: IgG2a<br />

Species Reactivity: Human and Pig. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: T4-positive CTL clone HG-38<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

Frozen human tonsil stained with MHC II<br />

• Immunofluorescence<br />

Ab–1.<br />

• Flow Cytometry<br />

• Blockade of Cytotoxicity of T4-positive Cytotoxic T-Cell Clones (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

MIC2, see CD99<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-163-P0<br />

MS-163-P1<br />

MS-163-P<br />

MS-163-P1ABX<br />

MS-163-PABX<br />

MHC II (HLA-DR) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LN3<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Activated human peripheral blood<br />

mononuclear cells<br />

Molecular Weight: 36kDa (α-chain) and 27kDa<br />

(β-chain)<br />

Positive Control: Tonsil/lymph node<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

FFPE human tonsil stained with MHC II<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Microglobulin β -2 Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-133-P0<br />

MS-133-P1<br />

MS-133-P<br />

MS-133-P1ABX<br />

MS-133-PABX<br />

Host Species: Mouse<br />

Clone: 246-E8.E7; same as HLA-ABC-m2<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Does not react with primate cells. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Human PBL (T-ALL patient)<br />

Molecular Weight: 12kDa<br />

Positive Control: Jurkat cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Microtubule-Associated Protein, see MAP 2a,b<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-440-P0<br />

MS-440-P1<br />

MS-440-P<br />

MS-440-P1ABX<br />

MS-440-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

185


Microphthalmia (Transcription Factor) (MiTF) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Milk Fat Globule 1, Human (HMFG1) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: C5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Horse, Dog, Mouse and<br />

Rat. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: N-terminal fragment of human Mi protein<br />

Molecular Weight: 52-56kDa doublet<br />

Positive Control: 501 Mel cells, colo32 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

FFPE human melanoma stained with Microphthalmia<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-771-P0<br />

MS-771-P1<br />

MS-771-P<br />

MS-771-P1ABX<br />

MS-771-PABX<br />

Host Species: Mouse<br />

Clone: EDM45<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human.<br />

Does not react with rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Delipidated<br />

human milk fat globule<br />

membrane preparation<br />

Molecular Weight: 40-45kDa<br />

Positive Control: SKBR-3 cells;<br />

Breast, colon, or lung tissues<br />

Cellular Localization:<br />

Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE human colon stained with Milk Fat<br />

Globule Ab–1.<br />

anti–Milk Fat<br />

Globule 1, WB<br />

anti–Milk Fat anti–Milk Fat<br />

Globule 1, Native<br />

IP natured<br />

Globule 1, De-<br />

IP<br />

Microphthalmia (Transcription Factor) (MiTF) Ab-2, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Dog. Does not react<br />

with mouse and rat. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: N-terminal fragment of human Mi protein<br />

Molecular Weight: 52-56kDa doublet<br />

Positive Control: 501 Mel cells, Melanoma<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human melanoma stained with Microphthalmia<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-772-P0<br />

MS-772-P1<br />

MS-772-P<br />

MS-772-P1ABX<br />

MS-772-PABX<br />

MS-772-B0<br />

MS-772-B1<br />

MS-772-B<br />

MS-772-R7<br />

MS-772-PCS<br />

Format<br />

Quantity<br />

Purified Ab with BSA and Azide 100µL<br />

Purified Ab with BSA and Azide 500µL<br />

Purified Ab with BSA and Azide 1mL<br />

Ab without BSA/Azide (Frozen) 100µL<br />

Ab without BSA/Azide (Frozen) 200µL<br />

Biotinylated Ab with BSA and Azide 100µL<br />

Biotinylated Ab with BSA and Azide 500µL<br />

Biotinylated Ab with BSA and Azide 1mL<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

Positive Control for IHC<br />

5 Slides<br />

Positive Control Lysate<br />

100µL<br />

USA: RUO; Int'l: RUO<br />

Mismatch Repair Protein 2, see MSH2<br />

MiTF, see Microphthalmia<br />

Conc. Cat. No.<br />

200µg/mL MS-512-P0<br />

200µg/mL MS-512-P1<br />

200µg/mL MS-512-P<br />

1mg/mL MS-512-P1ABX<br />

1mg/mL MS-512-PABX<br />

200µg/mL MS-512-B0<br />

200µg/mL MS-512-B1<br />

200µg/mL MS-512-B<br />

n/a MS-512-R7<br />

n/a MS-512-PCS<br />

250µg/100µL MS-512-PCL<br />

186<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Mitochondria Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MTC0 2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Semi-purified mitochondrial<br />

preparation<br />

Molecular Weight: 60kDa<br />

Positive Control: HeLa cells, Liver<br />

Cellular Localization: Cytoplasmic FFPE human liver stained with Mitochondriaanti–Mitochon-<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Ab–2.<br />

dria Ab–2, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1372-P0<br />

200µg/mL MS-1372-P1<br />

200µg/mL MS-1372-P<br />

1mg/mL MS-1372-P1ABX<br />

1mg/mL MS-1372-PABX<br />

200µg/mL MS-1372-B0<br />

200µg/mL MS-1372-B1<br />

200µg/mL MS-1372-B<br />

n/a MS-1372-R7<br />

n/a MS-1372-PCS<br />

250µg/100µL MS-1372-PCL<br />

MMP-1 (Collagenase-1) Ab-6, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Does not<br />

react with cow. Others not known.<br />

Epitope: Middle region of MMP-1<br />

Immunogen: A synthetic peptide from the<br />

middle region of the human MMP-1<br />

Molecular Weight: 52kDa (unglycosylated)<br />

and 57kDa (glycosylated) species of<br />

proform of MMP-1 plus 42kDa<br />

(unglycosylated) and 47kDa (glycosylated)<br />

active form of MMP-1<br />

Positive Control: Conditioned, serum-free<br />

medium from (TPA-treated) HFL-1 cells;<br />

Placenta; Bladder, breast, ovarian, colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human placenta stained with MMP–1<br />

Ab–6.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–MMP–1<br />

(Collagenase–1)<br />

Ab–6, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1536-P0<br />

1mg/mL RB-1536-P1<br />

1mg/mL RB-1536-P<br />

1mg/mL RB-1536-P1ABX<br />

1mg/mL RB-1536-PABX<br />

n/a RB-1536-R7<br />

n/a RB-1536-PCS<br />

250µg/100µL RB-1536-PCL<br />

Mitochondrial Marker, see Prohibitin<br />

MMAC1, see PTEN<br />

MMP-2 (72kDa Collagenase IV) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CA-4001 or CA719E3C<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Epitope: N-terminal (APSPIIKFPGD-VAPKTDK)<br />

Immunogen: N-terminal peptide APSPIIKFPGD-VAPKTDK of procollagenase<br />

IV<br />

Molecular Weight: 72kDa (proform)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated)<br />

HFL-1 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Not suitable)<br />

• Inhibition of MMP-2 Activity<br />

anti–MMP–2<br />

(72kDa Collagenase<br />

IV)<br />

Ab–1, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-567-P0<br />

200µg/mL MS-567-P1<br />

200µg/mL MS-567-P<br />

1mg/mL MS-567-P1ABX<br />

1mg/mL MS-567-PABX<br />

200µg/mL MS-567-B0<br />

200µg/mL MS-567-B1<br />

200µg/mL MS-567-B<br />

250µg/100µL MS-567-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

187


MMP-2 (72kDa Collagenase IV) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: VB3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human native 72kDa MMP-2<br />

Molecular Weight: 72kDa (proform) and ~66kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from<br />

(TPA-treated) HFL-1 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not Suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–MMP–2 anti–MMP–2<br />

(72kDa Collagenase<br />

IV)<br />

(72kDa Colla-<br />

Ab–2, WB<br />

genase IV)<br />

Ab–2, Native<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-804-P0<br />

200µg/mL MS-804-P1<br />

200µg/mL MS-804-P<br />

1mg/mL MS-804-P1ABX<br />

1mg/mL MS-804-PABX<br />

200µg/mL MS-804-B0<br />

200µg/mL MS-804-B1<br />

200µg/mL MS-804-B<br />

250µg/100µL MS-804-PCL<br />

MMP-2 (72kDa Collagenase IV) Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A-Gel VC2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human APMA-activated native 72kDa MMP-2<br />

Molecular Weight: 72kDa (proform) and ~66kDa (active form)<br />

Positive Control: Placenta; Bladder, breast and ovarian CAs<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (not qualified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-806-P0<br />

MS-806-P1<br />

MS-806-P<br />

MS-806-P1ABX<br />

MS-806-PABX<br />

MS-806-B0<br />

MS-806-B1<br />

MS-806-B<br />

MMP-2 (72kDa Collagenase IV) Ab-7, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat and Cow. Others not known.<br />

Epitope: Second half of MMP-2<br />

Immunogen: A synthetic peptide from the second half of human MMP-2<br />

Molecular Weight: 72kDa (proform) and ~66kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated)<br />

HFl-1 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–MMP–2<br />

(72kDa Collagenase<br />

IV)<br />

Ab–7, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1537-P0<br />

1mg/mL RB-1537-P1<br />

1mg/mL RB-1537-P<br />

1mg/mL RB-1537-P1ABX<br />

1mg/mL RB-1537-PABX<br />

250µg/100µL RB-1537-PCL<br />

MMP-3 (Stromelysin-1) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SL-1 ID3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: APMA (4-Aminophenylmercuric acetate) activated Human<br />

stromelysin-1 (SL-1)<br />

Molecular Weight: 54/59kDa (proform) and 44/49kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from TPA-treated<br />

human endometrial cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not Suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–MMP–3<br />

(Stromelysin–1)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-809-P0<br />

200µg/mL MS-809-P1<br />

200µg/mL MS-809-P<br />

1mg/mL MS-809-P1ABX<br />

1mg/mL MS-809-PABX<br />

200µg/mL MS-809-B0<br />

200µg/mL MS-809-B1<br />

200µg/mL MS-809-B<br />

250µg/100µL MS-809-PCL<br />

188<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MMP-3 (Stromelysin-1) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SL-1 IID4<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: APMA (4-Aminophenylmercuric acetate) activated human<br />

stromelysin-1 (SL-1)<br />

Molecular Weight: 54/59kDa (proform) and 44/49kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from TPA-treated<br />

human endometrial cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Affinity Purification (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–MMP–3<br />

(Stromelysin–1)<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-810-P0<br />

200µg/mL MS-810-P1<br />

200µg/mL MS-810-P<br />

1mg/mL MS-810-P1ABX<br />

1mg/mL MS-810-PABX<br />

200µg/mL MS-810-B0<br />

200µg/mL MS-810-B1<br />

200µg/mL MS-810-B<br />

250µg/100µL MS-810-PCL<br />

MMP-7 (Matrilysin) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: ID2<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human matrilysin (PUMP-1)<br />

Molecular Weight: ~28kDa (proform) and ~18kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated) human SW620<br />

cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Affinity Purification<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-813-P0<br />

MS-813-P1<br />

MS-813-P<br />

MS-813-P1ABX<br />

MS-813-PABX<br />

MMP-9 (92kDa Collagenase IV), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Guinea<br />

Pig. Does not react with mouse, rat or<br />

bovine. Others not tested.<br />

Epitope: Near C-terminus<br />

Immunogen: A synthetic peptide derived<br />

from near C-terminal of human MMP-9<br />

protein<br />

Molecular Weight: 92kDa (proform) and<br />

~86kDa (active form)<br />

FFPE human placenta stained with MMP–9. anti–MMP–9<br />

Positive Control: Placenta, or Breast CA<br />

(92kDa Collagenase<br />

IV), WB<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9234-P0<br />

200µg/mL RB-9234-P1<br />

200µg/mL RB-9234-P<br />

n/a RB-9234-R7<br />

250µg/100µL RB-9234-PCL<br />

MMP-9 (92kDa Collagenase IV) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: GE-213<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Purified human MMP-9<br />

Molecular Weight: 92kDa (proform) and ~86kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated)<br />

human fibrosarcoma HT-1080 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen tissues)<br />

• Immunoprecipitation (Native verified)<br />

• Inhibition of MMP-9 Activity<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Human<br />

MMP–9<br />

(92kDa Collagenase<br />

IV)<br />

MAb, Native<br />

IP<br />

Cat. No.<br />

MS-569-P0<br />

MS-569-P1<br />

MS-569-P<br />

MS-569-P1ABX<br />

MS-569-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

189


MMP-9 (92kDa Collagenase IV) Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: IA5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human native 92kDa MMP-9<br />

Molecular Weight: 92kDa (proform) and ~86kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated) human<br />

fibrosarcoma HT-1080 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-816-P0<br />

MS-816-P1<br />

MS-816-P<br />

MS-816-P1ABX<br />

MS-816-PABX<br />

MMP-9 (92kDa Collagenase IV) Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: IIA5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Human native 92kDa MMP-9<br />

Molecular Weight: 92kDa (proform) and<br />

~86kDa (active form)<br />

Positive Control: Conditioned, serum-free<br />

medium from (TPA-treated) human<br />

fibrosarcoma HT-1080 cells or CCL4 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not optimum)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–MMP–9 (92kDa Collagenase IV) Ab–5, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-817-P0<br />

200µg/mL MS-817-P1<br />

200µg/mL MS-817-P<br />

1mg/mL MS-817-P1ABX<br />

1mg/mL MS-817-PABX<br />

200µg/mL MS-817-B0<br />

200µg/mL MS-817-B1<br />

200µg/mL MS-817-B<br />

250µg/100µL MS-817-PCL<br />

MMP-9 (92kDa Collagenase IV) Ab-9, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Guinea Pig. Does not react with mouse, rat and cow.<br />

Others not known.<br />

Epitope: Middle region of MMP-9<br />

Immunogen: A synthetic peptide from the middle region of human MMP-9<br />

Molecular Weight: 92kDa (proform) and ~86kDa (active form)<br />

Positive Control: Conditioned serum medium from (TPA-treated) HT-1080 cells;<br />

Placenta or Breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1539-P0<br />

RB-1539-P1<br />

RB-1539-P<br />

RB-1539-P1ABX<br />

RB-1539-PABX<br />

MMP-10 (Stromelysin-2) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: IVC5<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant MMP-10 (stromelysin-2<br />

protein)<br />

Molecular Weight: ~57kDa (proform) and ~44kDa (active<br />

form)<br />

Positive Control: Conditioned, serum-free medium from<br />

(TPA-treated) human large cell lymphoma U937 cells; Placenta; anti–MMP–10 anti–MMP–10<br />

Bladder, breast and ovarian CAs<br />

(Stromelysin–2) (Stromelysin–2)<br />

Cellular Localization: Cytoplasmic<br />

Ab–2, Native Ab–2, WB<br />

IP<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-822-P0<br />

200µg/mL MS-822-P1<br />

200µg/mL MS-822-P<br />

1mg/mL MS-822-P1ABX<br />

1mg/mL MS-822-PABX<br />

250µg/100µL MS-822-PCL<br />

190<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MMP-11 (Stromelysin-3) Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SL3.05<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human.<br />

Others not known.<br />

Immunogen: Recombinant<br />

protein corresponding to active<br />

form of human MMP-11<br />

Molecular Weight: ~60kDa<br />

(latent), ~47kDa (active) and<br />

~35kDa (degradation product)<br />

Positive Control: Recombinant<br />

MMP-11 protein; Placenta<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Affinity Purification (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human placenta stained with MMP–11<br />

Ab–5.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–MMP–11 anti–MMP–11<br />

(Stromelysin–3) (Stromelysin–3)<br />

Ab–5, Native Ab–5, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-1035-P0<br />

200µg/mL MS-1035-P1<br />

200µg/mL MS-1035-P<br />

1mg/mL MS-1035-P1ABX<br />

1mg/mL MS-1035-PABX<br />

200µg/mL MS-1035-B0<br />

200µg/mL MS-1035-B1<br />

200µg/mL MS-1035-B<br />

n/a MS-1035-R7<br />

n/a MS-1035-PCS<br />

250µg/100µL MS-1035-PCL<br />

MMP-13 (Collagenase-3) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: VIIIA2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and Rabbit. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant collagenase-3<br />

protein<br />

Molecular Weight: ~60kDa (proform) and ~48kDa<br />

(active form)<br />

Positive Control: Conditioned, serum-free medium<br />

from (TPA-treated) human chondrosarcoma SW1353<br />

cells; Placenta; Bladder, breast and ovarian CAs<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunoprecipitation (Native verified)<br />

• Affinity Purification (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human placenta stained with<br />

MMP–13 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-825-P0<br />

MS-825-P1<br />

MS-825-P<br />

MS-825-P1ABX<br />

MS-825-PABX<br />

MS-825-R7<br />

MS-825-PCS<br />

MMP-13 (Collagenase-3) (Anti-Rat) Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: LIPCO IID1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Rat and Mouse. Does not react with human.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Rat MMP-13 from BC-1 cells<br />

Molecular Weight: ~60kDa (proform) and ~48kDa (active form)<br />

Positive Control: Conditioned, serum-free medium from<br />

(TPA-treated) rat keratinocyte CCL-4 cells<br />

Cellular Localization: Cytoplasmic<br />

anti–MMP–13 anti–MMP–13<br />

Applications:<br />

(Collagenase–3)<br />

(An-<br />

(Collage-<br />

• Western Blotting<br />

nase–3) (Anti–Rat)<br />

Ab–3,<br />

ti–Rat) Ab–3,<br />

• Immunofluorescence<br />

Native IP WB<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-827-P0<br />

200µg/mL MS-827-P1<br />

200µg/mL MS-827-P<br />

1mg/mL MS-827-P1ABX<br />

1mg/mL MS-827-PABX<br />

200µg/mL MS-827-B0<br />

200µg/mL MS-827-B1<br />

200µg/mL MS-827-B<br />

250µg/100µL MS-827-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

191


MMP-13 (Collagenase-3) Ab-5, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant MMP-13 protein<br />

Molecular Weight: ~60kDa (proform) and ~48kDa (active form)<br />

Positive Control: CCL-4 medium<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Positive Control Lysate<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

anti–MMP–13<br />

(Collagenase–3)<br />

Ab–5, WB<br />

Conc. Cat. No.<br />

250µg/100µL RB-1681-PCL<br />

1mg/mL RB-1681-P0<br />

1mg/mL RB-1681-P1<br />

1mg/mL RB-1681-P<br />

1mg/mL RB-1681-P1ABX<br />

1mg/mL RB-1681-PABX<br />

MMP-14/MT1-MMP Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: Hemopexin-like domain<br />

Immunogen: A synthetic peptide from the hemopexin-like domain of human<br />

MMP-14/MT1-MMP<br />

Molecular Weight: ~66kDa (latent) and ~54kDa (active)<br />

Positive Control: Recombinant MMP-14 protein; Conditioned, serum-free<br />

medium from (TPA-treated ) HFL-1 cells<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

anti–MMP–14<br />

/<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

MT1–MMP<br />

Ab–2, WB<br />

Moesin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 38/87<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Moesin purified from cow<br />

uterus<br />

Molecular Weight: 78kDa moesin and<br />

80kDa radixin<br />

Positive Control: Raji cells; Placenta<br />

Cellular Localization: Membrane and<br />

cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured only)<br />

FFPE human placenta stained with Moesin anti–Moesin<br />

Ab–1.<br />

Ab–1, WB<br />

• Inhibits (40%) Binding of Proteoheparan to Smooth Muscle Cells<br />

• Inhibits Proliferation of Smooth Muscle Cells<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Motility-Related Protein 1, see CD9<br />

MPO, see Myeloperoxidase<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-727-P0<br />

200µg/mL MS-727-P1<br />

200µg/mL MS-727-P<br />

1mg/mL MS-727-P1ABX<br />

1mg/mL MS-727-PABX<br />

200µg/mL MS-727-B0<br />

200µg/mL MS-727-B1<br />

200µg/mL MS-727-B<br />

n/a MS-727-R7<br />

n/a MS-727-PCS<br />

250µg/100µL MS-727-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1545-P0<br />

RB-1545-P1<br />

RB-1545-P<br />

RB-1545-P1ABX<br />

RB-1545-PABX<br />

USA: RUO; Int'l: RUO<br />

192<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


MSH2 (Mismatch Repair Protein 2) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 25D12<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Recombinant human MSH2 protein<br />

Molecular Weight: ~102kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

MUC-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse<br />

Epitope: aa 239-255<br />

Immunogen: A synthetic peptide from cytoplasmic<br />

tail of human MUC-1 protein<br />

Molecular Weight: 265-400kDa<br />

Positive Control: MCF-7 cells; Breast CA<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

FFPE human tonsil stained with MSH2<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1498-S0<br />

MS-1498-S1<br />

MS-1498-S<br />

MS-1498-R7<br />

MS-1498-RQ<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human breast CA stained with<br />

MUC–1 antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9222-P0<br />

RB-9222-P1<br />

RB-9222-P<br />

RB-9222-R7<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

5 Slides<br />

n/a<br />

MS-1498-PCS<br />

MUC-1 Ab-5, Hamster Monoclonal Antibody<br />

MT1-MMP, see MMP-14<br />

MUC, see Mucin<br />

MUC-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM492<br />

Isotype: IgG1/k<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Human breast cell line ZR-75-1<br />

Molecular Weight: 265-400kDa<br />

Positive Control: Breast CA<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with<br />

MUC–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-10340-P0<br />

MS-10340-P1<br />

MS-10340-P<br />

MS-10340-R7<br />

MS-10340-PCS<br />

Host Species: Hamster<br />

Clone: MH1 (CT2)<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: aa 239-255<br />

Immunogen: A synthetic peptide corresponding to aa<br />

239-255 (SSLSYTNPAVAATSANL) from the cytoplasmic<br />

tail of MUC-1<br />

Molecular Weight: 14-28kDa<br />

Positive Control: MCF-7 cells; Breast CA<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with<br />

MUC–1 Ab–5.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

HM-1630-P0<br />

HM-1630-P1<br />

HM-1630-P<br />

HM-1630-P1ABX<br />

HM-1630-PABX<br />

HM-1630-R7<br />

HM-1630-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

193


Mucin 2 (MUC2) Ab-2, Mouse Monoclonal Antibody<br />

Mucin 3 (MUC3) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: M53<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding five<br />

tandem repeats of the human MUC2 apomucin<br />

Molecular Weight: 520kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Cytoplasmic and cell surface<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human small intestine stained with<br />

Mucin 2 Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1037-P0<br />

MS-1037-P1<br />

MS-1037-P<br />

MS-1037-R7<br />

MS-1037-RQ<br />

MS-1037-PCS<br />

MS-1037-P1ABX<br />

MS-1037-PABX<br />

Host Species: Mouse<br />

Clone: 1143/B7<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Tandem repeats of the human MUC3<br />

Immunogen: MUC3 tandem repeat peptide<br />

Molecular Weight: High<br />

Positive Control: Colon CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1734-P0<br />

MS-1734-P1<br />

MS-1734-P<br />

MS-1734-P1ABX<br />

MS-1734-PABX<br />

Mucin 5AC (MUC5AC)/Gastric Mucin Ab-1, Mouse Monoclonal<br />

Antibody<br />

†USA: IVD; Int'l: IVD<br />

Mucin 2 (MUC2) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 996/1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Tandem repeats of the human MUC2<br />

Immunogen: MUC2 tandem repeat peptide<br />

Molecular Weight: 520kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Host Species: Mouse<br />

Clone: 45M1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey, Rabbit, Cat,<br />

Mouse, Rat, Pig, Hedgehog and Chicken. Does not<br />

react with cow. Others not known.<br />

Epitope: Destroyed by β-mercaptoethanol and<br />

proteases but not by periodate treatment<br />

Immunogen: M1 mucin preparation from the fluid of<br />

an ovarian mucinous cyst belonging to an O Le(a-b-)<br />

patient<br />

Molecular Weight: >1000kDa<br />

Positive Control: Stomach<br />

Cellular Localization: Cytoplasmic and cell surface<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human stomach stained with Mucin<br />

5AC Ab–1.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1729-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1729-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1729-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1729-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

200µL<br />

1mg/mL<br />

MS-1729-PABX<br />

FFPE rat stomach stained with Mucin 5AC<br />

Ab–1.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-145-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-145-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-145-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-145-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

MS-145-RQ<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-145-PCS<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-145-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-145-PABX<br />

Biotinylated Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-145-B0<br />

Biotinylated Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-145-B1<br />

Biotinylated Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-145-B<br />

†USA: IVD; Int'l: IVD<br />

194<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Mucin 5AC (MUC5AC)/Gastric Mucin Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 1-13M1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Monkey, Rabbit, Cat,<br />

Mouse, Rat, Cow and Chicken. Does not react with<br />

pig and hedgehog. Others not known.<br />

Epitope: Destroyed by β-mercaptoethanol and<br />

proteases but not by periodate treatment<br />

Immunogen: M1 mucin preparation from the fluid of<br />

an ovarian mucinous cyst belonging to an O Le(a-b-)<br />

patient<br />

Molecular Weight: >1000kDa<br />

Positive Control: Stomach<br />

Cellular Localization: Cytoplasmic and cell surface<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

FFPE human stomach stained with Mucin<br />

5AC Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Mucin 6 (MUC-6) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CLH5<br />

Isotype: IgG1<br />

Species Reactivity: Human. Weakly react with Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Synthetic peptide of the tandem repeat<br />

sequence of human MUC-6 protein<br />

Positive Control: Stomach<br />

Cellular Localization: Cytoplasmic and cell surface<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Cat. No.<br />

MS-551-P0<br />

MS-551-P1<br />

MS-551-P<br />

MS-551-P1ABX<br />

MS-551-PABX<br />

MS-551-PCS<br />

FFPE human stomach stained with<br />

Mucin–6 Ab–1.<br />

Myelin Basic Protein Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Myelin basic protein isolated from human<br />

brain<br />

Positive Control: Brain<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin )<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Myeloid Cell Marker, see Granulocyte<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human brain stained with Myelin Basic<br />

Protein Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Myeloperoxidase (MPO), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human granulocytic MPO<br />

Positive Control: Tonsil or spleen<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Cat. No.<br />

RB-1460-A0<br />

RB-1460-A1<br />

RB-1460-A<br />

RB-1460-R7<br />

RB-1460-PCS<br />

IVD†<br />

FFPE rat spleen stained with Myeloperoxidase.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1153-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1153-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1153-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1153-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1153-PCS<br />

USA: RUO; Int'l: RUO<br />

µ-Heavy Chain, see IgM<br />

Format<br />

Quantity<br />

FFPE human tonsil stained with Myeloperoxidase.<br />

Conc.<br />

Cat. No.<br />

Muramidase, see Lysozyme<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

100µL<br />

500µL<br />

n/a<br />

n/a<br />

RB-373-A0<br />

RB-373-A1<br />

Muscle Cell Marker, see Desmin<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

1mL<br />

7mL<br />

n/a<br />

n/a<br />

RB-373-A<br />

RB-373-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

RB-373-RQ<br />

MVP, see LRP<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

RB-373-PCS<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

195


MyoD1 Ab-1, Mouse Monoclonal Antibody<br />

Myogenin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5.8A<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse, Rat, Chicken.<br />

Epitope: aa 180-189<br />

Immunogen: Recombinant mouse MyoD1 protein<br />

Molecular Weight: 45kDa<br />

Positive Control: SW80 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–MyoD1,<br />

Native IP<br />

Cat. No.<br />

MS-273-P0<br />

MS-273-P1<br />

MS-273-P<br />

MS-273-P1ABX<br />

MS-273-PABX<br />

Host Species: Mouse<br />

Clone: F5D<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Mouse, Rat and Cat. Does not<br />

react with quail. Others not<br />

known.<br />

Epitope: aa 138-158<br />

Immunogen: Recombinant<br />

protein containing rat myogenin<br />

aa 30-224<br />

FFPE human rhabdomyosarcoma stained<br />

Molecular Weight: 34kDa with Myogenin Ab–1.<br />

Positive Control: Rh30 cells,<br />

Rhabdomyosarcoma or Wilm's tumors<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Gel Supershift<br />

anti–Myogenin,<br />

Native<br />

IP<br />

anti–Myogenin,<br />

WB<br />

USA: RUO; Int'l: RUO<br />

MyoD1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5.2F<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse, Rat, Chicken. Others not known.<br />

Epitope: aa 3-56<br />

Immunogen: Recombinant mouse MyoD1 protein<br />

Molecular Weight: 45kDa<br />

Positive Control: SW80 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-278-P0<br />

MS-278-P1<br />

MS-278-P<br />

MS-278-P1ABX<br />

MS-278-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

Myogenin Ab-2, Mouse Monoclonal Antibody<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Host Species: Mouse<br />

Clone: F12B<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: aa 158-178<br />

Immunogen: Recombinant<br />

protein containing rat myogenin<br />

aa 30-224<br />

Molecular Weight: 34kDa FFPE human rhabdomyosarcoma stained<br />

Positive Control: Rh30 cells; with Myogenin Ab–2.<br />

Rhabdomyosarcoma or Wilm's<br />

Tumor<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Gel Supershift<br />

Cat. No.<br />

MS-1113-P0<br />

MS-1113-P1<br />

MS-1113-P<br />

MS-1113-P1ABX<br />

MS-1113-PABX<br />

MS-1113-R7<br />

anti–Myogenin anti–Myogenin<br />

Ab–2, Native Ab–2, WB<br />

IP<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1182-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1182-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1182-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1182-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-1182-PABX<br />

USA: RUO; Int'l: RUO<br />

196<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Myoglobin, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Purified human myoglobin<br />

Molecular Weight: 17.8kDa<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human skeletal muscle stained with<br />

Myoglobin antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9068-P0<br />

RB-9068-P1<br />

RB-9068-P<br />

RB-9068-R7<br />

Myosin, Skeletal Muscle Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MYSN02; same as MY-32<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Mouse, Rat, Rabbit,<br />

Chicken and Guinea pig.<br />

Epitope: Not determined<br />

Immunogen: Rabbit muscle myosin<br />

Molecular Weight: 480kDa<br />

Positive Control: Skeletal muscle<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human skeletal muscle stained with<br />

Myosin, skeletal muscle Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1236-S0<br />

MS-1236-S1<br />

MS-1236-S<br />

MS-1236-R7<br />

MS-1236-PCS<br />

Myosin, Smooth Muscle Heavy Chain Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SMMS-1<br />

Isotype: IgG1/k<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Crude human uterus extract<br />

Molecular Weight: 205kDa (MHC-1) and 200kDa<br />

(MHC-2)<br />

Positive Control: Uterus<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human uterus stained with Myosin,<br />

smooth muscle heavy chain Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1177-P0<br />

MS-1177-P1<br />

MS-1177-P<br />

MS-1177-R7<br />

MS-1177-RQ<br />

MS-1177-PCS<br />

MS-1177-P1ABX<br />

MS-1177-PABX<br />

Myosin, Smooth Muscle Heavy Chain Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SM-M10<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Cow. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Crude human uterus extract<br />

Molecular Weight: 205kDa (MHC-1) and 200kDa<br />

(MHC-2)<br />

Positive Control: Uterus<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not verified)<br />

FFPE human uterus stained with Myosin<br />

Smooth Muscle Ab–3.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1348-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1348-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1348-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1348-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-1348-PABX<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1348-PCS<br />

USA: RUO; Int'l: RUO<br />

Natural Killer Cell Marker, see CD57<br />

NCAM-1, see CD56<br />

NDF, see Heregulin<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

197


Negative Control for Mouse IgG1 Ab-1, Mouse Monoclonal<br />

Antibody<br />

Negative Control for Mouse IgG2b Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: NCG01<br />

Isotype: IgG1/κ<br />

Species Reactivity: All species.<br />

Applications:<br />

Negative control for:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• ELISA<br />

• Gel Supershift<br />

Host Species: Mouse<br />

Clone: NCG2B.01<br />

Isotype: IgG2b/κ<br />

Species Reactivity: All species.<br />

Applications:<br />

Negative control for:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• ELISA<br />

• Gel Supershift<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

NC-748-P0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

NC-1391-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

NC-748-P1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

NC-1391-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

NC-748-P<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

NC-1391-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

NC-748-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

NC-1391-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

NC-748-PABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

NC-1391-PABX<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

NC-748-R7<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

NC-1391-R7<br />

USA: RUO; Int'l: RUO<br />

USA: RUO; Int'l: RUO<br />

Negative Control for Mouse IgG2a Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: NCG2A.01<br />

Isotype: IgG2a/κ<br />

Species Reactivity: All species.<br />

Applications:<br />

Negative control for:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• ELISA<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

NC-1390-P0<br />

NC-1390-P1<br />

NC-1390-P<br />

NC-1390-P1ABX<br />

NC-1390-PABX<br />

NC-1390-B0<br />

NC-1390-B1<br />

NC-1390-B<br />

NC-1390-R7<br />

Negative Control for Rabbit IgG Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Applications:<br />

Negative control for:<br />

• <strong>Immunohistochemistry</strong> (Frozen and formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

• ELISA<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

neu, see HER-2<br />

Neuregulin, see Heregulin<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

NC-100-P0<br />

NC-100-P1<br />

NC-100-P<br />

NC-100-P1ABX<br />

NC-100-PABX<br />

NC-100-R7<br />

USA: RUO; Int'l: RUO<br />

198<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Neurofilament (200kDa & 68kDa) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 2F11<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Rabbit, Cat,<br />

Mouse and Rat. Does not react with dog.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Neurofilament purified from<br />

human brain<br />

Molecular Weight: 68 and 200kDa<br />

(phosphorylated forms of thsese subunits)<br />

Positive Control: IMR-5 cells, Brain<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

FFPE human cerebellum stained with Neuro-anti–Neurofilafilament<br />

Ab–1.<br />

ment (200kDa<br />

and 68kDa)<br />

Ab–1, Native<br />

IP<br />

FFPE rat cerebellum stained with Neurofila-anti–Neurofilament<br />

Ab–1.<br />

ment (200kDa<br />

and 68kDa)<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

n/a MS-359-S0<br />

n/a MS-359-S1<br />

n/a MS-359-S<br />

n/a MS-359-R7<br />

n/a MS-359-PCS<br />

250µg/100µL MS-359-PCL<br />

Neurotrophin Receptor/NGF-Receptor (p75 NGFR ) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: NGFR5<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Monkey (Cebus apella, Macaca fascicularis, mulatta, and<br />

nemestrina), Baboon (Papio anubis and Cynocephalus), Cat, Rabbit, Ferret. Does not<br />

react with mouse and rat.<br />

Epitope: aa 1-160<br />

Immunogen: NGFR from A875 melanoma cells<br />

Molecular Weight: 75kDa<br />

Positive Control: Melanoma<br />

Cellular Localization: Cell surface and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Inhibits Binding of NGF to Melanoma Cells<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Neutral Endopeptidase, see CD10<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

NFκ B/p65 (Rel A), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Rat and<br />

Rabbit. Others not tested.<br />

Epitope: Internal domain<br />

Immunogen: A synthetic peptide<br />

corresponding to internal domain of human<br />

NFκB/p65<br />

Molecular Weight: 65kDa<br />

Positive Control: Prostate gland and<br />

placenta<br />

FFPE human placenta stained with<br />

Cellular Localization: Cytoplasmic NFkB/p65 antibody.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Cat. No.<br />

MS-394-P0<br />

MS-394-P1<br />

MS-394-P<br />

MS-394-P1ABX<br />

MS-394-PABX<br />

MS-394-B0<br />

MS-394-B1<br />

MS-394-B<br />

anti–NF kappa<br />

B / p65 (Rel<br />

A), WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9034-P0<br />

RB-9034-P1<br />

RB-9034-P<br />

RB-9034-R7<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

199


NFκ B/p65 (Rel A) Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat,<br />

Hamster, Rabbit, Cow, Pig, Dog, Drosophila,<br />

Xenopus. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the<br />

C-terminus of human NFκB protein<br />

Molecular Weight: 65kDa<br />

Positive Control: Jurkat cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab Without BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

NGF-Receptor, see Neurotrophin Receptor<br />

FFPE human placenta stained with NFK/p65anti–NFkap-<br />

paB/p65 (Rel<br />

Ab–1.<br />

A) Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1638-P0<br />

1mg/mL RB-1638-P1<br />

1mg/mL RB-1638-P<br />

1mg/mL RB-1638-P1ABX<br />

1mg/mL RB-1638-PABX<br />

n/a RB-1638-R7<br />

n/a RB-1638-PCS<br />

250µg/100µL RB-1638-PCL<br />

Nitric Oxide Synthase, endothelial (eNOS), Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Dog, Pig and<br />

Cow. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from<br />

C-ternimal of human eNOS<br />

Molecular Weight: 135kDa<br />

Positive Control: Capillary endothelium, regenerating<br />

endothelium<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human lung CA stained with eNOS<br />

antibody.<br />

Nitric Oxide Synthase, inducible (iNOS), Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Rat, Mouse and Human. Others<br />

not tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from<br />

C-ternimal of mouse iNOS<br />

Molecular Weight: 130kDa<br />

Positive Control: Lung<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human lung stained with iNOS antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9242-P0<br />

RB-9242-P1<br />

RB-9242-P<br />

RB-9242-R7<br />

Nitric Oxide Synthase, inducible (iNOS) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Rat, Mouse and Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the C-terminus of iNOS from activated<br />

mouse macrophages<br />

Molecular Weight: 130kDa<br />

Postitive Control: Rat lung<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1605-P0<br />

RB-1605-P1<br />

RB-1605-P<br />

RB-1605-P1ABX<br />

RB-1605-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9279-P0<br />

RB-9279-P1<br />

RB-9279-P<br />

RB-9279-R7<br />

USA: RUO; Int'l: RUO<br />

200<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Notch-1 Ab-1, Mouse Monoclonal Antibody<br />

Oct-2, Rabbit Polyclonal Antibody<br />

Host Species: Mouse<br />

Clone: A6<br />

Isotype: IgG2b<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: Ligand binding region<br />

Immunogen: Recombinant protein encoding the ligand binding region of human Notch-1<br />

Molecular Weight: 290kDa<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Immunoprecipitation (Not verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1339-P0<br />

MS-1339-P1<br />

MS-1339-P<br />

MS-1339-P1ABX<br />

MS-1339-PABX<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide derived from<br />

C-terminus of human Oct-2<br />

Molecular Weight: ~80kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human tonsil stained with Oct–2.<br />

Conc. Cat. No.<br />

200µg/mL RB-9297-P0<br />

200µg/mL RB-9297-P1<br />

200µg/mL RB-9297-P<br />

n/a RB-9297-R7<br />

NPM, see Nucleophosmin<br />

ODC, see Ornithine Decarboxylase<br />

NSE, see Neuron Specific Enolase<br />

Oligodendrocyte and Schwann Cell Marker, see CNPase Ab-1<br />

Nucleophosmin (NPM) Ab-1, Mouse Monoclonal Antibody<br />

O-methylguanine-DNA Methyltransferase, see MGMT<br />

Host Species: Mouse<br />

Clone: NA24<br />

Isotype: IgG/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: GST fusion protein containing the<br />

N-terminal part of nucleophosmin fused to 14aa of<br />

ALK protein<br />

Molecular Weight: 38kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control For IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with NPM<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1849-P0<br />

MS-1849-P1<br />

MS-1849-P<br />

MS-1849-P1ABX<br />

MS-1849-PABX<br />

MS-1849-R7<br />

MS-1849-PCS<br />

Opsin, see Rhodopsin<br />

Ornithine Decarboxylase (ODC) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MP16-2<br />

Isotype: IgG1<br />

Species Reactivity: Human, Rat, and Mouse. Because epitope of MAb MP16-2<br />

(-IWGPTC-) is present in all known eukaryotic ODC sequences, it should react with ODC<br />

from other eukaryotes also.<br />

Epitope: aa 355-360 (-IWGPTC-). It is associated with active site of ODC or a locus in<br />

its direct vicinity.<br />

Immunogen: A synthetic hexadecapeptide (KPDEKYYSSSIWGPTC) (aa 345-360) from<br />

rat ODC<br />

Molecular Weight: 53kDa<br />

Positive Control: Epithelial cells in normal placenta or prostate CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Frozen only)<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-464-P0<br />

MS-464-P1<br />

MS-464-P<br />

MS-464-P1ABX<br />

MS-464-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

201


Osteopontin, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Pig and Dog.<br />

Others not tested.<br />

Epitope: Internal domain<br />

Immunogen: A synthetic peptide derived<br />

from internal domain of human Osteopontin<br />

Molecular Weight: 34kDa<br />

Positive Control: Jurkat cells; Gastric CA<br />

or Osteosarcoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human osteosarcoma stained with<br />

Osteopontin.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

p14 ARF /p16β Ab-1, Rabbit Polyclonal Antibody<br />

anti–Osteopontin,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL RB-9097-P0<br />

200µg/mL RB-9097-P1<br />

200µg/mL RB-9097-P<br />

n/a RB-9097-R7<br />

250µg/100µL RB-9097-PCL<br />

p14 ARF /p16β Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 14P02; same as DCS-240<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant p14 ARF protein<br />

Molecular Weight: 14kDa<br />

Positive Control: HT-29 or HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not optimum)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–p14ARF/<br />

p16beta<br />

Ab–2, Native<br />

IP<br />

anti–p14ARF/<br />

p16beta<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-850-P0<br />

200µg/mL MS-850-P1<br />

200µg/mL MS-850-P<br />

1mg/mL MS-850-P1ABX<br />

1mg/mL MS-850-PABX<br />

250µg/100µL MS-850-PCL<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: aa 119-132<br />

Immunogen: A synthetic peptide, corresponding to aa 119-132<br />

(Cys-GRARCLGPSARGPG) from the C-terminus of human p14 ARF<br />

Molecular Weight: 14kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab without BSA and Azide<br />

Purified Ab without BSA and Azide<br />

Positive Control for Western Blot<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-045-P0<br />

1mg/mL RB-045-P1<br />

1mg/mL RB-045-P<br />

1mg/mL RB-045-P1ABX<br />

1mg/mL RB-045-PABX<br />

250µg/100µL RB-045-PCL<br />

p15 INK4b Ab-3, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Mouse and Rat. Does not react with human. Others not known.<br />

Epitope: aa 117-130<br />

Immunogen: A synthetic peptide corresponding to aa 117-130 (HRDIARYLHAATGD)<br />

from the C-terminus of MOUSE p15 INK4b<br />

Molecular Weight: 15kDa<br />

Positive Control: 3T3-L1 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not verified)<br />

• Kinase Assay (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab wthout BSA/Azide (Frozen)<br />

Ab Without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-028-P0<br />

RB-028-P1<br />

RB-028-P<br />

RB-028-P1ABX<br />

RB-028-PABX<br />

p16β, see p14 ARF<br />

202<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


p18 INK4c Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 18P118; same as<br />

DCS-118<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified<br />

recombinant p18 INK4c protein<br />

Molecular Weight: 18kDa<br />

Positive Control: HeLa cells;<br />

Tonsil, skeletal muscle, heart,<br />

pancreas<br />

Cellular Localization:<br />

Cytoplasmic and Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

FFPE human tonsil stained with p18 Ab–3. anti–p18INK4c<br />

Ab–3, Native<br />

IP<br />

anti–p18INK4c<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-858-P0<br />

200µg/mL MS-858-P1<br />

200µg/mL MS-858-P<br />

1mg/mL MS-858-P1ABX<br />

1mg/mL MS-858-PABX<br />

n/a MS-858-R7<br />

n/a MS-858-PCS<br />

250µg/100µL MS-858-PCL<br />

p21 WAF1 (Anti-Mouse) Ab-9, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Mouse and Rat. Does not react with human.<br />

Others not known.<br />

Epitope: aa 2-14<br />

Immunogen: A synthetic peptide corresponding to aa 2-14<br />

(SNPGDVR-PVPHRSK) from the N-terminus of Mouse p21 WAF1<br />

Molecular Weight: 21kDa<br />

Positive Control: NIH3T3 or MAD109 cells; Colon<br />

Cellular Localization: Nuclear<br />

Applications:<br />

anti–p21WAFti–p21WAF1<br />

an-<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

(Anti–Mouse) (Anti–Mouse)<br />

• Western Blotting (Not suitable)<br />

Ab–9, Native Ab–9, Denatured<br />

• Immunoprecipitation (Native and denatured)<br />

• Kinase Assay<br />

IP<br />

IP<br />

p21 WAF1 Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-60.2<br />

Isotype: IgG2a<br />

Species Reactivity: Human.<br />

Does not react with mouse and<br />

rat. Others not known<br />

Epitope: Not determined<br />

Immunogen: Full-length human<br />

recombinant p21 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: Ls174T or<br />

Raji cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

FFPE human colon CA stained with p21<br />

Ab–3.<br />

anti–p21WAF1<br />

Ab–3, Denatured<br />

IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

IVD†<br />

anti–p21WAF1<br />

anti–p21WAF1<br />

Ab–3, Native Ab–3, Native<br />

IP IP<br />

Cat. No.<br />

MS-230-P0<br />

MS-230-P1<br />

MS-230-P<br />

MS-230-R7<br />

MS-230-PCS<br />

MS-230-P1ABX<br />

MS-230-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-032-P0<br />

RB-032-P1<br />

RB-032-P<br />

RB-032-P1ABX<br />

RB-032-PABX<br />

RB-032-R7<br />

RB-032-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

203


p21 WAF1 Ab-5, Mouse Monoclonal Antibody<br />

p21 WAF1 Ab-11, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HZ52<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Cow, Mouse, and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Full-length human<br />

recombinant p21 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: Ls174T or Raji<br />

cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunoprecipitation<br />

• Flow Cytometry<br />

FFPE human colon CA stained with p21<br />

Ab–5.<br />

anti–p21WAFti–p21WAF1<br />

an-<br />

MAb, Native IP MAb, Native IP<br />

Host Species: Mouse<br />

Clone: CP74<br />

Isotype: IgG2b<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: aa 1-80<br />

Immunogen: Full-length human<br />

recombinant p21 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: Raji, PC12 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Flow Cytometry<br />

FFPE human colon CA stained with p21<br />

Ab–11.<br />

anti–p21WAF1<br />

Ab–11, Native<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

p21 WAF1 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: HJ21; same as WA-1<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant p21 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: PC12, Ls174T or Raji cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Not suitable)<br />

• Flow Cytometry (Not Suitable)<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-387-P0<br />

MS-387-P1<br />

MS-387-P<br />

MS-387-P1ABX<br />

MS-387-PABX<br />

MS-387-R7<br />

MS-387-PCS<br />

anti–p21WAF1<br />

Ab–6, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–p21WAF1 Ab–11, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-891-P0<br />

200µg/mL MS-891-P1<br />

200µg/mL MS-891-P<br />

1mg/mL MS-891-P1ABX<br />

1mg/mL MS-891-PABX<br />

200µg/mL MS-891-B0<br />

200µg/mL MS-891-B1<br />

200µg/mL MS-891-B<br />

250µg/100µL MS-891-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-454-P0<br />

200µg/mL MS-454-P1<br />

200µg/mL MS-454-P<br />

1mg/mL MS-454-P1ABX<br />

1mg/mL MS-454-PABX<br />

250µg/100µL MS-454-PCL<br />

204<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


p27 Kip1 Ab-1, Mouse Monoclonal Antibody<br />

p53, Rabbit Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DCS-72.F6<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse, Rat, and Dog.<br />

Does not react with cow. Others not known.<br />

Epitope: aa 83-197<br />

Immunogen: Mouse recombinant p27 protein<br />

Molecular Weight: 27kDa<br />

Positive Control: MAD109, Ls174T cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Flow Cytometry<br />

anti–p27Kip1<br />

Ab–1, Native<br />

IP<br />

anti–p27Kip1 anti–p27Kip1<br />

Ab–1, Denatured<br />

Ab–1, WB<br />

IP<br />

Host Species: Rabbit<br />

Clone: SP5<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human full-length wild<br />

type p53 protein<br />

Molecular Weight: 53kDa<br />

Positive Control: MDA-231 cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

IVD†<br />

RabbitMAb<br />

FFPE human colon CA stained with p53.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-256-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-256-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-256-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-256-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

1mg/mL MS-256-PABX<br />

200µg/mL MS-256-B0<br />

200µg/mL MS-256-B1<br />

200µg/mL MS-256-B<br />

250µg/100µL MS-256-PCL<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human breast CA stained with p53.<br />

Conc. Cat. No.<br />

n/a RM-9105-S0<br />

n/a RM-9105-S1<br />

n/a RM-9105-S<br />

n/a RM-9105-R7<br />

p34, see RPA<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

12mL<br />

n/a<br />

RM-9105-RQ<br />

p34 cdc2 , see Cdk1<br />

p53, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: Y5<br />

Species Reactivity: Human.Others not known.<br />

Immunogen: A synthetic peptide derived from N-<br />

terminal residues of human p53<br />

Molecular Weight: 53kDa<br />

Positive Control: Colon or Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

FFPE human breast CA stained with p53.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

RM-2103-S0<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

RM-2103-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RM-2103-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

RM-2103-RQ<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

205


p53 Ab-1, Mouse Monoclonal Antibody<br />

p53 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PAb 240<br />

Isotype: IgG1<br />

Species Reactivity: Human.<br />

Others not known.<br />

Epitope: aa 212-217<br />

Immunogen: Murine p53<br />

protein corresponding to aa<br />

14-289<br />

Molecular Weight: 53kDa<br />

Positive Control: MDA-231 or<br />

SKBR-3 cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Methacarn or<br />

formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry<br />

FFPE human colon CA stained with p53<br />

Ab–1.<br />

anti–p53<br />

Ab–1, WB<br />

anti–p53<br />

Ab–1, Native<br />

IP<br />

anti–p53<br />

Ab–1, Denatured<br />

IP<br />

Host Species: Mouse<br />

Clone: PAb 122<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human, Monkey, Mouse, Rat, and Hamster. Others<br />

not known.<br />

Epitope: aa 370-378<br />

Immunogen: SV40-transformed mouse B4 cells<br />

Molecular Weight: 53kDa<br />

Positive Control: MDA-231 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–p53<br />

Mab, Denatured<br />

IP<br />

Cat. No.<br />

MS-182-P0<br />

MS-182-P1<br />

MS-182-P<br />

MS-182-P1ABX<br />

MS-182-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

p53 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PAb 1801<br />

Isotype: IgG1<br />

Species Reactivity: Human specific.<br />

Epitope: aa 32-79<br />

Immunogen: Recombinant human p53 protein<br />

Molecular Weight: 53kDa<br />

Positive Control: SKBR-3 cells, MDA-231 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-104-P0<br />

200µg/mL MS-104-P1<br />

200µg/mL MS-104-P<br />

1mg/mL MS-104-P1ABX<br />

1mg/mL MS-104-PABX<br />

n/a MS-104-R7<br />

n/a MS-104-PCS<br />

250µg/100µL MS-104-PCL<br />

anti–p53<br />

Ab–2, Native<br />

IP<br />

anti–p53<br />

Ab–2, Denatured<br />

IP<br />

anti–p53<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-105-P0<br />

200µg/mL MS-105-P1<br />

200µg/mL MS-105-P<br />

1mg/mL MS-105-P1ABX<br />

1mg/mL MS-105-PABX<br />

250µg/100µL MS-105-PCL<br />

p53 Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DO-7<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human,<br />

Monkey, Cow. Others not<br />

known.<br />

Epitope: aa 37-45<br />

Immunogen: Recombinant<br />

human wild-type p53 protein<br />

expressed in E. coli<br />

Molecular Weight: 53kDa<br />

Positive Control: SKBR-3 or<br />

MDA-231 cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

FFPE human colon CA stained with p53<br />

Ab–5.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

anti–p53<br />

Ab–5, Denatured<br />

IP<br />

IVD†<br />

anti–p53<br />

Ab–5, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-186-P0<br />

200µg/mL MS-186-P1<br />

200µg/mL MS-186-P<br />

n/a MS-186-R7<br />

n/a MS-186-RQ<br />

n/a MS-186-PCS<br />

250µg/100µL MS-186-PCL<br />

1mg/mL MS-186-P1ABX<br />

1mg/mL MS-186-PABX<br />

200µg/mL MS-186-B0<br />

200µg/mL MS-186-B1<br />

200µg/mL MS-186-B<br />

206<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


p53 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DO-1<br />

Isotype: IgG2a<br />

Species Reactivity: Human,<br />

Monkey and Cow. Reacts<br />

weakly with Mouse and Rat.<br />

Others not known.<br />

Epitope: aa 11-25<br />

Immunogen: Recombinant<br />

human wild-type p53 protein<br />

expressed in E. coli<br />

Molecular Weight: 53kDa<br />

Positive Control: SKBR-3 cells<br />

or MDA-231 cells, Colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry<br />

• Gel Supershift Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human colon CA stained with p53<br />

Ab–6.<br />

anti–p53<br />

Ab–6, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

100µL<br />

anti–p53<br />

Ab–6, Native<br />

IP<br />

anti–p53<br />

Ab–6, Denatured<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-187-P0<br />

200µg/mL MS-187-P1<br />

200µg/mL MS-187-P<br />

1mg/mL MS-187-P1ABX<br />

1mg/mL MS-187-PABX<br />

n/a MS-187-PCS<br />

250µg/100µL MS-187-PCL<br />

p53 Ab-8, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DO-7 + BP53-12<br />

Isotype: IgG2b + IgG2a<br />

Species Reactivity: Human.<br />

Others not known.<br />

Epitope: aa 37-45 and aa<br />

20-25<br />

Immunogen: Recombinant<br />

human p53 protein<br />

Molecular Weight: 53kDa<br />

Positive Control: MDA-231,<br />

SKBR-3 cells or Colon CA<br />

Cellular Localization: Nuclear FFPE human colon CA stained with p53<br />

Ab–8.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

p56 lck , see LCK<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

anti–p53<br />

Ab–8, Native<br />

IP<br />

IVD†<br />

anti–p53<br />

Ab–8, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-738-P0<br />

200µg/mL MS-738-P1<br />

200µg/mL MS-738-P<br />

n/a MS-738-R7<br />

n/a MS-738-PCS<br />

250µg/100µL MS-738-PCL<br />

1mg/mL MS-738-P1ABX<br />

1mg/mL MS-738-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

207


p57 Kip2 Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: KP39<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Mouse.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human p57 Kip2<br />

protein<br />

Molecular Weight: 57kDa<br />

Positive Control: LS174T cells, Colon CA<br />

or placenta<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

FFPE human colon CA stained with p57 Kip2 anti–p57Kip2,<br />

Ab–3.<br />

Native IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

p57 Kip2 Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 57P06; same as KP10<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human and Mouse.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human p57 Kip2<br />

protein<br />

Molecular Weight: 57kDa<br />

Positive Control: LS174T cells, Colon CA<br />

or placenta<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

FFPE human colon CA stained with p57<br />

Ab–6.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-897-P0<br />

MS-897-P1<br />

MS-897-P<br />

MS-897-PCS<br />

MS-897-P1ABX<br />

MS-897-PABX<br />

MS-897-B0<br />

MS-897-B1<br />

MS-897-B<br />

IVD†<br />

anti–p57Kip2<br />

Ab–6, Native<br />

IP<br />

Cat. No.<br />

MS-1062-P0<br />

MS-1062-P1<br />

MS-1062-P<br />

MS-1062-R7<br />

MS-1062-RQ<br />

MS-1062-PCS<br />

MS-1062-P1ABX<br />

MS-1062-PABX<br />

p57 Kip2 Ab-7, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Cow and Mouse. Others<br />

not known.<br />

Epitope: Near C-terminus<br />

Immunogen: A synthetic peptide from human p57 Kip2<br />

protein<br />

Molecular Weight: 57kDa<br />

Positive Control: Colon CA or placenta<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

p59 fyn , see Fyn<br />

p65 (Rel A), see NFκB<br />

p70 (Replication Protein A), see RPA<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

p73α /β Ab-2, Mouse Monoclonal Antibody<br />

FFPE human colon CA stained with p57<br />

Ab–7.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1637-P0<br />

RB-1637-P1<br />

RB-1637-P<br />

RB-1637-P1ABX<br />

RB-1637-PABX<br />

RB-1637-R7<br />

RB-1637-PCS<br />

Host Species: Mouse<br />

Clone: ER-15<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Monkey. Others not known.<br />

Epitope: aa 380-637 (p73α)<br />

Immunogen: Purified monkey recombinant p73α protein (aa 380-637)<br />

Molecular Weight: 80kDa (p73α) and 70kDa (p73β)<br />

Positive Control: COS monkey kidney cells and IM9 human myeloma cells; SK-N-AS<br />

human neuroblastoma cells lack p73α/β<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

p75 NGFR , see Neurotrophin Receptor<br />

p80, see ALK<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-762-P0<br />

MS-762-P1<br />

MS-762-P<br />

MS-762-P1ABX<br />

MS-762-PABX<br />

208<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


p81, see Ezrin<br />

p130 Cas Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CAS-14; same as 35B-1A4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human p130 Cas<br />

protein<br />

Molecular Weight: 130kDa<br />

Positive Control: MCF-7 Cells, HUVEC<br />

cells, Tonsil or breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

FFPE rat breast CA stained with p130 Ab–1. anti–p130Cas<br />

Ab–1, WB<br />

p130/Rb2 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 130P215; same as DCS-215<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: aa 878-913<br />

Immunogen: A synthetic peptide from<br />

p130 corresponding to aa 878-913<br />

Molecular Weight: 130kDa<br />

Positive Control: A427 cells, Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

FFPE human colon CA stained with p130<br />

Ab–2.<br />

anti–p130/Rb2<br />

Ab–2, Denatured<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

FFPE human breast CA stained with p130 anti–p130Cas<br />

Ab–1.<br />

Ab–1, Denatured<br />

IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-855-P0<br />

200µg/mL MS-855-P1<br />

200µg/mL MS-855-P<br />

1mg/mL MS-855-P1ABX<br />

1mg/mL MS-855-PABX<br />

200µg/mL MS-855-B0<br />

200µg/mL MS-855-B1<br />

200µg/mL MS-855-B<br />

n/a MS-855-R7<br />

n/a MS-855-PCS<br />

250µg/100µL MS-855-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE rat spleen stained with p130 Ab–2.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–p130/Rb2<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-866-P0<br />

200µg/mL MS-866-P1<br />

200µg/mL MS-866-P<br />

1mg/mL MS-866-P1ABX<br />

1mg/mL MS-866-PABX<br />

n/a MS-866-R7<br />

n/a MS-866-PCS<br />

250µg/100µL MS-866-PCL<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

209


p170/p-Glycoprotein/MDR Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: F4<br />

Isotype: IgG1<br />

Species Reactivity: Human, Chinese Hamster. Does not react with mouse. Others not<br />

known.<br />

Epitope: Extracellular amino terminal half. This epitope is resistant to formalin fixation<br />

and periodate oxidation and is different from those of other commonly known MAbs to<br />

p-glycoprotein, such as C219, JSB-1, and MRK16, which recognize an intracellular<br />

and extracellular epitope of p-glycoprotein, respectively.<br />

Immunogen: Human and hamster drug-resistant viable cells followed by crude plasma<br />

membranes<br />

Molecular Weight: 170kDa<br />

Positive Control: Drug-resistant cells, Kidney or breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry (Fixed cells only)<br />

p300/CBP (CREB-Binding Protein) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: NM11<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human, Monkey, Mink, Mouse,<br />

and Rat. Others not known.<br />

Epitope: aa 2071-2091<br />

Immunogen: E1A affinity purified p300 protein<br />

Molecular Weight: 300kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

FFPE rat spleen stained with p300 Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

p170/p-Glycoprotein/MDR (Anti-Hamster) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Cat. No.<br />

MS-660-P0<br />

MS-660-P1<br />

MS-660-P<br />

MS-660-P1ABX<br />

MS-660-PABX<br />

Host Species: Mouse<br />

Clone: 265/F4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Chinese Hamster. Does not react with human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Colchicine-resistant viable Chinese Hamster Ovary (CHO) cells, followed<br />

by purified p170 glycoprotein from CHO cells<br />

Molecular Weight: 170kDa<br />

Positive Control: Drug-resistant Chinese Hamster Ovary (CHO) cells<br />

Cellular Localization: Cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Acetone-fixed frozen)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

Format<br />

Quantity<br />

Purified Ab with BSA and Azide 100µL<br />

Purified Ab with BSA and Azide 500µL<br />

Purified Ab with BSA and Azide 1mL<br />

Ab without BSA/Azide (Frozen) 100µL<br />

Ab without BSA/Azide (Frozen) 200µL<br />

Biotinylated Ab with BSA and Azide 100µL<br />

Biotinylated Ab with BSA and Azide 500µL<br />

Biotinylated Ab with BSA and Azide 1mL<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

Positive Control for IHC<br />

5 Slides<br />

USA: RUO; Int'l: RUO<br />

p300-Interacting Transactivator 1, see CITED1<br />

FFPE human tonsil stained with p300 Ab–1.<br />

Conc. Cat. No.<br />

200µg/mL MS-586-P0<br />

200µg/mL MS-586-P1<br />

200µg/mL MS-586-P<br />

1mg/mL MS-586-P1ABX<br />

1mg/mL MS-586-PABX<br />

200µg/mL MS-586-B0<br />

200µg/mL MS-586-B1<br />

200µg/mL MS-586-B<br />

n/a MS-586-R7<br />

n/a MS-586-PCS<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-190-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-190-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-190-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-190-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-190-PABX<br />

USA: RUO; Int'l: RUO<br />

210<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


p504s/AMACR, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: 13H4<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Human p504s/AMACR polypeptide<br />

Molecular Weight: ~45kDa<br />

Positive Control: Prostate carcinoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: ASR; Int'l: RUO<br />

PAN-LCA, see CD45<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

RabbitMAb<br />

FFPE human prostate CA stained with<br />

p504s.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9130-A0<br />

RM-9130-A1<br />

RM-9130-A<br />

RM-9130-R7<br />

RM-9130-RQ<br />

RM-9130-PCS<br />

Parathyroid Hormone Receptor (PTH-Receptor) Type 1 Ab-1,<br />

Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3D1.1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 146-169<br />

Immunogen: A 23 amino acid peptide of the<br />

hPTH/PTHrP receptor which is not shared by the type<br />

II receptor<br />

Molecular Weight: 80 and 160kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with PTH–R<br />

Type–1 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1270-P0<br />

MS-1270-P1<br />

MS-1270-P<br />

MS-1270-P1ABX<br />

MS-1270-PABX<br />

MS-1270-R7<br />

MS-1270-PCS<br />

PARP (Poly ADP-Ribose Polymerase) Ab-2, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic<br />

peptide for the N-terminal<br />

region of human PARP<br />

Molecular Weight: 116kDa<br />

Positive Control: Raji cells,<br />

Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin only)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with PARP Ab–2. anti–PARP anti–PARP<br />

(Poly ADP–Ri- (Poly ADP–Ribose<br />

Polymerase)<br />

bose Poly-<br />

merase)<br />

Ab–2, Denatured<br />

Ab–2, WB<br />

IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1516-P0<br />

1mg/mL RB-1516-P1<br />

1mg/mL RB-1516-P<br />

1mg/mL RB-1516-P1ABX<br />

1mg/mL RB-1516-PABX<br />

n/a RB-1516-R7<br />

n/a RB-1516-PCS<br />

250µg/100µL RB-1516-PCL<br />

PARP (Poly ADP-Ribose Polymerase) Ab-3, Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat and Cow. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the C-terminal region of bovine<br />

PARP<br />

Molecular Weight: 116kDa<br />

Positive Control: Raji cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–PARP<br />

(Poly ADP–Ribose<br />

Polymerase)<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1680-P0<br />

1mg/mL RB-1680-P1<br />

1mg/mL RB-1680-P<br />

1mg/mL RB-1680-P1ABX<br />

1mg/mL RB-1680-PABX<br />

250µg/100µL RB-1680-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

211


Pax-5, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human, Mouse, Rat.<br />

Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: Synthetic peptide derived<br />

from C-terminus of human PAX-5 protein<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil, Raji cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

FFPE human tonsil stained with PAX–5.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Pax-5, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP34<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Synthetic peptide derived from the<br />

C-terminus of human PAX-5 protein<br />

Molecular Weight: 50kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

anti–Pax–5,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL RB-9406-P0<br />

200µg/mL RB-9406-P1<br />

200µg/mL RB-9406-P<br />

n/a RB-9406-R7<br />

250µg/100µL RB-9406-PCL<br />

IVD†<br />

RabbitMAb<br />

Paxillin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5H11<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human<br />

and Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified<br />

recombinant full-length human<br />

paxillin protein<br />

Molecular Weight: 68kDa<br />

Positive Control: HeLa cells,<br />

Colon CA<br />

Cellular Localization:<br />

Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

P-Cadherin, see Cadherin-P<br />

P. Carinii, see Pneumocystis jiroveci<br />

FFPE human colon CA stained with Paxillin anti–Paxillin<br />

Ab–1.<br />

Ab–1, Native<br />

IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–Paxillin<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-404-P0<br />

200µg/mL MS-404-P1<br />

200µg/mL MS-404-P<br />

1mg/mL MS-404-P1ABX<br />

1mg/mL MS-404-PABX<br />

n/a MS-404-R7<br />

n/a MS-404-PCS<br />

250µg/100µL MS-404-PCL<br />

FFPE human tonsil stained with PAX–5.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9133-S0<br />

RM-9133-S<br />

RM-9133-R7<br />

RM-9133-RQ<br />

†USA: IVD; Int'l: IVD<br />

212<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


PCNA (Proliferating Cell Nuclear Antigen) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: PC10<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse, Rat,<br />

Insect, and Yeast. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant rat PCNA<br />

protein<br />

Molecular Weight: 36kDa<br />

Positive Control: Raji cells; Tonsil, lymph<br />

node, or small intestine<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native and<br />

denatured)<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human small intestine stained with<br />

PCNA Ab–1.<br />

FFPE rat breast CA stained with PCNA<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–PCNA<br />

(Proliferating<br />

Cell Nuclear<br />

Antigen)<br />

Ab–1, Denatured<br />

IP<br />

anti–PCNA<br />

(Proliferating<br />

Cell Nuclear<br />

Antigen)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

20µg/mL MS-106-P0<br />

20µg/mL MS-106-P1<br />

20µg/mL MS-106-P<br />

1mg/mL MS-106-P1ABX<br />

1mg/mL MS-106-PABX<br />

20µg/mL MS-106-B0<br />

20µg/mL MS-106-B1<br />

20µg/mL MS-106-B<br />

n/a MS-106-R7<br />

n/a MS-106-PCS<br />

250µg/100µL MS-106-PCL<br />

PCNA (Proliferating Cell Nuclear Antigen), Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant human PCNA<br />

protein<br />

Molecular Weight: 36kDa<br />

Positive Control: Raji cells, Tonsil, Lymph<br />

node, and small intestine<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

PD-ECGF, see Thymidine Phosphorylase<br />

PDGF, see Platelet-Derived Growth Factor<br />

FFPE human tonsil stained with PCNA.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

PDGFRα, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide derived from<br />

C-terminal of human PDGFRα<br />

Molecular Weight: 190kDa<br />

Positive Control: Skin and ovarian CA<br />

Cellular Localization: Cytoplasmic and cell membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

anti–PCNA<br />

(Proliferating<br />

Cell Nuclear<br />

Antigen), WB<br />

Conc. Cat. No.<br />

200µg/mL RB-9055-P0<br />

200µg/mL RB-9055-P1<br />

200µg/mL RB-9055-P<br />

n/a RB-9055-R7<br />

250µg/100µL RB-9055-PCL<br />

IVD†<br />

FFPE human angiosarcoma stained with<br />

PDGFR α antibody.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9027-P0<br />

RB-9027-P1<br />

RB-9027-P<br />

RB-9027-R7<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

213


PDGFRα Ab-1, Rabbit Polyclonal Antibody<br />

Pds1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, and Rat. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the C-terminus of the precursor form<br />

of human PDGFRα<br />

Molecular Weight: ~190kDa<br />

Postitive Control: Ovarian CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

PDGFRβ Ab-1, Rabbit Polyclonal Antibody<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1691-P0<br />

RB-1691-P1<br />

RB-1691-P<br />

RB-1691-P1ABX<br />

RB-1691-PABX<br />

Host Species: Mouse<br />

Clone: DCS-280<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant full-length Pds1<br />

protein<br />

Molecular Weight: 42kDa<br />

Positive Control: HeLa cells, Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Pds1<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1511-P0<br />

MS-1511-P1<br />

MS-1511-P<br />

MS-1511-P1ABX<br />

MS-1511-PABX<br />

MS-1511-R7<br />

MS-1511-PCS<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: Near C-terminal<br />

Immunogen: A synthetic peptide derived from near the C-terminus of human PDGFRβ<br />

Molecular Weight: ~190kDa<br />

Postitive Control: Ovarian CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

RB-1692-P0<br />

RB-1692-P1<br />

RB-1692-P<br />

RB-1692-P1ABX<br />

RB-1692-PABX<br />

USA: RUO; Int'l: RUO<br />

PECAM-1, see CD31<br />

Perforin Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5B10<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant protein corresponding to<br />

C-terminal region of human perforin<br />

Molecular Weight: 70kDa<br />

Positive Control: Lymphoma<br />

Cellular Localization: Granular and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human lymphoma stained with Perforin<br />

Ab–2 .<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1834-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1834-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1834-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1834-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-1834-PCS<br />

†USA: IVD; Int'l: IVD<br />

Peripheral Myelin Protein, see PMP-22<br />

Perlecan, see Heparan Sulfate Proteoglycan<br />

p-Glycoprotein, see p170<br />

PGP9.5, see Protein Gene Product 9.5<br />

214<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Placental Alk. Phosphatase (PLAP), Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP15<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding human<br />

Placental Alkaline Phosphatase (PLAP)<br />

Molecular Weight: 60-70kDa<br />

Positive Control: Placenta or seminoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

12mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human seminoma stained with PLAP.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9115-S0<br />

RM-9115-S1<br />

RM-9115-S<br />

RM-9115-RQ<br />

Placental Alk. Phosphatase (PLAP) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 8B6.18<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: HEp-2 cells expressing Placental Alkaline Phosphatase (PLAP)<br />

Molecular Weight: 60-70kDa<br />

Positive Control: Placenta<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• ELISA<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-208-P0<br />

MS-208-P1<br />

MS-208-P<br />

MS-208-P1ABX<br />

MS-208-PABX<br />

MS-208-B0<br />

MS-208-B1<br />

MS-208-B<br />

Placental Lactogen (hPL), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: Not known<br />

Immunogen: Purified human placental<br />

lactogen<br />

Molecular Weight: 21kDa<br />

Positive Control: hPL recombinant protein,<br />

Placenta<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

FFPE human placenta stained with Placentaanti–Placental<br />

Lactogen.<br />

Lactogen<br />

(hPL), WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9067-P0<br />

200µg/mL RB-9067-P1<br />

200µg/mL RB-9067-P<br />

n/a RB-9067-R7<br />

250µg/100µL RB-9067-PCL<br />

Placental Alk. Phosphatase (PLAP) Ab-4, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 8A9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human Placental Alkaline<br />

Phosphatase (PLAP)<br />

Molecular Weight: 60-70kDa<br />

Positive Control: Placenta or seminoma<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human placenta stained with PLAP<br />

Ab–4.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-734-S0<br />

MS-734-S1<br />

MS-734-S<br />

MS-734-R7<br />

MS-734-PCS<br />

PLAP, see Placental Alk. Phosphatase<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

215


Plasma Cell Ab-1, Mouse Monoclonal Antibody<br />

Plastin-L Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: LIV3G11<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Positive Control: Tonsil or lymph node<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Plasma Cell<br />

Ab–1.<br />

Conc.<br />

50µg/mL<br />

50µg/mL<br />

50µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Plasminogen Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

MS-488-P0<br />

MS-488-P1<br />

MS-488-P<br />

MS-488-P1ABX<br />

MS-488-PABX<br />

MS-488-R7<br />

MS-488-PCS<br />

Host Species: Mouse<br />

Clone: LPL4A.1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with Mouse. Others not known.<br />

Epitope: Headpiece region<br />

Immunogen: Human recombinant L-plastin protein<br />

Molecular Weight: 62kDa<br />

Positive Control: Human polymorphonuclear neutrophils and monocytes,<br />

MCF-7, Jurkat cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

anti–Plastin–L<br />

Ab–1,<br />

• Western Blotting<br />

• Immunofluorescence (Fixed in methanol or 3% paraformaldehyde) WB<br />

• Immunoprecipitation (Native)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1326-P0<br />

200µg/mL MS-1326-P1<br />

200µg/mL MS-1326-P<br />

1mg/mL MS-1326-P1ABX<br />

1mg/mL MS-1326-PABX<br />

250µg/100µL MS-1326-PCL<br />

Pneumocystis jiroveci (P. Carinii) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SBF1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human plasminogen protein<br />

Molecular Weight: ~120kDa<br />

Positive Control: HUVEC cells<br />

Cellular Localization: Secreted protein<br />

Applications:<br />

• Western Blotting (Nonreduced only)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Plasminogen<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-659-P0<br />

200µg/mL MS-659-P1<br />

200µg/mL MS-659-P<br />

1mg/mL MS-659-P1ABX<br />

1mg/mL MS-659-PABX<br />

200µg/mL MS-659-B0<br />

200µg/mL MS-659-B1<br />

200µg/mL MS-659-B<br />

250µg/100µL MS-659-PCL<br />

Host Species: Mouse<br />

Clone: 3F6<br />

Isotype: IgM/κ<br />

Species Reactivity: Pneumocystis jiroveci infected<br />

tissues.<br />

Immunogen: Pneumocystis jiroveci cysts isolated from<br />

human lung<br />

Molecular Weight: 82kDa<br />

Positive Control: Pneumocystis jiroveci infected human<br />

lung<br />

Cellular Localization: Alveolar spaces<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

pNR-2 Estrogen-Regulated Protein, see pS2<br />

Poliovirus Receptor, see CD155<br />

IVD†<br />

FFPE human infected lung stained with<br />

Pneumocystis jiroveci Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1427-S0<br />

MS-1427-S1<br />

MS-1427-S<br />

MS-1427-R7<br />

Poly ADP-Ribose Polymerase, see PARP<br />

216<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


PR3 (Proteinase 3) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: MCPR3-2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: HMC-1/PR3 cell granule extract<br />

Molecular Weight: 32-40kDa<br />

Positive Control: HMC-1/PR3-S176 cells<br />

Applications:<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Progesterone Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4P01; same as 1E11<br />

Isotype: IgG1/κ<br />

Species Reactivity: All species.<br />

Immunogen: Progesterone-11α-hemisuccinate conjugated to BSA<br />

Positive Control: T47D, Luteinized theca cells of normal ovary<br />

Cellular Localization: Cytoplasmic and secreted<br />

Applications:<br />

• ELISA<br />

• Radioimmunoassay (RIA)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1333-P0<br />

MS-1333-P1<br />

MS-1333-P<br />

MS-1333-P1ABX<br />

MS-1333-PABX<br />

Cat. No.<br />

MS-1040-P0<br />

MS-1040-P1<br />

MS-1040-P<br />

MS-1040-P1ABX<br />

MS-1040-PABX<br />

Progesterone Receptor, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: SP2<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: 412-526aa<br />

Immunogen: Recombinant protein<br />

encoding human progesterone receptor<br />

412-526aa<br />

Molecular Weight: 116 + 81kDa<br />

Positive Control: Breast CA, T47D cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

IVD†<br />

RabbitMAb<br />

FFPE human breast CA stained with Rabbit anti–Progesterone<br />

Recep-<br />

Monoclonal Progesterone Receptor.<br />

tor, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

100µL<br />

Conc. Cat. No.<br />

n/a RM-9102-S0<br />

n/a RM-9102-S1<br />

n/a RM-9102-S<br />

n/a RM-9102-R7<br />

n/a RM-9102-RQ<br />

250µg/100µL RM-9102-PCL<br />

anti-Progesterone Receptor, Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: YR85<br />

Isotype: Rabbit IgG<br />

Species Reactivity: Human, Rat.<br />

Molecular Weight: 118kDa<br />

Positive Control: Breast Ca<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human breast carcinoma stained with<br />

Progesterone Receptor.<br />

Progesterone Receptor, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: 412-526aa<br />

Immunogen: Recombinant protein encoding human<br />

progesterone receptor 412-526aa<br />

Molecular Weight: 81 and 116kDa<br />

Positive Control: T47D cells, Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not tested)<br />

FFPE human breast CA stained with Progesterone<br />

Receptor.<br />

Format<br />

Supernatant<br />

Supernatant<br />

Ready-to-use for IHC<br />

Ready-to-use for IHC<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-2114-S0<br />

RM-2114-S<br />

RM-2114-R7<br />

RM-2114-RQ<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9017-P0<br />

RB-9017-P1<br />

RB-9017-P<br />

RB-9017-R7<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

217


Progesterone Receptor Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: hPRa 2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Cow, Horse, Rabbit, and<br />

Chicken. Does not react with<br />

monkey. Others not known.<br />

Epitope: N-terminal half of<br />

human progesterone<br />

Immunogen: PgR from a<br />

human endometrial carcinoma FFPE human breast CA stained with Proges-anti–Progesterone<br />

Receptor Ab–2.<br />

terone Recepterone<br />

Recep-<br />

anti–Proges-<br />

(EnCa 101) grown in athymic<br />

mice<br />

tor Ab–2, Native<br />

IP<br />

tor Ab–2, WB<br />

Molecular Weight: 116kDa<br />

(triplet, B-form)<br />

Positive Control: T47D cells or Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Sedimentation in Sucrose Gradient<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-192-P0<br />

200µg/mL MS-192-P1<br />

200µg/mL MS-192-P<br />

1mg/mL MS-192-P1ABX<br />

1mg/mL MS-192-PABX<br />

n/a MS-192-PCS<br />

250µg/100µL MS-192-PCL<br />

Progesterone Receptor Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: hPRa 6<br />

Isotype: IgG2b<br />

Species Reactivity: Human, Cow, Rabbit, and Chicken. Does<br />

not react with monkey. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Partially purified PgR from a human endometrial<br />

carcinoma (EnCa 101) grown in athymic mice<br />

Molecular Weight: 116kDa (triplet, B-form)<br />

Positive Control: T47D cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting (Not optimum)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Sedimentation in Sucrose Gradient<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Progesterone<br />

Recepterone<br />

Recep-<br />

anti–Progestor<br />

MAb, Nativtor<br />

Mab, WB<br />

IP<br />

Cat. No.<br />

MS-196-P0<br />

MS-196-P1<br />

MS-196-P<br />

MS-196-P1ABX<br />

MS-196-PABX<br />

Progesterone Receptor Ab-7, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: hPRa 7<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Baboon, Monkey, Mouse, and Rat. Does not<br />

react with guinea pig. Others not known.<br />

Epitope: N-terminal half of human PgR<br />

Immunogen: PgR from a human endometrial carcinoma (EnCa 101) grown<br />

in athymic mice<br />

Molecular Weight: 116kDa (triplet, B-form) and 81kDa (singlet, A-form)<br />

Positive Control: T47D cells<br />

Cellular Localization: Nuclear<br />

anti–Progesterone<br />

Recep-<br />

Applications:<br />

• Western Blotting<br />

tor Ab–7, WB<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native only)<br />

• Sedimentation in Sucrose Gradient<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-197-P0<br />

200µg/mL MS-197-P1<br />

200µg/mL MS-197-P<br />

1mg/mL MS-197-P1ABX<br />

1mg/mL MS-197-PABX<br />

250µg/100µL MS-197-PCL<br />

Progesterone Receptor Ab-8, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

IVD†<br />

Clone: hPRa 2 + hPRa 3<br />

Isotype: IgG1/κ + IgG1/κ<br />

Species Reactivity: Human, Horse, Sheep<br />

and Pig. Others not known.<br />

Epitope: N-terminal half of human PgR<br />

Immunogen: PgR from a human<br />

endometrial carcinoma (EnCa 101) grown<br />

in athymic mice<br />

Molecular Weight: 116kDa (B-form) and<br />

81kDa (A-form)<br />

Positive Control: T47D or Breast CA<br />

Cellular Localization: Nuclear<br />

FFPE human breast CA stained with Proges-anti–Progesterone<br />

Receptor Ab–8.<br />

terone Recep-<br />

Applications:<br />

tor Ab–8, WB<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

• Sedimentation in Sucrose Gradient<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

Conc. Cat. No.<br />

200µg/mL MS-298-P0<br />

200µg/mL MS-298-P1<br />

200µg/mL MS-298-P<br />

n/a MS-298-R7<br />

n/a MS-298-RQ<br />

n/a MS-298-PCS<br />

250µg/100µL MS-298-PCL<br />

1mg/mL MS-298-P1ABX<br />

1mg/mL MS-298-PABX<br />

218<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Progesterone Receptor Ab-9, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-14, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1A6<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide of human PgR<br />

Positive Control: Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human breast CA stained with Progesterone<br />

Receptor Ab–9.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-390-S0<br />

MS-390-S1<br />

MS-390-S<br />

MS-390-R7<br />

MS-390-PCS<br />

Host Species: Mouse<br />

Clone: PgR636<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal (shared by A- and B-form)<br />

Immunogen: Formalin fixed recombinant full-length<br />

A-form of human progesterone receptor<br />

Molecular Weight: 116kDa (triplet, B-form) and 81kDa<br />

(singlet, A-form)<br />

Positive Control: Breast CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with Progesterone<br />

Receptor Ab–14.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1882-S0<br />

MS-1882-S1<br />

MS-1882-S<br />

MS-1882-R7<br />

MS-1882-PCS<br />

Progesterone Receptor Ab-13, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, and Rat. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from C-terminus of human<br />

progesterone receptor protein<br />

Molecular Weight: 116kDa (triplet, B-form) and 81kDa (singlet, A-form)<br />

Positive Control: T47D cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Progesterone<br />

Receptor<br />

Ab–13,<br />

WB<br />

Conc. Cat. No.<br />

1mg/mL RB-1492-P0<br />

1mg/mL RB-1492-P1<br />

1mg/mL RB-1492-P<br />

1mg/mL RB-1492-P1ABX<br />

1mg/mL RB-1492-PABX<br />

250µg/100µL RB-1492-PCL<br />

Prohibitin (Mitochondrial Marker) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: II-14-10<br />

Isotype: IgG1<br />

Species Reactivity: Human, Pig, Rat,<br />

Mouse, and Chicken. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant rat<br />

prohibitin protein<br />

Molecular Weight: 30kDa<br />

Positive Control: MAD109 or PC12 cells,<br />

Heart<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

FFPE human heart stained with Prohibitin<br />

Ab–1.<br />

FFPE rat heart stained with Prohibitin Ab–1.<br />

anti–Prohibitin<br />

(Mitochondrial<br />

Marker) Ab–1,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-261-P0<br />

200µg/mL MS-261-P1<br />

200µg/mL MS-261-P<br />

1mg/mL MS-261-P1ABX<br />

1mg/mL MS-261-PABX<br />

200µg/mL MS-261-B0<br />

200µg/mL MS-261-B1<br />

200µg/mL MS-261-B<br />

n/a MS-261-R7<br />

n/a MS-261-PCS<br />

250µg/100µL MS-261-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

219


Prolactin, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SPM108<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Purified human prolactin<br />

Molecular Weight: 23.5kDa<br />

Positive Control: Pituitary gland<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Prolactin Ab-2, Mouse Monoclonal Antibody<br />

IVD†<br />

FFPE human pituitary stained with Prolactin.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

MS-9083-P0<br />

MS-9083-P1<br />

MS-9083-P<br />

MS-9083-R7<br />

Prolactin Receptor Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: B6.2<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Semi-purified human prolactin receptor<br />

Molecular Weight: ~70kDa<br />

Positive Control: Breast CA<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast cancer stained with<br />

Prolactin Receptor Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1338-P0<br />

MS-1338-P1<br />

MS-1338-P<br />

MS-1338-P1ABX<br />

MS-1338-PABX<br />

MS-1338-R7<br />

MS-1338-PCS<br />

Host Species: Mouse<br />

Clone: PRL02<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human prolactin<br />

Molecular Weight: 23.5kDa<br />

Positive Control: Pituitary gland<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• ELISA<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

FFPE human pituitary stained with Prolactin<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-1362-P0<br />

MS-1362-P1<br />

MS-1362-P<br />

MS-1362-P1ABX<br />

MS-1362-PABX<br />

MS-1362-R7<br />

Proliferating Cell Nuclear Antigen, see PCNA<br />

Properdin, FITC Labeled Antibody<br />

Host Species: Goat<br />

IVD†<br />

Species Reactivity: Reacts with properdin in human serum and tissues.<br />

Immunogen: Properdin from human serum<br />

Cellular Localization: Kidney tissue; used in detecting certain types of kidney tissue<br />

Positive Control: Diseased kidney fixed and processed in the same manner as the test<br />

specimen<br />

Applications:<br />

• Immunofluorescence<br />

Format<br />

FITC-Conjugated Ab<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

2mL<br />

Conc.<br />

n/a<br />

Cat. No.<br />

GT-1928-R2<br />

220<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Prostate Specific Acid Phosphatase (PSAP) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Prostate Specific Membrane Antigen (PSMA), Rabbit Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: PASE/4LJ<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with dog,<br />

rabbit, and rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified prostatic acid phosphatase<br />

(PSAP) from human seminal plasma<br />

Molecular Weight: 52kDa<br />

Positive Control: Normal prostate or prostate CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

IVD†<br />

FFPE human prostate stained with PSAP<br />

Ab–1.<br />

Host Species: Rabbit<br />

Clone: SP29<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: C-terminal<br />

Molecular Weight: 84kDa<br />

Positive Control: Prostate carcinoma<br />

Cellular Localization: Cytoplasmic and membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

FFPE human prostate CA stained with rabbit<br />

monoclonal PSMA.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-321-P0<br />

MS-321-P1<br />

MS-321-P<br />

MS-321-R7<br />

MS-321-RQ<br />

MS-321-PCS<br />

MS-321-P1ABX<br />

MS-321-PABX<br />

MS-321-B0<br />

MS-321-B1<br />

MS-321-B<br />

Prostate Specific Antigen (PSA), Rabbit Monoclonal Antibody<br />

Host Species: Rabbit<br />

Clone: EP1588Y<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: A synthetic peptide corresponding to<br />

residues near the C-terminus of human PSA<br />

Molecular Weight: 34kDa<br />

Positive Control: Normal prostate or prostate<br />

carcinoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

RabbitMAb<br />

FFPE human prostate stained with rabbit<br />

monoclonal PSA.<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Prostate Stem Cell Antigen, see PSCA<br />

Quantity<br />

100µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9131-S0<br />

RM-9131-S<br />

RM-9131-R7<br />

RM-9131-RQ<br />

Protein Gene Product 9.5 (PGP9.5), Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant full-length human PGP9.5<br />

protein<br />

Molecular Weight: 9.5kDa<br />

Positive Control: Pancreas and small intestine<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human pancreas stained with<br />

PGP9.5.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

IVD†<br />

Cat. No.<br />

RB-9202-P0<br />

RB-9202-P1<br />

RB-9202-P<br />

RB-9202-R7<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

†USA: IVD; Int'l: IVD<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

RM-2104-S0<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

RM-2104-S<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RM-2104-R7<br />

Ready-to-use for IHC (Quanto)<br />

12mL<br />

n/a<br />

RM-2104-RQ<br />

†USA: ASR; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

221


Protein Gene Product 9.5 (PGP9.5) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 10A1<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein corresponding to<br />

full-length human protein gene product 9.5 molecule<br />

Molecular Weight: 25-27kDa<br />

Positive Control: Small intestine<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

IVD†<br />

FFPE human small intestine stained with<br />

PGP9.5 Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1760-S0<br />

MS-1760-S1<br />

MS-1760-S<br />

MS-1760-R7<br />

MS-1760-PCS<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal<br />

Antibody<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-2, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: GE2; same as R47/94<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 57-84<br />

Immunogen: A synthetic peptide of 28 amino acid<br />

residues corresponding to<br />

CFDDTVRGVPWCF-YPNTIDVPPEEECEF (aa 57-84) from<br />

C-terminus of human pS2 protein<br />

Molecular Weight: 6.5kDa<br />

Positive Control: Normal stomach or breast CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Affinity Purification<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human breast CA stained with pS2<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-199-P0<br />

MS-199-P1<br />

MS-199-P<br />

MS-199-P1ABX<br />

MS-199-PABX<br />

MS-199-R7<br />

MS-199-PCS<br />

Host Species: Mouse<br />

Clone: pS2.1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 54-84<br />

Immunogen: A synthetic 31-mer peptide aa 54-84<br />

(KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein<br />

Molecular Weight: 6.5kDa<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-111-P0<br />

MS-111-P1<br />

MS-111-P<br />

MS-111-P1ABX<br />

MS-111-PABX<br />

PSA, see Prostate Specific Antigen<br />

PSAP, see Prostate Specific Acid Phosphatase<br />

PSMA, see Prostate Specific Membrane Antigen<br />

PTEN/MMAC1 Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 17.A<br />

Isotype: IgM/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human PTEN protein<br />

Molecular Weight: 60kDa<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1601-S0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1601-S1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1601-S<br />

USA: RUO; Int'l: RUO<br />

PTH-Receptor Type 1, see Parathyroid Hormone Receptor<br />

PVR, see CD155<br />

222<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Rabies Virus Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Rab-50<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Rabies virus of strains SAD-Vnukovo and Pitman Moore<br />

Epitope: Not determined<br />

Immunogen: Rabies Virus of strains SAD-Vnukovo and Pitman Moore<br />

Applications:<br />

• ELISA<br />

• Neutralization in vitro<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

RAD51 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 51RAD01; same as<br />

3C10<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

RAD51 protein<br />

Molecular Weight: 37-43kDa<br />

Positive Control: HeLa cells,<br />

Testis<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

FFPE human testis stained with RAD51<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Cat. No.<br />

MS-549-P0<br />

MS-549-P1<br />

MS-549-P<br />

MS-549-P1ABX<br />

MS-549-PABX<br />

anti–RAD51 anti–RAD51<br />

Ab–1, Natove Ab–1, WB<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-988-P0<br />

200µg/mL MS-988-P1<br />

200µg/mL MS-988-P<br />

1mg/mL MS-988-P1ABX<br />

1mg/mL MS-988-PABX<br />

200µg/mL MS-988-B0<br />

200µg/mL MS-988-B1<br />

200µg/mL MS-988-B<br />

n/a MS-988-R7<br />

n/a MS-988-PCS<br />

250µg/100µL MS-988-PCL<br />

Raf-1 (Phospho-specific) Ab-2, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: pS338[DPR/2/2A/3A]<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: GQRDS*SYY*WEIEAS<br />

Immunogen: A synthetic peptide corresponding to aa<br />

GQRDS*SYY*WEIEAS<br />

Molecular Weight: 74kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Rb, see Retinoblastoma<br />

Rb2, see p130<br />

Reed-Sternberg Cell Marker, see CD30<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with Raf–1<br />

Ab–2.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RT-1732-P0<br />

RT-1732-P1<br />

RT-1732-P<br />

RT-1732-P1ABX<br />

RT-1732-PABX<br />

RT-1732-R7<br />

RT-1732-PCS<br />

Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: PN-15<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Carbohydrate domain<br />

Immunogen: Microsomal fraction of human renal<br />

cortical tissue homogenate<br />

Molecular Weight: ~200kDa<br />

Positive Control: Normal kidney or renal cell CA<br />

Cellular Localization: Membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Reduced and nonreduced)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE human renal cell CA stained with<br />

RCC Marker Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-409-P0<br />

MS-409-P1<br />

MS-409-P<br />

MS-409-R7<br />

MS-409-RQ<br />

MS-409-PCS<br />

MS-409-P1ABX<br />

MS-409-PABX<br />

MS-409-B0<br />

MS-409-B1<br />

MS-409-B<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

223


Replication Protein A, see RPA<br />

Retinoblastoma (Rb) Ab-1, Mouse Monoclonal Antibody<br />

Ret Oncoprotein Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3F8<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant protein encoding the<br />

extreme C-terminal cytoplasmic region of the human<br />

ret oncoprotein<br />

Positive Control: Enteric ganglion cells, Small intestine<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human small intestine stained with<br />

Ret Oncoprotein Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1120-S0<br />

MS-1120-S1<br />

MS-1120-S<br />

MS-1120-R7<br />

MS-1120-PCS<br />

Host Species: Mouse<br />

Clone: 1F8; same as Rb1<br />

Isotype: IgG1<br />

Species Reactivity: Human.<br />

Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: aa 703-722<br />

Immunogen: Recombinant<br />

human Rb protein<br />

Molecular Weight: 105kDa<br />

Positive Control: Ls174T,<br />

HT29, HUVEC cells; Normal<br />

colon, Breast CA and colon CA<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Flow Cytometry<br />

FFPE human breast CA stained with Rb<br />

Ab–1.<br />

anti–Retinoblastoma<br />

(Rb)<br />

Ab–1, WB<br />

an-<br />

anti–Retinoblasti–Retinoblas-<br />

toma (Rb) toma (Rb)<br />

Ab–1, Native Ab–1, Denatured<br />

IP<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-107-P0<br />

200µg/mL MS-107-P1<br />

200µg/mL MS-107-P<br />

1mg/mL MS-107-P1ABX<br />

1mg/mL MS-107-PABX<br />

200µg/mL MS-107-B0<br />

200µg/mL MS-107-B1<br />

200µg/mL MS-107-B<br />

n/a MS-107-R7<br />

n/a MS-107-PCS<br />

250µg/100µL MS-107-PCL<br />

224<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Retinoblastoma (Rb) Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: XZ133<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse (strong) and Chicken (strong). Does<br />

not react with Xenopus. Others not known.<br />

Epitope: aa 620-665<br />

Immunogen: Recombinant human Rb protein corresponding to amino acids<br />

387-928<br />

Molecular Weight: 105kDa<br />

Positive Control: Ls174T, HT29, HUVEC cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Retinoblastoma<br />

(Rb),<br />

Denatured IP<br />

Cat. No.<br />

MS-595-P0<br />

MS-595-P1<br />

MS-595-P<br />

MS-595-P1ABX<br />

MS-595-PABX<br />

Retinoblastoma (Rb) (Phospho-specific Serine) Ab-7, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 51B7<br />

Isotype: IgG1<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Molecular Weight: 105kDa<br />

Positive Control: Ls174T cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1883-P0<br />

200µg/mL MS-1883-P1<br />

200µg/mL MS-1883-P<br />

1mg/mL MS-1883-P1ABX<br />

1mg/mL MS-1883-PABX<br />

250µg/100µL MS-1883-PCL<br />

Rhodopsin (Opsin) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: RET-P1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and<br />

Rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Membrane preparation from<br />

adult rat retina<br />

Molecular Weight: 39kDa<br />

Positive Control: Brain or retina<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

FFPE human brain stained with Rhodopsin<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

ROC1 Ab-1, Rabbit Polyclonal Antibody<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: aa 97-108<br />

Immunogen: A peptide corresponding to amino acid residue<br />

97-108 (CPLDNREWEFQKYGH) from C-terminus of the human<br />

ROC1<br />

Molecular Weight: 13kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Rhodopsin<br />

(Opsin) Ab–1,<br />

WB<br />

Cat. No.<br />

MS-1233-P0<br />

MS-1233-P1<br />

MS-1233-P<br />

MS-1233-P1ABX<br />

MS-1233-PABX<br />

MS-1233-B0<br />

MS-1233-B1<br />

MS-1233-B<br />

MS-1233-R7<br />

MS-1233-PCS<br />

anti–ROC1<br />

Ab–1, Native<br />

IP<br />

anti–ROC1<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

1mg/mL RB-069-P0<br />

1mg/mL RB-069-P1<br />

1mg/mL RB-069-P<br />

1mg/mL RB-069-P1ABX<br />

1mg/mL RB-069-PABX<br />

250µg/100µL RB-069-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

225


RPA/p70 (Replication Protein A) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2H10 or 70C or αSSB70C<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human RPA protein<br />

Molecular Weight: 70kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunoprecipitation (Native and denatured)<br />

• Gel Supershift<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–RPA/p70 anti–RPA/p70 anti–RPA/p70<br />

(Replication (Replication (Replication<br />

ProteinA)<br />

Ab–2, WB<br />

ProteinA)<br />

Ab–2, Native<br />

IP<br />

ProteinA)<br />

Ab–2, Denatured<br />

IP<br />

Conc. Cat. No.<br />

200µg/mL MS-692-P0<br />

200µg/mL MS-692-P1<br />

200µg/mL MS-692-P<br />

1mg/mL MS-692-P1ABX<br />

1mg/mL MS-692-PABX<br />

250µg/100µL MS-692-PCL<br />

S100 A4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Recombinant protein encoding full-length<br />

human S100 A4<br />

Molecular Weight: 10-12kDa<br />

Positive Control: Human melanoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

S100 A4 Ab-8, Rabbit Polyclonal Antibody<br />

FFPE human melanoma stained with S100<br />

A4.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-9411-P0<br />

RB-9411-P1<br />

RB-9411-P<br />

RB-9411-R7<br />

RB-9411-PCS<br />

S100, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding human<br />

S100 protein<br />

Molecular Weight: 21-24kDa<br />

Positive Control: Melanoma or Schwannoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human melanoma stained with S100.<br />

Conc. Cat. No.<br />

200µg/mL RB-9018-P0<br />

200µg/mL RB-9018-P1<br />

200µg/mL RB-9018-P<br />

n/a RB-9018-R7<br />

n/a RB-9018-RQ<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Cow, Horse,<br />

Cat and Dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant human S100 A4<br />

monomer expressed in E. coli<br />

Molecular Weight: 10-12kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic, membrane and<br />

nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with S100 A4<br />

Ab–8.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-1804-A0<br />

RB-1804-A1<br />

RB-1804-A<br />

RB-1804-R7<br />

RB-1804-PCS<br />

226<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


S100 A6 Ab-9, Rabbit Polyclonal Antibody<br />

S100 Protein Ab-2, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat, Cow, Horse,<br />

Cat and Dog. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant human S100 A6<br />

monomer expressed in E. coli<br />

Molecular Weight: 10-12kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human tonsil stained with S100 A6<br />

Ab–9.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

S100 Protein Ab-1, Mouse Monoclonal Antibody<br />

Cat. No.<br />

RB-1805-A0<br />

RB-1805-A1<br />

RB-1805-A<br />

RB-1805-R7<br />

RB-1805-PCS<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Cow, Kangaroo, Mouse,<br />

Rat and Chicken. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: S100 protein purified from cow brain<br />

Molecular Weight: ~22kDa (nonreduced); ~11kDa<br />

(reduced)<br />

Positive Control: Melanoma or Schwannoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunocytochemistry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

SCF-Receptor, see CD117<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human melanoma stained with S100<br />

Protein Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-044-A0<br />

RB-044-A1<br />

RB-044-A<br />

RB-044-R7<br />

RB-044-PCS<br />

Host Species: Mouse<br />

Clone: 4C4.9<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Cow, Rat and Mouse.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified bovine brain S100 protein<br />

Molecular Weight: ~22kDa (nonreduced); ~11kDa<br />

(reduced)<br />

Positive Control: Melanoma or Schwannoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE human melanoma stained with S100<br />

Protein Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-296-P0<br />

MS-296-P1<br />

MS-296-P<br />

MS-296-R7<br />

MS-296-RQ<br />

MS-296-PCS<br />

MS-296-P1ABX<br />

MS-296-PABX<br />

MS-296-B0<br />

MS-296-B1<br />

MS-296-B<br />

Secretory Component Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: COMPO2; same as SC-05<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Semi-purified human secretory<br />

component (SC)<br />

Molecular Weight: 80kDa<br />

Positive Control: Small intestine, Colon CA, Stomach<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

sem5, see Grb2<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE human colon CA stained with Secretory<br />

Component Ab–2.<br />

Conc.<br />

1.9mg/mL<br />

1.9mg/mL<br />

1.9mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1367-P0<br />

MS-1367-P1<br />

MS-1367-P<br />

MS-1367-R7<br />

MS-1367-PCS<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

227


Serotonin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5HT-H209<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: 5-Hydroxytryptamine hydrochloride<br />

[3-(2-aminoethyl)-5-hydroxyindole hydrochloride;<br />

serotonin hydrochloride]<br />

Positive Control: Appendix<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

SHP-1 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 1SH01; same as 11D7C8H5<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human SHP-1 protein<br />

Molecular Weight: ~68kDa<br />

Positive Control: Jurkat or HeLa cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human appendix stained with Serotonin<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1431-S0<br />

MS-1431-S1<br />

MS-1431-S<br />

MS-1431-R7<br />

MS-1431-PCS<br />

anti–SHP–1,<br />

WB<br />

Cat. No.<br />

MS-1190-P0<br />

MS-1190-P1<br />

MS-1190-P<br />

MS-1190-P1ABX<br />

MS-1190-PABX<br />

sm (Smith Antigen) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Y12<br />

Isotype: IgG3/κ<br />

Species Reactivity: Human, Pig, Rabbit,<br />

Rat and Drosophila. Others not known.<br />

Epitope: Not determined<br />

Molecular Weight: ~25kDa (predominant)<br />

Positive Control: Ls174T cells, Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Affinity Purification<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human tonsil stained with sm Ab–1. anti–sm<br />

(Smith Antigen)<br />

Ab–1,<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

SMAD4/DPC4 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SMD46; same as DCS-46<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified recombinant DPC4 protein<br />

Molecular Weight: 60kDa<br />

Positive Control: Ls174T, HT29, Raji, Jurkat cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

Conc. Cat. No.<br />

200µg/mL MS-450-P0<br />

200µg/mL MS-450-P1<br />

200µg/mL MS-450-P<br />

1mg/mL MS-450-P1ABX<br />

1mg/mL MS-450-PABX<br />

200µg/mL MS-450-B0<br />

200µg/mL MS-450-B1<br />

200µg/mL MS-450-B<br />

n/a MS-450-R7<br />

n/a MS-450-PCS<br />

250µg/100µL MS-450-PCL<br />

anti–SMAD4/<br />

DPC4 Ab–1,<br />

Native IP<br />

anti–SMAD4/<br />

DPC4 Ab–1,<br />

WB<br />

Sialyl Lewis a , see CA19-9<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-865-P0<br />

200µg/mL MS-865-P1<br />

200µg/mL MS-865-P<br />

1mg/mL MS-865-P1ABX<br />

1mg/mL MS-865-PABX<br />

200µg/mL MS-865-B0<br />

200µg/mL MS-865-B1<br />

200µg/mL MS-865-B<br />

250µg/100µL MS-865-PCL<br />

USA: RUO; Int'l: RUO<br />

Smith Antigen, see sm<br />

228<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Somatostatin Ab-1, Rabbit Polyclonal Antibody<br />

Surfactant Protein B (Mature) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 1-14<br />

Immunogen: Synthetic cyclic (1-14) somatostatin<br />

Positive Control: Pancreas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human pancreas stained with Somatostatin<br />

Ab–1.<br />

Host Species: Mouse<br />

Clone: SPB02; same as 1B9<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not determined<br />

Immunogen: Recombinant surfactant protein B<br />

Molecular Weight: 8-9kDa<br />

Positive Control: Lung adenocarcinoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Quantity<br />

FFPE human lung stained with Surfactant<br />

Protein B Ab–2.<br />

Conc.<br />

Cat. No.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-038-A0<br />

RB-038-A1<br />

RB-038-A<br />

RB-038-R7<br />

RB-038-PCS<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab wWithout BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

MS-1300-P0<br />

MS-1300-P1<br />

MS-1300-P<br />

MS-1300-P1ABX<br />

MS-1300-PABX<br />

MS-1300-R7<br />

MS-1300-PCS<br />

USA: RUO; Int'l: RUO<br />

SREBP-1 (Sterol Regulatory Element Binding Protein-1) Ab-1,<br />

Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 2A4<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Hamster. Others not known.<br />

Epitope: aa 301-407<br />

Immunogen: Recombinant protein encoding N-terminal amino acids<br />

301-407 (the bHLH/leucine zipper domain) of human SREBP-1<br />

Molecular Weight: 125kDa (precursor) and 60-70kDa (cleaved)<br />

Positive Control: HeLa and IMR5 cells<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Not verified)<br />

anti–SREBP–1<br />

(Sterol Regulatory<br />

Element<br />

Binding<br />

Protein–1)<br />

Ab–1, WB<br />

Surfactant Protein B (Precursor) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: SPB01; same as 1-2-A5-9<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant prosurfactant protein B<br />

Molecular Weight: 42-46kDa<br />

Positive Control: Lung adenocarcinoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

FFPE rat lung stained with Prosurfactant<br />

Protein B Ab–1.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1207-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1207-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1207-P<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1207-P1ABX<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

200µL<br />

100µL<br />

1mg/mL MS-1207-PABX<br />

250µg/100µL MS-1207-PCL<br />

FFPE human lung stained with Prosurfactant<br />

Protein B Ab–1.<br />

USA: RUO; Int'l: RUO<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-704-P0<br />

Sterol Regulatory Element Binding Protein-1, see SREBP-1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-704-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-704-P<br />

Stromelysin-1, see MMP-3<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

200µL<br />

1mg/mL<br />

1mg/mL<br />

MS-704-P1ABX<br />

MS-704-PABX<br />

Stromelysin-2, see MMP-10<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

100µL<br />

500µL<br />

200µg/mL<br />

200µg/mL<br />

MS-704-B0<br />

MS-704-B1<br />

Stromelysin-3, see MMP-11<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

1mL<br />

7mL<br />

200µg/mL<br />

n/a<br />

MS-704-B<br />

MS-704-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-704-PCS<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

229


Survivin, Rabbit Polyclonal Antibody<br />

Survivin Ab-6, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the<br />

C-terminus of human survivin<br />

Molecular Weight: 16.5kDa<br />

Positive Control: Normal pancreas (α-cells) or prostate<br />

CA<br />

Cellular Localization: Cytoplasmic and Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human pancreas stained with Survivin.<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Mouse. Others not<br />

tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the<br />

C-terminus of survivin<br />

Molecular Weight: 16.5kDa<br />

Positive Control: Stomach<br />

Cellular Localization: Cytoplasmic and Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human stomach stained with Survivin<br />

Ab–6.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

RB-9245-P0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

1mg/mL<br />

RB-1629-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

RB-9245-P1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

1mg/mL<br />

RB-1629-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

RB-9245-P<br />

Purified Ab with BSA and Azide<br />

1mL<br />

1mg/mL<br />

RB-1629-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RB-9245-R7<br />

Ab without BSA/Azide (Frozen)<br />

500µL<br />

1mg/mL<br />

RB-1629-P1ABX<br />

USA: RUO; Int'l: RUO<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control for IHC<br />

1mL<br />

5 Slides<br />

1mg/mL<br />

n/a<br />

RB-1629-PABX<br />

RB-1629-PCS<br />

Survivin Ab-1, Mouse Monoclonal Antibody<br />

USA: RUO; Int'l: RUO<br />

Host Species: Mouse<br />

Clone: 8E2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rat. Others not known.<br />

Epitope: aa 1-99<br />

Immunogen: Full-length recombinant human survivin protein<br />

Molecular Weight: 16.5kDa<br />

Positive Control: HeLa cells<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Not suitable)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1201-P0<br />

MS-1201-P1<br />

MS-1201-P<br />

MS-1201-P1ABX<br />

MS-1201-PABX<br />

SV40 Large T Antigen Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PAb101; originally clone 412<br />

Isotype: IgG2a1<br />

Species Reactivity: SV40 virus.<br />

Epitope: C-terminal<br />

Immunogen: SV40-transformed mouse line B4<br />

Molecular Weight: 94kDa<br />

Positive Control: SV40-transfected cells<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1832-P0<br />

MS-1832-P1<br />

MS-1832-P<br />

MS-1832-P1ABX<br />

MS-1832-PABX<br />

230<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


SV40 Large T Antigen Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: PAb108<br />

Isotype: IgG2a1<br />

Species Reactivity: SV40 virus.<br />

Epitope: N-terminal<br />

Immunogen: SV40-transformed mouse line B4<br />

Molecular Weight: 94kDa<br />

Positive Control: SV40-transfected cells<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1833-P0<br />

MS-1833-P1<br />

MS-1833-P<br />

MS-1833-P1ABX<br />

MS-1833-PABX<br />

Synaptophysin (Neuroendocrine Marker), Rabbit Monoclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Clone: SP11<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: C-terminus<br />

Immunogen: A synthetic peptide of human<br />

synaptophysin<br />

Molecular Weight: 38kDa<br />

Positive Control: IMR5 cells, Pancreas or<br />

Pheochromocytoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

IVD†<br />

FFPE neuroendocrine tumor stained with<br />

Synaptophysin.<br />

RabbitMAb<br />

anti–Synaptophysin<br />

(Neuroendocrine<br />

Marker), WB<br />

Syk Signaling Protein Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 4D10.1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human.<br />

Does not react with pig or<br />

mouse. Others not known.<br />

Epitope: aa 313-339<br />

Immunogen: Synthetic peptide<br />

corresponding to aa 313-339<br />

of human Syk protein<br />

Molecular Weight: 72kDa<br />

Positive Control: Raji, K562,<br />

HL-60, U937 cells or lymphoma<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• in vitro Kinase Assay (Not<br />

verified)<br />

FFPE human lymphoma stained with Syk<br />

Ab–1.<br />

anti–Syk Signalling<br />

Protein<br />

Ab–1, WB<br />

anti–Syk Signalling<br />

Protein nalling Protein<br />

anti–Syk Sig-<br />

Ab–1, Native Ab–1, Denatured<br />

IP<br />

IP<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

FFPE human Pancreas stained with Synaptophysin<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

100µL<br />

Conc. Cat. No.<br />

n/a RM-9111-S0<br />

n/a RM-9111-S1<br />

n/a RM-9111-S<br />

n/a RM-9111-R7<br />

n/a RM-9111-RQ<br />

250µg/100µL RM-9111-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-322-P0<br />

200µg/mL MS-322-P1<br />

200µg/mL MS-322-P<br />

1mg/mL MS-322-P1ABX<br />

1mg/mL MS-322-PABX<br />

200µg/mL MS-322-B0<br />

200µg/mL MS-322-B1<br />

200µg/mL MS-322-B<br />

n/a MS-322-R7<br />

n/a MS-322-PCS<br />

250µg/100µL MS-322-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

231


Synaptophysin Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SYP02<br />

Isotype: IgG1<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Near C-terminus<br />

Immunogen: A synthetic peptide encoding a region<br />

near the C-terminal end of the synaptophysin protein<br />

Molecular Weight: 38kDa<br />

Positive Control: Pancreas, rheochromocytoma or<br />

thyroid<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

FFPE rat pancreas stained with Synaptophysin<br />

Ab–2.<br />

FFPE human pancreas stained with Synaptophysin<br />

Ab–2.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Synaptophysin Ab-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from<br />

C-terminus of human synaptophysin<br />

Molecular Weight: 38kDa<br />

Positive Control: IMR-5 cells, Pancreas<br />

or Pheochromocytoma or GI tumor<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control fFor IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Cat. No.<br />

MS-1150-S0<br />

MS-1150-S1<br />

MS-1150-S<br />

MS-1150-R7<br />

MS-1150-PCS<br />

FFPE human GI tumor stained with Synapto-anti–Synaptophysin<br />

Ab–4.<br />

physin Ab–4,<br />

WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-1461-P0<br />

1mg/mL RB-1461-P1<br />

1mg/mL RB-1461-P<br />

1mg/mL RB-1461-P1ABX<br />

1mg/mL RB-1461-PABX<br />

n/a RB-1461-R7<br />

n/a RB-1461-PCS<br />

250µg/100µL RB-1461-PCL<br />

Synuclein Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: syn211<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant α-synuclein<br />

Molecular Weight: ~14kDa<br />

Positive Control: Brain<br />

Cellular Localization: Neuronal cytosol and presynaptic terminals<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Synuclein α, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human and Rat. Others not tested.<br />

Epitope: Near C-terminus<br />

Immunogen: A synthetic peptide derived from near<br />

C-terminus of human α-Synuclein<br />

Molecular Weight: 15kDa<br />

Positive Control: Posterior cingulated gyrus<br />

Cellular Localization: Neuronal cytosol and<br />

presynaptic terminals<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

T200, see CD45<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1572-P0<br />

MS-1572-P1<br />

MS-1572-P<br />

MS-1572-P1ABX<br />

MS-1572-PABX<br />

MS-1572-R7<br />

MS-1572-PCS<br />

IVD†<br />

FFPE human brain stained with α–Synuclein.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9026-P0<br />

RB-9026-P1<br />

RB-9026-P<br />

RB-9026-R7<br />

232<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


TACE (TNF-α converting enzyme)/ADAM17 Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Tartrate Resistant Acid Phosphatase (TRAP) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse, Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide from the C-terminus of human<br />

TACE protein<br />

Molecular Weight: 80-130kDa (corresponding to mature,<br />

precursor and glycosylated forms)<br />

Positive Control: HeLa cells<br />

Cellular Localization: Membrane<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

anti–TACE anti–TACE<br />

(TNF–alpha (TNF–alpha<br />

converting enzyme)/ADAM17<br />

converting en-<br />

zyme)/ADAM17<br />

Ab–1, WB<br />

Ab–1, Denatured<br />

IP<br />

Conc. Cat. No.<br />

1mg/mL RB-1660-P0<br />

1mg/mL RB-1660-P1<br />

1mg/mL RB-1660-P<br />

1mg/mL RB-1660-P1ABX<br />

1mg/mL RB-1660-PABX<br />

250µg/100µL RB-1660-PCL<br />

Host Species: Mouse<br />

Clone: 26E5<br />

Isotype: IgG2b<br />

Species Reactivity: Human. Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant protein corresponding to<br />

N-terminal region of human TRAP<br />

Positive Control: Lung (macrophages)<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Tau Ab-2, Mouse Monoclonal Antibody<br />

IVD†<br />

FFPE human lung stained with TRAP Ab–1.<br />

Conc. Cat. No.<br />

n/a MS-1768-S0<br />

n/a MS-1768-S1<br />

n/a MS-1768-S<br />

n/a MS-1768-R7<br />

n/a MS-1768-PCS<br />

TAG-72/CA 72-4* Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: B72.3<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Dog, Hamster and<br />

Rat. Others not known.<br />

Epitope: Mucin-carried-sialylated-Tn epitope<br />

Immunogen: Membrane-enriched fraction of a human<br />

breast carcinoma liver metastasis<br />

Molecular Weight: >1000kDa<br />

Positive Control: Breast or lung CA<br />

Cellular Localization: Cell surface and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Flow Cytometry<br />

• Radioimaging<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human colon carcinoma stained with<br />

TAG–72 Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-138-P0<br />

MS-138-P1<br />

MS-138-P<br />

MS-138-P1ABX<br />

MS-138-PABX<br />

MS-138-R7<br />

MS-138-PCS<br />

Host Species: Mouse<br />

Clone: TAU-5<br />

Isotype: IgG1<br />

Species Reactivity: Human, Sheep, Cow, Mouse and Rat.<br />

Others not known.<br />

Epitope: Middle of Tau<br />

Immunogen: Purified bovine microtubule-associated proteins<br />

Molecular Weight: 45-68kDa<br />

Positive Control: IMR5 cells, Human T98G glioblastoma cells<br />

or Alzheimer's disease brain tissue<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–TAU<br />

Ab–2, Denatured<br />

IP<br />

anti–TAU<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-247-P0<br />

200µg/mL MS-247-P1<br />

200µg/mL MS-247-P<br />

1mg/mL MS-247-P1ABX<br />

1mg/mL MS-247-PABX<br />

200µg/mL MS-247-B0<br />

200µg/mL MS-247-B1<br />

200µg/mL MS-247-B<br />

250µg/100µL MS-247-PCL<br />

TAPA-1, see CD81<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

233


Tau Ab-3, Rabbit Polyclonal Antibody<br />

Tenascin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: Recombinant protein encoding<br />

C-terminal part of human tau<br />

Molecular Weight: 45-68kDa<br />

Positive Control: Alzheimer's disease brain tissue<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human brain of Alzheimer's disease<br />

stained with Tau Ab–3.<br />

Host Species: Mouse<br />

Clone: T2H5<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human breast carcinoma<br />

Molecular Weight: 210 and 300kDa<br />

Positive Control: Tonsil or squamous cell CA<br />

Cellular Localization: Connective tissue matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human squamous cell carcinoma<br />

stained with Tenascin Ab–1.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

n/a<br />

RB-1429-A0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-128-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

n/a<br />

RB-1429-A1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-128-P1<br />

Purified Ab with BSA and Azide<br />

1mL<br />

n/a<br />

RB-1429-A<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-128-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

RB-1429-R7<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-128-P1ABX<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

RB-1429-PCS<br />

Ab without BSA/Azide (Frozen)<br />

200µL<br />

1mg/mL<br />

MS-128-PABX<br />

USA: RUO; Int'l: RUO<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-128-R7<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-128-PCS<br />

T-Cell Marker, see CD43<br />

USA: RUO; Int'l: RUO<br />

T-Cell Signaling Protein, see ITK<br />

Terminal Deoxyribonucleotidyl Transferase, see TdT<br />

TdT/Terminal Deoxyribonucleotidyl Transferase Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: SEN28<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Does not react with rat.<br />

Others not known.<br />

Epitope: N-terminal<br />

Immunogen: Recombinant protein corresponding to<br />

the amino terminal region of the TdT molecule<br />

Molecular Weight: 58kDa<br />

Positive Control: Thymus<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

IVD†<br />

FFPE human thymus stained with TdT<br />

Ab–1.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1105-S0<br />

MS-1105-S1<br />

MS-1105-S<br />

MS-1105-R7<br />

MS-1105-RQ<br />

TGFβ 1/3 Receptor, see CD105<br />

TGFα, see Transforming Growth Factor α<br />

Thomsen-Friedenreich Antigen Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A78-G/A7<br />

Isotype: IgM/κ<br />

Species Reactivity: Human and Rat. Others not<br />

known.<br />

Epitope: Galβ1-3GalNAc<br />

Immunogen: Neuraminidase-treated human red blood<br />

cells<br />

Positive Control: KG1 cells, Human colorectal CA<br />

tissues<br />

Cellular Localization: Membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

FFPE human colon adenocarcinoma<br />

stained with Thomsen–Friedenreich Antigen<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-455-P0<br />

MS-455-P1<br />

MS-455-P<br />

MS-455-P1ABX<br />

MS-455-PABX<br />

MS-455-R7<br />

MS-455-PCS<br />

USA: RUO; Int'l: RUO<br />

Thrombomodulin (TSP), see CD141<br />

234<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Thrombospondin (TSP) Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A4.1<br />

Isotype: IgM<br />

Species Reactivity: Human, Mouse, Rat, Cow and Chicken. Others not<br />

known.<br />

Epitope: N-terminal half of the central stalk-like region of TSP, which is<br />

recovered as a 50kDa fragment after chymotryptic digestion of TSP<br />

Immunogen: Calcium-replete, native purified human TSP from the<br />

supernatant of thrombin-activated platelets<br />

Molecular Weight: ~450kDa (nonreduced)<br />

Positive Control: HUVEC cells<br />

Cellular Localization: Secretory granules, Golgi complex, endoplasmic<br />

reticulum, extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Nonreduced only)<br />

• Immunofluorescence<br />

• Blocks Binding of TSP-1 to TSP-Rec./CD36<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Human<br />

Thrombospondin<br />

(TSP) Mab,<br />

WB<br />

Cat. No.<br />

MS-418-P0<br />

MS-418-P1<br />

MS-418-P<br />

MS-418-P1ABX<br />

MS-418-PABX<br />

Thrombospondin (TSP) Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: C6.7<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Pig, Horse, Dog, Sheep and<br />

Rat. Others not known.<br />

Epitope: Platelet- or cell-binding domain at the extreme<br />

C-terminus of TSP<br />

Immunogen: Ca 2+ -replete, native purified human TSP from<br />

supernatant of thrombin-activated platelets<br />

Molecular Weight: ~450kDa (Nonreduced)<br />

Cellular Localization: Secretory granules, Golgi complex,<br />

endoplasmic reticulum, extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Nonreduced only)<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

• Flow Cytometry<br />

• Blocks Binding of TSP-1 to IAP/CD47<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

anti–Human anti–Human<br />

Thrombospondin<br />

Throm-<br />

bospondin<br />

(TSP) MAb, (TSP) Mab,<br />

Native IP WB<br />

Cat. No.<br />

MS-420-P0<br />

MS-420-P1<br />

MS-420-P<br />

MS-420-P1ABX<br />

MS-420-PABX<br />

Thrombospondin (TSP) Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: A6.1<br />

Isotype: IgG1<br />

Species Reactivity: Human, Cow, Pig,<br />

Horse, Dog, Sheep, Mouse and Rat. Others<br />

not known.<br />

Epitope: Collagen Type V-binding domain<br />

of TSP<br />

Immunogen: Reduced and alkylated<br />

purified human TSP (fully denatured) from<br />

the supernatant of thrombin-activated<br />

platelets<br />

Molecular Weight: ~450kDa<br />

(nonreduced), 170 to 180kDa (reduced)<br />

Positive Control: Tonsil or Placenta<br />

Cellular Localization: Secretory granules,<br />

Golgi complex, endoplasmic reticulum,<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

FFPE human placenta stained with Thrombospondin<br />

Ab–4.<br />

anti–Thrombospondin (TSP) Ab–4, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

anti–Thrombospondin<br />

(TSP) Ab–4,<br />

Native IP<br />

Cat. No.<br />

MS-421-P0<br />

MS-421-P1<br />

MS-421-P<br />

MS-421-P1ABX<br />

MS-421-PABX<br />

MS-421-B0<br />

MS-421-B1<br />

MS-421-B<br />

MS-421-R7<br />

MS-421-PCS<br />

Thrombospondin (TSP) Ab-11, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D4.6 + A6.1 + MBC 200.1<br />

Isotype: IgG1 + IgG1 + IgG1<br />

Species Reactivity: Human. Others not<br />

known.<br />

Immunogen: Purified human TSP<br />

Molecular Weight: ~450kDa (nonreduced),<br />

170 to 180kDa (reduced)<br />

Cellular Localization: Secretory granules,<br />

Golgi complex, endoplasmic reticulum,<br />

extracellular matrix<br />

anti–Thrombospondin (TSP)1, WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting (Reduced and nonreduced)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1066-P0<br />

MS-1066-P1<br />

MS-1066-P<br />

MS-1066-P1ABX<br />

MS-1066-PABX<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

235


Thrombospondin-1 (TSP-1) Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: D4.6<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Mouse, Rat, Cow, Pig, Horse,<br />

Dog and Sheep. Others not<br />

known.<br />

Epitope: Calcium-binding<br />

domain of TSP (C-terminal<br />

50kDa piece of the 120kDa<br />

fragment)<br />

Immunogen: Reduced and<br />

alkylated purified human TSP<br />

(fully denatured) from the<br />

supernatant of<br />

thrombin-activated platelets<br />

anti–Human<br />

Thrombospondin–1<br />

(TSP–1) MAb,<br />

Native IP<br />

anti–Human Thrombospondin–1 (TSP–1) Mab, WB<br />

Molecular Weight: ~450kDa (nonreduced), 170 to 180kDa (reduced)<br />

Cellular Localization: Secretory granules, Golgi complex, endoplasmic reticulum,<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-419-P0<br />

MS-419-P1<br />

MS-419-P<br />

MS-419-P1ABX<br />

MS-419-PABX<br />

MS-419-B0<br />

MS-419-B1<br />

MS-419-B<br />

Thymidine Phosphorylase/PD-ECGF Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: P-GF.44C<br />

Isotype: IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant full-length human<br />

thymidine phosphorylase (TP/PD-ECGF) protein<br />

Molecular Weight: 55kDa (reduced)<br />

Positive Control: HUVEC cells, Breast CA<br />

Cellular Localization: Cytoplasmic and nuclear FFPE human breast carcinoma stained<br />

Applications:<br />

with Thymidine Phosphorylase Ab–1.<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Neutralizes Enzymatic Activity of TP/PD-ECGF (Not verified)<br />

Thymidylate Synthase Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TS 106<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human TS enzyme<br />

Molecular Weight: 36kDa<br />

Positive Control: 5-FU-resistant cell cancer lines or colon CA<br />

Cellular Localization: Nuclear and cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native verified)<br />

• ELISA<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Thyroglobulin Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TGB04 (2H11) + TGB05 (6E1)<br />

Isotype: IgG1 + IgG1<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human thyroglobulin<br />

Molecular Weight: 330kDa<br />

Positive Control: Thyroid<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Flow Cytometry<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

anti–Thymidylate<br />

Synthase, late Synthase,<br />

anti–Thymidy-<br />

Native IP WB<br />

Cat. No.<br />

MS-471-P0<br />

MS-471-P1<br />

MS-471-P<br />

MS-471-P1ABX<br />

MS-471-PABX<br />

IVD†<br />

FFPE human thyroid gland from Hashimoto's<br />

disease stained with Thyroglobulin<br />

Ab–6.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1380-P0<br />

MS-1380-P1<br />

MS-1380-P<br />

MS-1380-R7<br />

MS-1380-RQ<br />

MS-1380-PCS<br />

MS-1380-P1ABX<br />

MS-1380-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control fFor IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-499-P0<br />

MS-499-P1<br />

MS-499-P<br />

MS-499-P1ABX<br />

MS-499-PABX<br />

MS-499-R7<br />

MS-499-PCS<br />

USA: RUO; Int'l: RUO<br />

236<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Thyroid Cancer Marker, Mouse Monoclonal Antibody<br />

Tid-1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 373E1<br />

Species Reactivity: Human. Others not tested.<br />

Positive Control: Papillary Thyroid CA<br />

Cellular Localization: Membrane, cytoplasmic and<br />

luminal<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

FFPE human papillary thyroid carcinoma<br />

stained with Thyroid Cancer Marker.<br />

Host Species: Mouse<br />

Clone: RS13<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and Rat. Others not known.<br />

Immunogen: Recombinant hTid-1 protein<br />

Molecular Weight: 40 and 43kDa<br />

Positive Control: HeLa and Jurkat cells<br />

Cellular Localization: Mitochondria<br />

Applications:<br />

• Western Blotting<br />

• Immunoprecipitation<br />

anti–TID–1<br />

Ab–2, WB<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Culture Supernatant with Azide<br />

100µL<br />

n/a<br />

MS-1914-S0<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-1564-P0<br />

Culture Supernatant with Azide<br />

500µL<br />

n/a<br />

MS-1914-S1<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-1564-P1<br />

Culture Supernatant with Azide<br />

1mL<br />

n/a<br />

MS-1914-S<br />

Purified Ab with BSA and Azide<br />

1mL<br />

200µg/mL<br />

MS-1564-P<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

n/a<br />

MS-1914-R7<br />

Ab without BSA/Azide (Frozen)<br />

100µL<br />

1mg/mL<br />

MS-1564-P1ABX<br />

USA: RUO; Int'l: RUO<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

200µL<br />

100µL<br />

1mg/mL MS-1564-PABX<br />

250µg/100µL MS-1564-PCL<br />

Thyroid Stimulating Hormone (TSH) Ab-3, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: TSH01 + TSH02<br />

Isotype: IgG1/κ + IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified human TSH-β<br />

Molecular Weight: 14kDa (β), 28kDa (αβ)<br />

Positive Control: Anterior pituitary<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

†USA: IVD; Int'l: IVD<br />

Thyroid Transcription Factor-1, see TTF-1<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

200µL<br />

IVD†<br />

FFPE human pituitary stained with TSH<br />

Ab–3.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1453-P0<br />

MS-1453-P1<br />

MS-1453-P<br />

MS-1453-R7<br />

MS-1453-PCS<br />

MS-1453-P1ABX<br />

MS-1453-PABX<br />

USA: RUO; Int'l: RUO<br />

TIMP-1 Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 102D1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human TIMP-1<br />

Molecular Weight: 28.5kDa<br />

Positive Control: Conditioned, serum-free<br />

medium from (TPA-treated) human fetal<br />

lung cell line HFL-1; Bladder, breast and FFPE human breast carcinoma stained with anti–TIMP–1<br />

ovarian CA<br />

TIMP–1 Ab–2.<br />

Ab–2, WB<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-608-P0<br />

200µg/mL MS-608-P1<br />

200µg/mL MS-608-P<br />

1mg/mL MS-608-P1ABX<br />

1mg/mL MS-608-PABX<br />

200µg/mL MS-608-B0<br />

200µg/mL MS-608-B1<br />

200µg/mL MS-608-B<br />

n/a MS-608-R7<br />

n/a MS-608-PCS<br />

250µg/100µL MS-608-PCL<br />

USA: RUO; Int'l: RUO<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

237


TIMP-2 Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: T2-101<br />

Isotype: IgG1<br />

Species Reactivity: Human. Does not react with mouse and rat. Others<br />

not known.<br />

Epitope: aa 111-126. This epitope is not involved in binding of TIMP-2 to<br />

MMP-2<br />

Immunogen: Native human pro-MMP-2/TIMP-2 complex purified from<br />

A2058 culture medium followed by purified human rTIMP-2<br />

Molecular Weight: 21kDa<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated)<br />

human fetal lung cell line HFL-1<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Immunoprecipitation (Native and denatured)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–TIMP–2<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-571-P0<br />

200µg/mL MS-571-P1<br />

200µg/mL MS-571-P<br />

1mg/mL MS-571-P1ABX<br />

1mg/mL MS-571-PABX<br />

200µg/mL MS-571-B0<br />

200µg/mL MS-571-B1<br />

200µg/mL MS-571-B<br />

250µg/100µL MS-571-PCL<br />

TIMP-2 Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 3A4<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human, Mouse, Rat,<br />

Rabbit, Cow and Guinea Ppig. Others not<br />

known.<br />

Epitope: N-terminal<br />

Immunogen: A synthetic peptide from the<br />

N-terminal region of human TIMP-2 protein<br />

Molecular Weight: 21kDa<br />

Positive Control: Conditioned, serum-free FFPE human pancreatic tumor stained with anti–TIMP–2<br />

medium from (TPA-treated) HFL-1 cells; TIMP–2 Ab–5.<br />

Ab–5, WB<br />

Pancreatic or colon CA<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin only)<br />

• Western Blotting<br />

• Immunoprecipitation (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1485-P0<br />

200µg/mL MS-1485-P1<br />

200µg/mL MS-1485-P<br />

1mg/mL MS-1485-P1ABX<br />

1mg/mL MS-1485-PABX<br />

200µg/mL MS-1485-B0<br />

200µg/mL MS-1485-B1<br />

200µg/mL MS-1485-B<br />

n/a MS-1485-R7<br />

n/a MS-1485-PCS<br />

250µg/100µL MS-1485-PCL<br />

TNFα Converting Enzyme, see TACE<br />

Topoisomerase II α Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 1513-1530<br />

Immunogen: A synthetic peptide, corresponding to aa<br />

1513-1530 (RAKKPIKYLEESDEDDLF) from the C-terminus of<br />

human topoisomerase IIα<br />

Molecular Weight: 170kDa<br />

Positive Control: Raji cells or any exponentially growing<br />

cultured human cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native and denatured)<br />

anti–Topoisomerase<br />

II alpha<br />

Ab–1, Native<br />

IP<br />

anti–Topoisomerase<br />

II alpha<br />

Ab–1, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

1mg/mL RB-117-P0<br />

1mg/mL RB-117-P1<br />

1mg/mL RB-117-P<br />

1mg/mL RB-117-P1ABX<br />

1mg/mL RB-117-PABX<br />

250µg/100µL RB-117-PCL<br />

238<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Topoisomerase II α Ab-4, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: Ki-S1<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Lysate of the human histiocytic leukemia<br />

cell line U937<br />

Molecular Weight: 170kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

IVD†<br />

FFPE human tonsil stained with Topoisomerase<br />

II α.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Toxoplasma gondii Ab-1, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Intact Toxoplasma gondii<br />

Positive Control: Infected brain tissue<br />

Cellular Localization: Whole organism<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Cat. No.<br />

MS-1819-S0<br />

MS-1819-S1<br />

MS-1819-S<br />

MS-1819-R7<br />

MS-1819-RQ<br />

MS-1819-PCS<br />

IVD†<br />

Toxoplasma gondii, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Species Reactivity: Human. Others not tested.<br />

Immunogen: Toxoplasma gondii<br />

Positive Control: Infected brain tissue<br />

Cellular Localization: Whole organism<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

FFPE human T. gondii–infected brain<br />

stained with T. gondii.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

TR2/HVEM Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 122<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human TR2 protein<br />

Molecular Weight: 32kDa<br />

Positive Control: Tonsil<br />

Cellular Localization: Secreted protein<br />

Applications:<br />

• Immunofluorescence<br />

• Flow Cytometry<br />

• Function Blocking<br />

Cat. No.<br />

RB-9423-P0<br />

RB-9423-P1<br />

RB-9423-P<br />

RB-9423-R7<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

FFPE human infected brain stained with<br />

Toxoplasma gondii Ab–1.<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

100µL<br />

500µL<br />

200µg/mL<br />

200µg/mL<br />

MS-710-P0<br />

MS-710-P1<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RB-282-A0<br />

RB-282-A1<br />

RB-282-A<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

1mL<br />

100µL<br />

200µL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

MS-710-P<br />

MS-710-P1ABX<br />

MS-710-PABX<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

7mL<br />

12mL<br />

n/a<br />

n/a<br />

RB-282-R7<br />

RB-282-RQ<br />

Transcription Factor, see Microphthalmia<br />

USA: ASR; Int'l: RUO†<br />

Transferrin Receptor, see CD71<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

239


Transforming Growth Factor α (TGFα) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: MF9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Cow, Rat and Mouse. Others not known.<br />

Epitope: C-terminal<br />

Immunogen: A 17-amino acid synthetic peptide from the carboxyl-terminus<br />

of rat TGFα<br />

Molecular Weight: 6kDa<br />

Positive Control: Recombinant TGFα protein, A2058 cells<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–Transforming<br />

Growth Factor<br />

alpha (TG-<br />

Falpha)<br />

Ab–1, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-670-P0<br />

200µg/mL MS-670-P1<br />

200µg/mL MS-670-P<br />

1mg/mL MS-670-P1ABX<br />

1mg/mL MS-670-PABX<br />

200µg/mL MS-670-B0<br />

200µg/mL MS-670-B1<br />

200µg/mL MS-670-B<br />

250µg/100µL MS-670-PCL<br />

Transglutaminase II Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CUB 7402<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Dog, Rabbit and Guinea Pig.<br />

Does not react with mouse and<br />

rat. Others not known.<br />

Epitope: aa 447-478<br />

Immunogen: Purified guinea<br />

pig liver TGase II<br />

Molecular Weight: 77-85kDa<br />

Positive Control: HUVEC cells,<br />

Breast CA<br />

Cellular Localization:<br />

Cytoplasm, membrane and<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Affinity Purification<br />

• Biological Blockade<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast carcinoma stained withanti–Transglu-<br />

anti–Transglutaminase<br />

Transglutaminase II Ab–1.<br />

taminase II<br />

Ab–1, Native<br />

IP<br />

II<br />

Ab–1, Denatured<br />

IP<br />

anti–Transglutaminase<br />

II<br />

Ab–1, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-224-P0<br />

200µg/mL MS-224-P1<br />

200µg/mL MS-224-P<br />

1mg/mL MS-224-P1ABX<br />

1mg/mL MS-224-PABX<br />

200µg/mL MS-224-B0<br />

200µg/mL MS-224-B1<br />

200µg/mL MS-224-B<br />

n/a MS-224-R7<br />

n/a MS-224-PCS<br />

250µg/100µL MS-224-PCL<br />

240<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Transglutaminase II Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TG100<br />

Isotype: IgG1<br />

Species Reactivity: Human,<br />

Rat and Guinea Pig. Others not<br />

known.<br />

Epitope: aa 447-538<br />

Immunogen: Purified guinea<br />

pig liver TGase II<br />

Molecular Weight: 77-85kDa<br />

Positive Control: HUVEC cells,<br />

Breast CA<br />

Cellular Localization:<br />

Cytoplasm, membrane and<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE rat spleen stained with Transglutaminase<br />

II Ab–2.<br />

taminase II<br />

anti–Transglu-<br />

Ab–2, Native<br />

IP<br />

Transglutaminase II Ab-3, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CUB 7402 + TG100<br />

Isotype: IgG1<br />

Species Reactivity: Human<br />

and Guinea Pig. Others not<br />

known.<br />

Immunogen: Purified<br />

transglutaminase II from guinea<br />

pig liver<br />

Molecular Weight: 77-85kDa<br />

Positive Control: HUVEC cells,<br />

Breast CA<br />

Cellular Localization:<br />

Cytoplasm, membrane and<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

FFPE human breast carcinoma stained with<br />

Transglutaminase II Ab–3.<br />

anti–Transglutaminase<br />

anti–Transglu-<br />

II taminase II<br />

Ab–3, Native Ab–3, Denatured<br />

IP<br />

IP<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human breast carcinoma stained withanti–Transglu-<br />

anti–Transglutaminase<br />

Transglutaminase II Ab–2.<br />

taminase II<br />

Ab–2, Denatured<br />

IP<br />

II<br />

Ab–2, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-279-P0<br />

200µg/mL MS-279-P1<br />

200µg/mL MS-279-P<br />

1mg/mL MS-279-P1ABX<br />

1mg/mL MS-279-PABX<br />

200µg/mL MS-279-B0<br />

200µg/mL MS-279-B1<br />

200µg/mL MS-279-B<br />

n/a MS-279-R7<br />

n/a MS-279-PCS<br />

250µg/100µL MS-279-PCL<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

anti–Transglutaminase<br />

II<br />

Ab–3, WB<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-300-P0<br />

200µg/mL MS-300-P1<br />

200µg/mL MS-300-P<br />

1mg/mL MS-300-P1ABX<br />

1mg/mL MS-300-PABX<br />

n/a MS-300-R7<br />

n/a MS-300-PCS<br />

250µg/100µL MS-300-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

241


Transglutaminase II Ab-4, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human,<br />

Mouse and Rat. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant<br />

full-length human TGase II<br />

Molecular Weight: 77-85kDa<br />

Positive Control: HUVEC cells,<br />

Breast CA<br />

Cellular Localization:<br />

Cytoplasm, membrane and<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

FFPE rat spleen stained with Transglutminase<br />

anti–Transglu-<br />

anti–Transglutaminase<br />

II Ab–4.<br />

taminase II<br />

Ab–4, Native<br />

IP<br />

II<br />

Ab–4, WB<br />

Troponin T, Cardiac Isoform Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 13-11<br />

Isotype: IgG1<br />

Species Reactivity: Human, Pig, Dog, Rabbit, Rat,<br />

Mouse, Guinea Pig, Chicken, Sparrow and Goldfish.<br />

Does not react with frog.<br />

Epitope: FMPNLVPPKI (5' region of the cardiac gene<br />

exon 10)<br />

Immunogen: Purified rabbit cardiac troponin T isoform<br />

(TnT4R)<br />

Positive Control: Cardiac muscle<br />

Cellular Localization: Mostly over the I bands in<br />

myofibrils<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

• Electron Microscopy<br />

IVD†<br />

FFPE human heart stained with Troponin T<br />

Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

500µL<br />

1mL<br />

100µL<br />

500µL<br />

1mL<br />

5 Slides<br />

100µL<br />

TRAP, see Tartrate Resistant Acid Phosphatase<br />

Tropomyosin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CH1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Rat and Chicken. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Tropomyosin protein purified from<br />

chicken embryo fibroblasts (CEF) and chicken leg,<br />

heart and gizzard<br />

Positive Control: Skeletal or Cardiac muscle<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting (Not verified)<br />

• Immunofluorescence<br />

Conc. Cat. No.<br />

1mg/mL RB-060-P0<br />

1mg/mL RB-060-P1<br />

1mg/mL RB-060-P<br />

1mg/mL RB-060-P1ABX<br />

1mg/mL RB-060-PABX<br />

1mg/mL RB-060-B0<br />

1mg/mL RB-060-B1<br />

1mg/mL RB-060-B<br />

n/a RB-060-PCS<br />

250µg/100µL RB-060-PCL<br />

FFPE human heart stained with<br />

Tropomyosin Ab–1.<br />

Format<br />

Quantity<br />

Purified Ab with BSA and Azide 100µL<br />

Purified Ab with BSA and Azide 500µL<br />

Purified Ab with BSA and Azide 1mL<br />

Ready-to-use for IHC (UVLP)<br />

7mL<br />

Positive Control for IHC<br />

5 Slides<br />

Ab without BSA/Azide (Frozen) 100µL<br />

Ab without BSA/Azide (Frozen) 200µL<br />

†USA: IVD; Int'l: IVD<br />

TRP75, see Tyrosinase Related Protein 75<br />

TSH, see Thyroid Stimulating Hormone<br />

Tsk, see ITK<br />

TSP, see Thrombospondin<br />

FFPE rat heart stained with Troponin T<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-295-P0<br />

MS-295-P1<br />

MS-295-P<br />

MS-295-R7<br />

MS-295-PCS<br />

MS-295-P1ABX<br />

MS-295-PABX<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1256-P0<br />

MS-1256-P1<br />

MS-1256-P<br />

MS-1256-P1ABX<br />

MS-1256-PABX<br />

MS-1256-R7<br />

MS-1256-PCS<br />

USA: RUO; Int'l: RUO<br />

242<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


TTF-1 (Thyroid Transcription Factor-1) Ab-1, Mouse Monoclonal<br />

Antibody<br />

Host Species: Mouse<br />

Clone: 8G7G3/1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human, Mouse and Rat. Shows<br />

a broad species reactivity.<br />

Epitope: Not determined<br />

Immunogen: Rat TTF-1 recombinant protein<br />

Molecular Weight: 40kDa<br />

Positive Control: MAD109 cells, normal thyroid or<br />

lung<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

IVD†<br />

FFPE rat lung stained with TTF–1 Ab–1.<br />

FFPE human lung CA stained with TTF–1<br />

Ab–1.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

MS-699-P0<br />

MS-699-P1<br />

MS-699-P<br />

MS-699-R7<br />

MS-699-RQ<br />

MS-699-PCS<br />

MS-699-P1ABX<br />

MS-699-PABX<br />

MS-699-B0<br />

MS-699-B1<br />

MS-699-B<br />

Tubulin-α Ab-2, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: DM1A<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human,<br />

Cow, Pig, Rat, Mouse, Guinea<br />

Pig, Gerbil, Frog and Chicken.<br />

Others not known.<br />

Epitope: aa 426-450<br />

Immunogen: Native chick brain<br />

microtubules<br />

Molecular Weight: 57kDa<br />

Positive Control: Ls174T,<br />

MAD109 cells; skin or lung<br />

Cellular Localization:<br />

Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Native<br />

and denatured)<br />

• Electron Microscopy<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab without BSA and Azide<br />

Purified Ab without BSA and Azide<br />

Ready-to-use for IHC<br />

Positive Control for Histology<br />

Positive Control for Western Blot<br />

USA: RUO; Int'l: RUO<br />

FFPE human lung stained with Tubulin–α<br />

Ab–2.<br />

anti–Tubulin,<br />

Native IP<br />

FFPE rat lung stained with Tubulin–α Ab–2. anti–Tubulin,<br />

Denatured IP<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Tubulin-α, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Cow, Pig,<br />

Rat, Mouse, Guinea Pig, Gerbil, Frog and<br />

Chicken.<br />

Epitope: aa 426-450<br />

Immunogen: A synthetic peptide derived<br />

from aa 426-450 of human tubulin-α<br />

Molecular Weight: 57kDa<br />

Positive Control: MAD109 cells, MCF-7<br />

cells, skin or lung<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

anti–Tubulin,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-581-P0<br />

200µg/mL MS-581-P1<br />

200µg/mL MS-581-P<br />

1mg/mL MS-581-P1ABX<br />

1mg/mL MS-581-PABX<br />

n/a MS-581-R7<br />

n/a MS-581-PCS<br />

250µg/100µL MS-581-PCL<br />

FFPE human lung stained with Tubulin–α<br />

antibody.<br />

IVD†<br />

anti–Tubulin–alpha,<br />

WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL RB-9281-P0<br />

200µg/mL RB-9281-P1<br />

200µg/mL RB-9281-P<br />

n/a RB-9281-R7<br />

250µg/100µL RB-9281-PCL<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

243


Tubulin-β, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Cow, Pig,<br />

Rat, Mouse, Guinea Pig, Gerbil, Frog,<br />

Chicken, Yeast, Fungi, Sea Urchin,<br />

Myxamoeba and Plasmodium.<br />

Epitope: aa 416-430<br />

Immunogen: A synthetic peptide derived<br />

from aa 416-430 of human tubulin-β<br />

Molecular Weight: 55kDa<br />

Positive Control: MAD109 cells, MCF-7<br />

cells, skin or lung<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

FFPE human lung stained with Tubulin–β<br />

antibody.<br />

IVD†<br />

anti–Tubulin–beta,<br />

WB<br />

Tyrosinase Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: T311<br />

IVD†<br />

Isotype: IgG2a<br />

Species Reactivity: Human, Dog and Cat.<br />

Weakly cross-reacts with Mouse. Others<br />

not known.<br />

Epitope: aa 1-433<br />

Immunogen: Recombinant tyrosinase<br />

protein<br />

Molecular Weight: 70-80kDa<br />

Positive Control: Melanoma cell lines and<br />

Melanoma<br />

Cellular Localization: Cytoplasmic FFPE human melanoma stained with Tyrosi-anti–Tyrosinase<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunocytology<br />

Ab–1.<br />

nase, WB<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Purified Ab with BSA and Azide<br />

100µL<br />

200µg/mL<br />

MS-800-P0<br />

Purified Ab with BSA and Azide<br />

500µL<br />

200µg/mL<br />

MS-800-P1<br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Positive Control Lysate<br />

FFPE human lung adenocarcinoma stained<br />

with Tubulin beta antibody<br />

Quantity<br />

7mL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

Conc. Cat. No.<br />

n/a RB-9249-R7<br />

200µg/mL RB-9249-P0<br />

200µg/mL RB-9249-P1<br />

200µg/mL RB-9249-P<br />

250µg/100µL RB-9249-PCL<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

MS-800-P<br />

MS-800-R7<br />

MS-800-RQ<br />

MS-800-PCS<br />

MS-800-P1ABX<br />

MS-800-PABX<br />

MS-800-B0<br />

MS-800-B1<br />

MS-800-B<br />

†USA: IVD; Int'l: IVD<br />

†USA: IVD; Int'l: IVD<br />

Tubulin-Α Ab-6, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TBN06; same as Tub 2.5<br />

Isotype: IgG3<br />

Species Reactivity: Human, Cow, Rabbit,<br />

Mouse, Chicken, Rat, Frog, Moth and<br />

Wheat. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified tubulin<br />

Molecular Weight: 55kDa<br />

Positive Control: Ls174T, MAD109 cells;<br />

Skin or lung<br />

FFPE human lung stained with Tubulin–β<br />

Cellular Localization: Cytoplasmic Ab–6.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

100µL<br />

200µL<br />

anti–Tubulin–Beta<br />

Ab–6, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1226-P0<br />

200µg/mL MS-1226-P1<br />

200µg/mL MS-1226-P<br />

n/a MS-1226-R7<br />

n/a MS-1226-PCS<br />

250µg/100µL MS-1226-PCL<br />

1mg/mL MS-1226-P1ABX<br />

1mg/mL MS-1226-PABX<br />

Tyrosinase Related Protein 75 (TRP75/gp75) Ab-1, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: TA99<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: SK-MEL-23 Melanoma cell line<br />

Molecular Weight: 75kDa<br />

Positive Control: SK-MEL-23, A375 cells; Melanoma, Skin<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• Western Blotting<br />

• <strong>Immunohistochemistry</strong> (Frozen)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-1634-P0<br />

MS-1634-P1<br />

MS-1634-P<br />

MS-1634-P1ABX<br />

MS-1634-PABX<br />

USA: RUO; Int'l: RUO<br />

244<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ubiquitin, Rabbit Polyclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: Not known<br />

Immunogen: Recombinant full-length human ubiquitin<br />

protein<br />

Molecular Weight: 8.5kDa<br />

Positive Control: Human brain from patient with<br />

Alzheimer's disease<br />

Cellular Localization: Nuclear, cytoplasmic and<br />

membrane<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human brain Alzheimer's disease<br />

stained with Ubiquitin antibody.<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9203-P0<br />

RB-9203-P1<br />

RB-9203-P<br />

RB-9203-R7<br />

uPA (Urokinase-type Plasminogen Activator) Ab-2, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 7-18<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Active form of human uPA<br />

Molecular Weight: ~35kDa (active) and ~55kDa (proform)<br />

Positive Control: Conditioned, serum-free medium from (TPA-treated)<br />

human fetal lung cell line HFL-1<br />

Cellular Localization: Cytoplasmic, cell surface and extracellular matrix<br />

Applications:<br />

• Western Blotting<br />

• Effect on Dissolution of Fibrin (80-90% Inhibitory)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

anti–uPA<br />

(Urokinase–type<br />

Plasminogen<br />

Activator)<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-835-P0<br />

200µg/mL MS-835-P1<br />

200µg/mL MS-835-P<br />

1mg/mL MS-835-P1ABX<br />

1mg/mL MS-835-PABX<br />

200µg/mL MS-835-B0<br />

200µg/mL MS-835-B1<br />

200µg/mL MS-835-B<br />

250µg/100µL MS-835-PCL<br />

Vascular Endothelial Growth Factor (VEGF), Rabbit Monoclonal<br />

Antibody<br />

Host Species: Rabbit<br />

RabbitMAb<br />

Clone: SP28<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not tested.<br />

Epitope: N-terminus<br />

Immunogen: A synthetic peptide derived from N-terminal of human VEGF<br />

Molecular Weight: 19-22kDa (reduced) or 38-44kDa (nonreduced)<br />

Positive Control: Angiosarcoma, VEGF recombinant protein<br />

Cellular Localization: Cytoplasmic, cell surface in endothelial cells<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

Format<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

7mL<br />

5 Slides<br />

Conc.<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9128-R7<br />

RM-9128-PCS<br />

Vascular Endothelial Growth Factor (VEGF), Rabbit Polyclonal<br />

Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not<br />

tested.<br />

Epitope: N-terminus<br />

Immunogen: A synthetic peptide derived<br />

from N-terminal of human VEGF<br />

Molecular Weight: 19-22kDa (reduced)<br />

Positive Control: Angiosarcoma<br />

Cellular Localization: Cytoplasmic, cell<br />

surface and extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready to Use<br />

†USA: ASR; Int'l: IVD<br />

FFPE human angiosarcoma stained with<br />

VEGF antibody.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

IVD†<br />

anti–Vascular<br />

Endothelial<br />

Growth Factor<br />

(VEGF), WB<br />

Cat. No.<br />

RB-9031-P0<br />

RB-9031-P1<br />

RB-9031-P<br />

RB-9031-R7<br />

RB-9031-RQ<br />

Urokinase-type Plasminogen Activator, see uPA<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

245


Vascular Endothelial Growth Factor (VEGF) Ab-1, Rabbit Polyclonal<br />

Antibody<br />

Vascular Endothelial Growth Factor (VEGF) Ab-3, Mouse<br />

Monoclonal Antibody<br />

Host Species: Rabbit<br />

Isotype: IgG<br />

Species Reactivity: Human, Mouse and Rat. Others<br />

not known.<br />

Epitope: Not determined<br />

Immunogen: Human recombinant VEGF 165<br />

Molecular Weight: 19-22kDa (reduced)<br />

Positive Control: Angiosarcoma.<br />

Cellular Localization: Cytoplasmic, cell surface and<br />

extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

†USA: ASR; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

FFPE human angiosarcoma stained with<br />

VEGF Ab–1.<br />

Conc.<br />

1mg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

RB-222-P0<br />

RB-222-P1<br />

RB-222-P<br />

RB-222-R7<br />

Host Species: Mouse<br />

Clone: JH121<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Rabbit. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human VEGF 121<br />

Molecular Weight: 19-22kDa (reduced)<br />

Positive Control: VEGF 165 recombinant protein, Angiosarcoma<br />

Cellular Localization: Cytoplasmic, cell surface and extracellular matrix<br />

Applications:<br />

• Neutralizes Bioactivity of VEGF<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

Cat. No.<br />

MS-350-P0<br />

MS-350-P1<br />

MS-350-P<br />

MS-350-P1ABX<br />

MS-350-PABX<br />

Vascular Endothelial Growth Factor (VEGF) Ab-2, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 5C3.F8<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Human VEGF from a glioma<br />

Molecular Weight: 19-22kDa (reduced)<br />

Positive Control: VEGF 165 recombinant protein<br />

Cellular Localization: Cytoplasmic, cell surface and extracellular matrix<br />

Applications:<br />

• Western Blotting (Reduced only)<br />

• Neutralization of VEGF (Not suitable)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

anti–Vascular<br />

Endothelial<br />

Growth Factor<br />

(VEGF)<br />

Ab–2, WB<br />

Conc. Cat. No.<br />

200µg/mL MS-290-P0<br />

200µg/mL MS-290-P1<br />

200µg/mL MS-290-P<br />

1mg/mL MS-290-P1ABX<br />

1mg/mL MS-290-PABX<br />

250µg/100µL MS-290-PCL<br />

Vascular Endothelial Growth Factor (VEGF) Ab-7, Mouse<br />

Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: VG1<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant VEGF protein<br />

Molecular Weight: 19-22kDa (reduced)<br />

Positive Control: VEGF 165 recombinant<br />

protein, Angiosarcoma<br />

Cellular Localization: Cytoplasmic, cell<br />

surface and extracellular matrix<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE human angiosarcoma stained with<br />

VEGF Ab–7.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

100µL<br />

anti–Vascular<br />

Endothelial<br />

Growth Factor<br />

(VEGF), WB<br />

Conc. Cat. No.<br />

200µg/mL MS-1467-P0<br />

200µg/mL MS-1467-P1<br />

200µg/mL MS-1467-P<br />

1mg/mL MS-1467-P1ABX<br />

1mg/mL MS-1467-PABX<br />

n/a MS-1467-R7<br />

250µg/100µL MS-1467-PCL<br />

VCAM-1, see CD106<br />

VDR, see Vitamin D Receptor<br />

VEGF, see Vascular Endothelial Growth Factor<br />

VEGFR1, see Flt-1<br />

VEGFR2, see Flk-1<br />

246<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


vHL Protein, see von Hippel-Lindau<br />

Vimentin Ab-2, Mouse Monoclonal Antibody<br />

Villin Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: CWWB1<br />

Isotype: IgG1<br />

Species Reactivity: Human. Others not known.<br />

Immunogen: Human Villin protein<br />

Molecular Weight: 92.5kDa<br />

Positive Control: Small intestine and kidney<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

Host Species: Mouse<br />

Clone: V9<br />

Isotype: IgG1/κ<br />

Species Reactivity: Rat, Horse, Chicken, Cow, Cat,<br />

Dog, Human and Pig. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Purified vimentin from pig eye lens<br />

Molecular Weight: 57-60kDa<br />

Positive Control: Sarcomas<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

IVD†<br />

FFPE human osteosarcoma stained with<br />

Vimentin Ab–2.<br />

FFPE human kidney stained with Villin<br />

Ab–1.<br />

Format<br />

Purified Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

Conc.<br />

200µg/mL<br />

Cat. No.<br />

MS-129-P0<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1499-P0<br />

MS-1499-P1<br />

MS-1499-P<br />

MS-1499-R7<br />

MS-1499-RQ<br />

MS-1499-PCS<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Ready-to-use for IHC (Quanto)<br />

Positive Control for IHC<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

500µL<br />

1mL<br />

7mL<br />

12mL<br />

5 Slides<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

n/a<br />

n/a<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

MS-129-P1<br />

MS-129-P<br />

MS-129-R7<br />

MS-129-RQ<br />

MS-129-PCS<br />

MS-129-P1ABX<br />

MS-129-PABX<br />

MS-129-B0<br />

MS-129-B1<br />

Vimentin, Rabbit Monoclonal Antibody<br />

Biotinylated Ab with BSA and Azide<br />

†USA: IVD; Int'l: IVD<br />

1mL<br />

200µg/mL<br />

MS-129-B<br />

Host Species: Rabbit<br />

Clone: SP20<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant protein encoding human<br />

vimentin<br />

Molecular Weight: 57-60kDa<br />

Positive Control: Sarcoma and melanoma<br />

Cellular Localization: Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

IVD†<br />

RabbitMAb<br />

FFPE human melanoma stained with Vimentin.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

RM-9120-S0<br />

RM-9120-S1<br />

RM-9120-S<br />

RM-9120-R7<br />

Vimentin/gp100, MultiVision Antibody Cocktail<br />

Host Species: Vimentin — Rabbit; gp100 — Mouse<br />

Clone: Vimentin — SP20; gp100 — HMB45<br />

Isotype: Vimentin — Rabbit monoclonal IgG; gp100<br />

— Mouse IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Vimentin — Not determined; gp100 —<br />

Not determined<br />

Immunogen: Vimentin — recombinant protein<br />

encoding human Vimentin; gp100 — Extract of<br />

pigmented melanoma metastases from lymph nodes<br />

Molecular Weight: Vimentin — 57-60kDa;<br />

gp100—100kDa<br />

Positive Control: Melanoma<br />

Cellular Localization: Vimentin — Cytoplasmic;<br />

gp100 — Cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

FFPE human melanoma stained with<br />

MV–2004–R7 using MultiVision anti–Mouse/HRP<br />

+ anti–Rabbit/AP.<br />

IVD†<br />

†USA: IVD; Int'l: IVD<br />

Format<br />

Quantity<br />

Conc.<br />

Cat. No.<br />

Ready-to-use for IHC<br />

7mL<br />

n/a<br />

MV-2004-R7<br />

†USA: IVD; Int'l: IVD<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

247


Vinculin Ab-1, Mouse Monoclonal Antibody<br />

von Hippel-Lindau (vHL) Protein Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: VLN01<br />

Isotype: IgG<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Semi-purified vinculin<br />

Molecular Weight: 130kDa (vinculin) and 150kDa<br />

(meta-vinculin)<br />

Positive Control: HeLa cells, skin<br />

Cellular Localization: Cell membrane and cytoplasmic<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunofluorescence<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

n/a<br />

anti–Vinculin<br />

Ab–1, Denatured<br />

IP<br />

anti–Vinculin<br />

Ab–1, WB<br />

Cat. No.<br />

MS-1209-P0<br />

MS-1209-P1<br />

MS-1209-P<br />

MS-1209-P1ABX<br />

MS-1209-PABX<br />

MS-1209-R7<br />

MS-1209-PCS<br />

Vitamin D Receptor (VDR) Ab-1, Rat Monoclonal Antibody<br />

Host Species: Rat<br />

Clone: 9A7γ.E10.E4<br />

Isotype: IgG2b<br />

Species Reactivity: Human, Pig, Mouse, Rat, Hamster, Frog, Chicken and Fish. Others<br />

not known.<br />

Epitope: aa 89-105 (near the DNA-binding domain)<br />

Immunogen: Vitamin D receptor protein from chicken intestine<br />

Molecular Weight: 53kDa<br />

Positive Control: LNCAP cells, HeLa cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• Western Blotting<br />

• Gel Supershift Assay<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Cat. No.<br />

RT-200-P0<br />

RT-200-P1<br />

RT-200-P<br />

RT-200-P1ABX<br />

RT-200-PABX<br />

RT-200-B0<br />

RT-200-B1<br />

RT-200-B<br />

Host Species: Mouse<br />

Clone: Ig33<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human and Mouse. Others not known.<br />

Epitope: aa 1-54<br />

Immunogen: A recombinant protein containing aa 1-213 of human vHL<br />

Molecular Weight: 30kDa<br />

Positive Control: Kidney<br />

Cellular Localization: Cytoplasmic<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

von Willebrand Factor, see Factor VIII Related Antigen<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

Wilm's Tumor Protein (WT1), Rabbit Polyclonal Antibody<br />

Cat. No.<br />

MS-690-P0<br />

MS-690-P1<br />

MS-690-P<br />

MS-690-P1ABX<br />

MS-690-PABX<br />

MS-690-B0<br />

MS-690-B1<br />

MS-690-B<br />

Host Species: Rabbit<br />

Species Reactivity: Human, Mouse and Rat. Others not tested.<br />

Epitope: C-terminal<br />

Immunogen: A synthetic peptide derived from the C-terminus of human Wilm's tumor<br />

protein<br />

Molecular Weight: 47-55kDa<br />

Positive Control: Wilm's tumor<br />

Cellular Localization: Cytoplasmic and nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

n/a<br />

Cat. No.<br />

RB-9267-P0<br />

RB-9267-P1<br />

RB-9267-P<br />

RB-9267-R7<br />

USA: RUO; Int'l: RUO<br />

v-myb, see c-myb<br />

248<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Wilm's Tumor Protein (WT1) Ab-5, Mouse Monoclonal Antibody<br />

XPF Ab-1, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 6F-H2<br />

Isotype: IgG1/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: aa 1-181<br />

Immunogen: Truncated human WT1 protein<br />

corresponding to aa 1-181<br />

Molecular Weight: 47-55kDa<br />

Positive Control: Wilm's tumor<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

Format<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Culture Supernatant with Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

†USA: IVD; Int'l: IVD<br />

WT1, see Wilm's Tumor Protein<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

XPA Ab-1, Mouse Monoclonal Antibody<br />

IVD†<br />

FFPE human Wilm's tumor stained with<br />

WT1 Ab–5.<br />

Conc.<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

n/a<br />

Cat. No.<br />

MS-1837-S0<br />

MS-1837-S1<br />

MS-1837-S<br />

MS-1837-R7<br />

MS-1837-PCS<br />

Host Species: Mouse<br />

Clone: 219<br />

Isotype: IgG2/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human XPF<br />

protein<br />

Molecular Weight: ~110kDa<br />

Positive Control: MCF-7 cells or human<br />

tonsil<br />

FFPE human tonsil stained with XPF Ab–1. anti–XPF<br />

Cellular Localization: Nuclear<br />

Ab–1, WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1381-P0<br />

200µg/mL MS-1381-P1<br />

200µg/mL MS-1381-P<br />

1mg/mL MS-1381-P1ABX<br />

1mg/mL MS-1381-PABX<br />

n/a MS-1381-R7<br />

n/a MS-1381-PCS<br />

250µg/100µL MS-1381-PCL<br />

Host Species: Mouse<br />

Clone: 12F5<br />

Isotype: IgG2a/k<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human XPA<br />

protein<br />

Molecular Weight: ~40kDa<br />

Positive Control: Ls174T or MCF-7 cells<br />

or human tonsil<br />

FFPE human tonsil stained with XPA Ab–1. anti–XPA<br />

Cellular Localization: Nuclear<br />

Ab–1, WB<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

XPF Ab-5, Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 51<br />

Isotype: IgG2b/κ<br />

Species Reactivity: Human. Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human XPF protein<br />

Molecular Weight: ~110kDa<br />

Positive Control: MCF-7 cells<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Not suitable)<br />

• Western Blotting<br />

anti–XPF<br />

Ab–5, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

Conc.<br />

200µg/mL<br />

200µg/mL<br />

200µg/mL<br />

1mg/mL<br />

1mg/mL<br />

n/a<br />

Cat. No.<br />

MS-650-P0<br />

MS-650-P1<br />

MS-650-P<br />

MS-650-P1ABX<br />

MS-650-PABX<br />

MS-650-R7<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Positive Control Lysate<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1385-P0<br />

200µg/mL MS-1385-P1<br />

200µg/mL MS-1385-P<br />

1mg/mL MS-1385-P1ABX<br />

1mg/mL MS-1385-PABX<br />

250µg/100µL MS-1385-PCL<br />

Positive Control for IHC<br />

5 Slides<br />

n/a<br />

MS-650-PCS<br />

USA: RUO; Int'l: RUO<br />

Positive Control Lysate<br />

100µL<br />

250µg/100µL MS-650-PCL<br />

USA: RUO; Int'l: RUO<br />

X-Ray Repair Cross Complementing Protein 1, see XRCC1<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

249


XRCC1 (X-Ray Repair Cross Complementing Protein 1) Ab-1,<br />

Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 33-2-5<br />

Isotype: IgG2b<br />

Species Reactivity: Human and Rat.<br />

Others not known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human XRCC1<br />

protein<br />

Molecular Weight: 85kDa<br />

Positive Control: Ls174T, HT29 or HeLa<br />

cells; normal testis<br />

Cellular Localization: Nuclear<br />

Applications:<br />

• <strong>Immunohistochemistry</strong><br />

(Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Native verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Biotinylated Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

FFPE rat testis stained with XRCC1 Ab–1. anti–XR-<br />

CC1(X–Ray<br />

Repair Cross<br />

Complementing<br />

Protein1)Ab–1,<br />

Native IP<br />

FFPE human testis stained with XRCC1<br />

Ab–1.<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

anti–XR-<br />

CC1(X–Ray<br />

Repair Cross<br />

Complementing<br />

Protein1)Ab–1,<br />

WB<br />

Conc. Cat. No.<br />

200µg/mL MS-434-P0<br />

200µg/mL MS-434-P1<br />

200µg/mL MS-434-P<br />

1mg/mL MS-434-P1ABX<br />

1mg/mL MS-434-PABX<br />

200µg/mL MS-434-B0<br />

200µg/mL MS-434-B1<br />

200µg/mL MS-434-B<br />

n/a MS-434-R7<br />

n/a MS-434-PCS<br />

250µg/100µL MS-434-PCL<br />

XRCC1 (X-Ray Repair Cross Complementing Protein 1) Ab-3,<br />

Mouse Monoclonal Antibody<br />

Host Species: Mouse<br />

Clone: 144<br />

Isotype: IgG2a/κ<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: Recombinant human XRCC1<br />

protein<br />

Molecular Weight: 85kDa<br />

Positive Control: Ls174T, or HeLa cells;<br />

normal testis<br />

FFPE human testis stained with XRCC1<br />

Cellular Localization: Nuclear<br />

Ab–3.<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

• Immunoprecipitation (Denatured verified)<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ab without BSA/Azide (Frozen)<br />

Ab without BSA/Azide (Frozen)<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

USA: RUO; Int'l: RUO<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

100µL<br />

200µL<br />

7mL<br />

5 Slides<br />

100µL<br />

ZAP-70 Ab-1, Mouse Monoclonal Antibody<br />

anti–XRCC1<br />

Ab–3, WB<br />

Conc. Cat. No.<br />

200ug/mL MS-1393-P0<br />

200µg/mL MS-1393-P1<br />

200µg/mL MS-1393-P<br />

1mg/mL MS-1393-P1ABX<br />

1mg/mL MS-1393-PABX<br />

n/a MS-1393-R7<br />

n/a MS-1393-PCS<br />

250µg/100µL MS-1393-PCL<br />

Host Species: Mouse<br />

Clone: 2F3.2<br />

Isotype: IgG2a<br />

Species Reactivity: Human. Others not<br />

known.<br />

Epitope: Not determined<br />

Immunogen: GST-fusion to tandem SH2<br />

domains of human ZAP-70 corresponding<br />

to residues 1-254<br />

Molecular Weight: 70kDa<br />

Positive Control: Tonsil, Jurkat cells, T-<br />

and NK-cells<br />

Cellular Localization: Cytoplasmic (with FFPE human tonsil stained with Zap–70<br />

Ab–1.<br />

occasional staining of macrophage<br />

lysozymes)<br />

Applications:<br />

• <strong>Immunohistochemistry</strong> (Formalin/paraffin)<br />

• Western Blotting<br />

IVD†<br />

anti–ZAP–70<br />

Ab–1, WB<br />

Format<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Purified Ab with BSA and Azide<br />

Ready-to-use for IHC (UVLP)<br />

Positive Control for IHC<br />

Positive Control Lysate<br />

†USA: IVD; Int'l: IVD<br />

Quantity<br />

100µL<br />

500µL<br />

1mL<br />

7mL<br />

5 Slides<br />

100µL<br />

Conc. Cat. No.<br />

200µg/mL MS-1911-P0<br />

200µg/mL MS-1911-P1<br />

200µg/mL MS-1911-P<br />

n/a MS-1911-R7<br />

n/a MS-1911-PCS<br />

250µg/100µL MS-1911-PCL<br />

250<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Clone<br />

1-13M1<br />

1-2<br />

1.1<br />

1.3.3.22<br />

1.4C3<br />

100/D5<br />

102D1<br />

1032<br />

10A1<br />

10D6<br />

10F11<br />

11-5B<br />

111<br />

111.6<br />

111.6+199.12+ F4+11E8<br />

1143/B7<br />

116-NS-19-9<br />

11C1.3<br />

121SLE<br />

122<br />

123C3.D5<br />

12F5<br />

13-11<br />

130P215; same as DCS-215<br />

137B4<br />

138H11<br />

13A3<br />

13H4<br />

1415-1<br />

141C01; same as 1009<br />

1433S01<br />

144<br />

14P02; same as DCS-240<br />

15.2<br />

156-3C11<br />

162<br />

17-69<br />

17.A<br />

17C2<br />

18-2<br />

18-2 + 25-4 + 42-psc<br />

1808<br />

185-1G2<br />

18P118; same as DCS-118<br />

18S<br />

199.12<br />

19C3<br />

1A10<br />

1A4; also known as asm-1<br />

1A6<br />

1B12<br />

1D5<br />

1D5 + 6F11<br />

1DP06; same as TFD10<br />

1F8; same as Rb1<br />

1G11<br />

1H8<br />

1S<br />

1SH01; same as 11D7C8H5<br />

2-4A5-4<br />

202-36<br />

219<br />

225<br />

Product Description<br />

Mucin 5AC (MUC5AC)/Gastric Mucin Ab-2<br />

IGF-1R (β-Subunit) Ab-5<br />

Dog1<br />

CD81/TAPA-1 Ab-1<br />

CD106/VCAM-1 Ab-3<br />

Bcl-2α Ab-1<br />

TIMP-1 Ab-2<br />

LRP/MVP (Major Vault Protein) Ab-2<br />

Protein Gene Product 9.5 (PGP9.5) Ab-1<br />

CD163 Ab-1<br />

CD71/Transferrin Receptor Ab-3<br />

CNPase Ab-1 (Oligodendrocyte & Schwann Cell Marker)<br />

Ku (p80) Ab-2<br />

Epidermal Growth Factor Receptor/EGFR Ab-10<br />

Epidermal Growth Factor Receptor/EGFR Ab-12 (Cocktail R19/48)<br />

Mucin 3 (MUC3) Ab-2<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-3<br />

Fibrillin-1 Ab-1<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-1<br />

TR2/HVEM Ab-1<br />

CD56/NCAM-1 Ab-2<br />

XPA Ab-1<br />

Troponin T, Cardiac Isoform Ab-1<br />

p130/Rb2 Ab-2<br />

CD27 Ab-2<br />

Glutamyl Transferase, γ Ab-1<br />

Cyclin E Ab-5<br />

p504s/AMACR<br />

Histone H1 Ab-1<br />

CD141/Thrombomodulin Ab-1<br />

14.3.3σ Ab-1<br />

XRCC1 (X-Ray Repair Cross Complementing Protein1)<br />

p14 ARF /p16β Ab-2<br />

CD54/ICAM-1 Ab-1<br />

CD44 Std./HCAM Ab-4<br />

Ku (p70/p80) Ab-3<br />

IGF-1R (α-Subunit) Ab-2<br />

PTEN/MMAC1 Ab-4<br />

Catenin, β Ab-3<br />

DNA-PKcs Ab-1<br />

DNA-PKcs Ab-4 (Cocktail)<br />

Dystrophin Ab-1<br />

CD36/GPIIIb/GPIV Ab-3<br />

p18 INK4c Ab-3<br />

DNA Polymerase, β Ab-1<br />

Epidermal Growth Factor Receptor/EGFR Ab-11<br />

Cathepsin G Ab-1<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-6<br />

Actin, Smooth Muscle Ab-1<br />

Progesterone Receptor Ab-9<br />

CD23 Ab-1<br />

Estrogen Receptor Ab-11<br />

Estrogen Receptor Ab-14<br />

DP-1 Transcription Factor Ab-6<br />

Retinoblastoma (Rb) Ab-1<br />

Ets-1 Ab-1<br />

Excitatory Amino Acid Transporter 2 Ab-1<br />

Fyn (p59 fyn ) Ab-1<br />

SHP-1 Ab-1<br />

CD115/c-fms/CSF-1R/M-CSFR Ab-1<br />

CD26/DPP IV/ADA-Binding Protein Ab-1<br />

XPF Ab-1<br />

Epidermal Growth Factor Receptor/EGFR Ab-2<br />

Cat. No.<br />

MS-551<br />

MS-645<br />

MS-1933<br />

MS-502<br />

MS-1101<br />

MS-123<br />

MS-608<br />

MS-664<br />

MS-1760<br />

MS-1103<br />

MS-1096<br />

MS-349<br />

MS-285<br />

MS-378<br />

MS-400<br />

MS-1734<br />

MS-1811<br />

MS-231<br />

MS-379<br />

MS-710<br />

MS-204<br />

MS-650<br />

MS-295<br />

MS-866<br />

MS-1468<br />

MS-1272<br />

MS-1060<br />

RM-9130<br />

MS-628<br />

MS-1102<br />

MS-1185<br />

MS-1393<br />

MS-850<br />

MS-114<br />

MS-668<br />

MS-286<br />

MS-642<br />

MS-1601<br />

MS-1763<br />

MS-369<br />

MS-423<br />

MS-486<br />

MS-756<br />

MS-858<br />

MS-669<br />

MS-396<br />

MS-1835<br />

MS-1873<br />

MS-113<br />

MS-390<br />

MS-729<br />

MS-354<br />

MS-750<br />

MS-1056<br />

MS-107<br />

MS-1762<br />

MS-1750<br />

MS-339<br />

MS-1190<br />

RT-601<br />

MS-524<br />

MS-1381<br />

MS-269<br />

Page<br />

195<br />

167<br />

125<br />

89<br />

90<br />

59<br />

237<br />

177<br />

222<br />

93<br />

87<br />

104<br />

173<br />

130<br />

130<br />

194<br />

62<br />

140<br />

62<br />

239<br />

85<br />

249<br />

242<br />

209<br />

79<br />

147<br />

113<br />

211<br />

164<br />

92<br />

50<br />

250<br />

202<br />

84<br />

83<br />

173<br />

166<br />

222<br />

69<br />

123<br />

124<br />

126<br />

81<br />

203<br />

124<br />

130<br />

70<br />

80<br />

52<br />

219<br />

77<br />

135<br />

135<br />

126<br />

224<br />

136<br />

137<br />

142<br />

228<br />

90<br />

78<br />

249<br />

128<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

251


Clone<br />

23A3<br />

23G12<br />

24-31<br />

24-57<br />

24-60<br />

246-B8.E7<br />

246-E8.E7; same as HLA-ABC-m2<br />

25-4<br />

25C14; same as TC-14<br />

25D12<br />

265/F4<br />

266<br />

26E5<br />

2A4<br />

2B1.5<br />

2B5<br />

2B6<br />

2B6 + 8D4<br />

2C3<br />

2CHK01; same as DCS-293<br />

2D2<br />

2F11<br />

2F12<br />

2f2<br />

2F3.2<br />

2G9<br />

2GB04; same as C1.4<br />

2H10 or 70C or alphaSSB70C<br />

2H12<br />

2H7<br />

304-1A5<br />

323/A3<br />

33-2-5<br />

34BetaE12<br />

373E1<br />

38/87<br />

38C03; same as SPC32<br />

38C12<br />

3A4<br />

3A5<br />

3B5<br />

3C12<br />

3CSP01; same as 7.1.44<br />

3CSP03; same as 4.1.18<br />

3D1.1<br />

3E2F04; same as PF37<br />

3F6<br />

3F8<br />

3G5<br />

3H11<br />

42-psc; same as 42-26 or 42-27<br />

42C01<br />

45M1<br />

47-9<br />

47DC141; same as DCS-141<br />

4B12<br />

4B4<br />

4B4 + 10H4 + 10H8<br />

4B7R<br />

4C12.1<br />

4C4.9<br />

4C7<br />

4C9<br />

4D10.1<br />

Product Description<br />

GCDFP-15 (Gross Cystic Disease Fluid Protein-15) Ab-1<br />

CD54/ICAM-1 Ab-4<br />

IGF-1R (α-Subunit) Ab-1<br />

IGF-1R (α-Subunit) Ab-3<br />

IGF-1R (α-Subunit) Ab-4<br />

MHC I (HLA-A, B, C) Ab-1<br />

Microglobulin β-2 Ab-1<br />

DNA-PKcs Ab-2<br />

CDC25C Ab-1<br />

MSH2 (Mismatch Repair Protein 2) Ab-1<br />

p170/p-Glycoprotein/MDR (Anti-Hamster) Ab-1<br />

Exo1 Ab-4<br />

Tartrate Resistant Acid Phosphatase (TRAP) Ab-1<br />

SREBP-1 (Sterol Regulatory Element Binding Protein-1) Ab-1<br />

Collagen II Ab-2<br />

HER-3/c-erbB-3 Ab-6<br />

Cdk2 Ab-1<br />

Cdk2 Ab-4<br />

HER-3/c-erbB-3 Ab-7<br />

Chk2 Ab-1<br />

Bax Ab-1<br />

Neurofilament (200kDa & 68kDa) Ab-1<br />

HER-3/c-erbB-3 Ab-2<br />

CD61 (GPIIIa) Ab-1<br />

ZAP-70 Ab-1<br />

CD21 Ab-2<br />

Grb2/sem5/ASH Signaling Protein Ab-4<br />

RPA/p70 (Replication Protein A) Ab-2<br />

Bcl-X Ab-1<br />

CD16/Fcγ Receptor III Ab-2<br />

Mammaglobin<br />

Epithelial Specific Antigen/Ep-CAM Ab-3<br />

XRCC1 (X-Ray Repair Cross Complementing Protein1) Ab-1<br />

Cytokeratin, High Molecular Weight Ab-3<br />

Thyroid Cancer Marker<br />

Moesin Ab-1<br />

CD38 Ab-3<br />

CD13/Aminopeptidase-N Ab-3<br />

TIMP-2 Ab-5<br />

LCK (p56 lck ) Ab-1<br />

HER-2/c-erbB-2/neu5 Ab-15<br />

Ezrin/p81/80K/Cytovillin Ab-1<br />

Caspase 3 (CPP32) Ab-1<br />

Caspase 3 (CPP32) Ab-3<br />

Parathyroid Hormone Receptor (PTH-Receptor) Type 1<br />

E2F-3 Transcription Factor Ab-4<br />

Pneumocystis jiroveci (P. Carinii) Ab-1<br />

Ret Oncoprotein Ab-1<br />

MAP1B/MAP5 (Microtubule-Associated Protein) Ab-1<br />

ERCC1 Ab-1<br />

DNA-PKcs Ab-3<br />

CD42b (GPIb) Ab-1<br />

Mucin 5AC (MUC5AC)/Gastric Mucin Ab-1<br />

Insulin Receptor (α-Subunit) Ab-3<br />

CDC47/MCM7 Ab-2<br />

CD4 Ab-8<br />

Heat Shock Factor 1 (HSF1) Ab-1<br />

Heat Shock Factor 1 (HSF1) Ab-4<br />

CD29 (Integrin β-1) Ab-1<br />

Hepatocyte Growth Factor Ab-1<br />

S100 Protein Ab-1<br />

CD5 Ab-1<br />

CD25/IL-2Rα Ab-4<br />

Syk Signaling Protein Ab-1<br />

Cat. No.<br />

MS-1170<br />

MS-1094<br />

MS-641<br />

MS-643<br />

MS-644<br />

MS-557<br />

MS-440<br />

MS-370<br />

MS-751<br />

MS-1498<br />

MS-190<br />

MS-1534<br />

MS-1768<br />

MS-1207<br />

MS-235<br />

MS-310<br />

MS-459<br />

MS-617<br />

MS-313<br />

MS-1330<br />

MS-711<br />

MS-359<br />

MS-201<br />

MS-1095<br />

MS-1911<br />

MS-1086<br />

MS-1457<br />

MS-692<br />

MS-715<br />

MS-1085<br />

MS-1919<br />

MS-181<br />

MS-434<br />

MS-1447<br />

MS-1914<br />

MS-727<br />

MS-983<br />

MS-1079<br />

MS-1485<br />

MS-164<br />

MS-599<br />

MS-661<br />

MS-1121<br />

MS-1123<br />

MS-1270<br />

MS-1063<br />

MS-1427<br />

MS-1120<br />

MS-248<br />

MS-647<br />

MS-371<br />

MS-1174<br />

MS-145<br />

MS-633<br />

MS-862<br />

MS-1528<br />

RT-405<br />

RT-629<br />

MS-596<br />

MS-651<br />

MS-296<br />

MS-393<br />

MS-1088<br />

MS-322<br />

Page<br />

144<br />

85<br />

166<br />

166<br />

167<br />

184<br />

185<br />

124<br />

94<br />

193<br />

210<br />

137<br />

233<br />

229<br />

105<br />

160<br />

96<br />

96<br />

160<br />

100<br />

59<br />

199<br />

159<br />

86<br />

250<br />

77<br />

148<br />

226<br />

60<br />

76<br />

179<br />

132<br />

250<br />

120<br />

237<br />

192<br />

82<br />

75<br />

238<br />

176<br />

157<br />

137<br />

67<br />

67<br />

211<br />

127<br />

216<br />

224<br />

180<br />

133<br />

124<br />

82<br />

194<br />

170<br />

94<br />

73<br />

151<br />

151<br />

79<br />

155<br />

227<br />

73<br />

78<br />

231<br />

252<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Clone<br />

4D11<br />

4D2<br />

4E2F04; same as WUF10<br />

4E3<br />

4G5<br />

4P01; same as 1E11<br />

5.2F<br />

5.8A<br />

51<br />

51B7<br />

51RAD01; same as 3C10<br />

528<br />

528 + 199.12<br />

56C04; same as 123A8<br />

56C6<br />

57P06; same as KP10<br />

5A4<br />

5A5<br />

5B10<br />

5B2<br />

5B2.5<br />

5C3.F8<br />

5C5.F8.C7; or alpha-Sr-1<br />

5D3<br />

5F12<br />

5H11<br />

5HT-H209<br />

61<br />

67P05<br />

6A7<br />

6ARF01<br />

6B3<br />

6C1<br />

6CSP03; same as 14.1.190<br />

6E6<br />

6F-H2<br />

6F11<br />

7<br />

7-18<br />

72F6<br />

7D5<br />

7D9<br />

7F10<br />

7H8.2C12<br />

83-14<br />

83-7<br />

84-3C1<br />

8A9<br />

8B6.18<br />

8C8<br />

8CSP03; same as 4.1.20<br />

8E2<br />

8E9<br />

8F1<br />

8G7G3/1<br />

93H3A<br />

996/1<br />

9A7gamma.E10.E4<br />

9C4<br />

9E10.3<br />

9E11; same as A3B2<br />

9G10.F8.2<br />

9G6.10<br />

A-Gel VC2<br />

Product Description<br />

6-Histidine (Epitope Tag) Ab-1<br />

Adenovirus Fiber (Monomer and Trimer) Ab-4<br />

E2F-4 Transcription Factor Ab-4<br />

c-myb/v-myb Ab-1<br />

Emerin Ab-1<br />

Progesterone Ab-1<br />

MyoD1 Ab-2<br />

MyoD1 Ab-1<br />

XPF Ab-5<br />

Retinoblastoma (Rb) (Phospho-specific Serine) Ab-7<br />

RAD51 Ab-1<br />

Epidermal Growth Factor Receptor /EGFR Ab-1<br />

Epidermal Growth Factor Receptor/EGFR Ab-13<br />

CD56/NCAM-1 Ab-4<br />

CD10/CALLA (Neutral Endopeptidase) Ab-2<br />

p57 Kip2 Ab-6<br />

ALK (Anaplastic Lymphoma Kinase)/p80 Ab-1<br />

Calretinin Ab-1<br />

Perforin Ab-2<br />

Mesothelin Ab-1<br />

Collagen II Ab-1<br />

Vascular Endothelial Growth Factor (VEGF) Ab-2<br />

Actin, Skeletal Muscle Ab-2<br />

Cytokeratin 8/18 Ab-1<br />

CD44 Std./H-CAM Ab-2<br />

Paxillin Ab-1<br />

Serotonin Ab-1<br />

DNA Polymerase, β Ab-2<br />

c-myc Ab-5<br />

Bax Ab-4<br />

ADP-ribosylation Factor (ARF) 6 Ab-1<br />

Collagen II Ab-3<br />

MAGE-1 Ab-6<br />

Caspase 6 (Mch 2) Ab-3<br />

Cyclin A Ab-6<br />

Wilm's Tumor Protein (WT1) Ab-5<br />

Estrogen Receptor Ab-12<br />

CD14 Ab-2<br />

uPA (Urokinase-type Plasminogen Activator) Ab-2<br />

CD9/Motility-Related Protein-1 Ab-1<br />

Heregulin/NDF/GGF/Neuregulin Ab-1<br />

Bcl-XL Ab-2<br />

CD29 (Integrin β-1) Ab-3<br />

Cytochrome c Ab-2<br />

Insulin Receptor (α-Subunit) Ab-1<br />

Insulin Receptor (α-Subunit) Ab-2<br />

CD43/T-Cell Marker Ab-3<br />

Placental Alk. Phosphatase (PLAP) Ab-4<br />

Placental Alk. Phosphatase (PLAP) Ab-1<br />

Bcl-2α Ab-3<br />

Caspase 8 (FLICE) Ab-3<br />

Survivin Ab-1<br />

c-Abl Ab-1<br />

ERCC1 Ab-2<br />

TTF-1 (Thyroid Transcription Factor-1) Ab-1<br />

DNA Polymerase, ε Ab-1<br />

Mucin 2 (MUC2) Ab-3<br />

Vitamin D Receptor (VDR) Ab-1<br />

Galectin-3 Ab-1<br />

c-myc Ab-2<br />

c-myc Ab-1<br />

Glucose-Regulated Protein 94 (Grp94)/gp96 Ab-1<br />

HER-2/c-erbB-2/neu Ab-2<br />

MMP-2 (72kDa Collagenase IV) Ab-4<br />

Cat. No.<br />

MS-667<br />

MS-1027<br />

MS-1057<br />

MS-1728<br />

MS-1751<br />

MS-1040<br />

MS-278<br />

MS-273<br />

MS-1385<br />

MS-1883<br />

MS-988<br />

MS-268<br />

MS-609<br />

MS-1149<br />

MS-728<br />

MS-1062<br />

MS-1104<br />

MS-1110<br />

MS-1834<br />

MS-1320<br />

MS-234<br />

MS-290<br />

MS-185<br />

MS-743<br />

MS-178<br />

MS-404<br />

MS-1431<br />

MS-1402<br />

MS-1054<br />

MS-714<br />

MS-1269<br />

MS-306<br />

MS-1836<br />

MS-1126<br />

MS-1061<br />

MS-1837<br />

MS-391<br />

MS-1080<br />

MS-835<br />

MS-1077<br />

MS-272<br />

MS-1334<br />

MS-1089<br />

MS-1192<br />

MS-631<br />

MS-632<br />

MS-679<br />

MS-734<br />

MS-208<br />

MS-597<br />

MS-1143<br />

MS-1201<br />

MS-938<br />

MS-671<br />

MS-699<br />

MS-576<br />

MS-1729<br />

RT-200<br />

MS-1756<br />

MS-139<br />

MS-127<br />

RT-102<br />

MS-229<br />

MS-806<br />

Page<br />

50<br />

52<br />

127<br />

103<br />

128<br />

217<br />

196<br />

196<br />

249<br />

225<br />

223<br />

128<br />

131<br />

85<br />

75<br />

208<br />

54<br />

66<br />

214<br />

184<br />

105<br />

246<br />

52<br />

116<br />

83<br />

212<br />

228<br />

125<br />

104<br />

59<br />

53<br />

105<br />

178<br />

68<br />

108<br />

249<br />

135<br />

75<br />

245<br />

74<br />

162<br />

60<br />

79<br />

114<br />

169<br />

169<br />

82<br />

215<br />

215<br />

60<br />

68<br />

230<br />

63<br />

134<br />

243<br />

125<br />

194<br />

248<br />

143<br />

104<br />

104<br />

146<br />

156<br />

188<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

253


Clone<br />

A103<br />

A17.1.1<br />

A4.1<br />

A5<br />

A53-B/A2.26; same as Ks19.1<br />

A6<br />

A6.1<br />

A78-G/A7<br />

A7L6<br />

AA1<br />

AB75<br />

AC-1A1<br />

ACTN05; same as C4<br />

AE1<br />

AE1/AE3<br />

AE3<br />

AER314<br />

AH26<br />

ALK-SP8<br />

AP18<br />

AP20<br />

AR 441<br />

ASTRO6<br />

AUA1<br />

B6.2<br />

B6H12.2<br />

B72.3<br />

BA17<br />

BAM01; same as 6F/3D<br />

BBK-2<br />

Ber-EP4<br />

Ber-H2<br />

BGAL01<br />

BL6.02; same as PG-B6p<br />

BM-2<br />

Bra55<br />

BRD.3<br />

BTN.4<br />

Bu20a<br />

C-11<br />

C3<br />

C5<br />

C6.7<br />

C8/144B<br />

CA-4001 or CA719E3C<br />

CALP<br />

CAS-14; same as 35B-1A4<br />

CC1<br />

CD3 – SP7; CD20 – L26<br />

CD4 – 4B12, CD8 – SP16<br />

CG04 + CG05<br />

CG15<br />

CG31<br />

CH1<br />

CIV 22<br />

CLH5<br />

CMV01<br />

COL-1<br />

COMPO2; same as SC-05<br />

CON.1<br />

CON6D/ C2<br />

CP74<br />

CRCT2.1<br />

CS1+CS2+CS3+CS4<br />

Product Description<br />

MART-1/Melan-A (Melanoma Marker) Ab-4<br />

Cdk1/p34 cdc2 Ab-1<br />

Thrombospondin (TSP) Ab-1<br />

Laminin B2/γ1 Ab-1<br />

Cytokeratin 19 Ab-1<br />

Notch-1 Ab-1<br />

Thrombospondin (TSP) Ab-4<br />

Thomsen-Friedenreich Antigen Ab-1<br />

Heparan Sulfate Proteoglycan/Perlecan Ab-1<br />

Mast Cell Tryptase Ab-2<br />

CD2 (LFA-2) Ab-2<br />

Factor XIII A Ab-1<br />

Actin, pan Ab-5<br />

Cytokeratin, Low Molecular Weight Ab-1<br />

Cytokeratin, Pan Ab-1<br />

Cytokeratin, High Molecular Weight Ab-1<br />

Estrogen Receptor Ab-1<br />

Adrenocorticotrophic Hormone (ACTH) Ab-1<br />

Alk/CD30, MultiVision Antibody Cocktail<br />

MAP 2a,b,c (Microtubule-Associated Protein) Ab-3<br />

MAP 2a,b (Microtubule-Associated Protein) Ab-2<br />

Androgen Receptor Ab-1<br />

GFAP (Glial Fibrillary Acidic Protein)<br />

Epithelial Specific Antigen/Ep-CAM Ab-2<br />

Prolactin Receptor Ab-1<br />

CD47 Ab-2<br />

TAG-72/CA 72-4 Ab-1<br />

Cytokeratin 19 Ab-4<br />

Amyloid A4/Amyloid β Ab-1<br />

CD137 (4-1BB) Ab-1<br />

Epithelial Specific Antigen/Ep-CAM Ab-9<br />

CD30 (Reed-Sternberg Cell Marker) Ab-1<br />

β-Galactosidase Ab-1<br />

Bcl-6 Ab-2<br />

Granulocyte (Myeloid cell Marker) Ab-1<br />

CD45/T200/LCA Ab-1<br />

Bromodeoxyuridine (BrdU) Ab-3<br />

Biotin Ab-2<br />

Bromodeoxyuridine (BrdU) Ab-4<br />

Cytokeratin, Multi Ab-1<br />

α-Fetoprotein (AFP) Ab-1<br />

Microphthalmia (Transcription Factor) (MiTF) Ab-1<br />

Thrombospondin (TSP) Ab-3<br />

CD8 Ab-1<br />

MMP-2 (72kDa Collagenase IV) Ab-1<br />

Calponin Ab-1<br />

p130 Cas Ab-1<br />

Mast Cell Chymase Ab-1<br />

CD3/CD20<br />

CD4/CD8<br />

Chorionic Gonadotropin, Human/hCG Ab-5<br />

14.3.3 pan Ab-4<br />

14.3.3γ Ab-2<br />

Tropomyosin Ab-1<br />

Collagen IV Ab-2<br />

Mucin 6 (MUC-6) Ab-1<br />

Cytomegalovirus Ab-1<br />

CEA (Carcinoembryonic Antigen)/CD66e Ab-3<br />

Secretory Component Ab-2<br />

Clathrin, Light Chain Ab-1<br />

CD30 (Reed-Sternberg Cell Marker)<br />

p21 WAF1 Ab-11<br />

MCM2 Ab-1<br />

Epstein-Barr Virus/LMP Ab-1<br />

Cat. No.<br />

MS-799<br />

MS-110<br />

MS-418<br />

RT-795<br />

MS-198<br />

MS-1339<br />

MS-421<br />

MS-455<br />

RT-794<br />

MS-1216<br />

MS-1074<br />

MS-1237<br />

MS-1295<br />

MS-341<br />

MS-343<br />

MS-342<br />

MS-168<br />

MS-452<br />

MV-2008<br />

MS-250<br />

MS-249<br />

MS-443<br />

MS-1376<br />

MS-675<br />

MS-1338<br />

MS-1302<br />

MS-138<br />

MS-1671<br />

MS-1167<br />

MS-621<br />

MS-1898<br />

MS-361<br />

MS-1329<br />

MS-1114<br />

MS-189<br />

MS-240<br />

MS-1058<br />

MS-1048<br />

MS-1848<br />

MS-149<br />

MS-226<br />

MS-771<br />

MS-420<br />

MS-457<br />

MS-567<br />

MS-1168<br />

MS-855<br />

MS-1217<br />

MV-2002<br />

MV-2001<br />

MS-1065<br />

MS-1504<br />

MS-1502<br />

MS-1256<br />

MS-448<br />

MS-1153<br />

MS-717<br />

MS-613<br />

MS-1367<br />

MS-1291<br />

MS-1915<br />

MS-891<br />

MS-1726<br />

MS-1458<br />

Page<br />

181<br />

95<br />

235<br />

175<br />

119<br />

201<br />

235<br />

234<br />

154<br />

182<br />

71<br />

138<br />

51<br />

121<br />

121<br />

120<br />

134<br />

54<br />

55<br />

179<br />

179<br />

57<br />

145<br />

132<br />

220<br />

84<br />

233<br />

119<br />

57<br />

91<br />

133<br />

80<br />

143<br />

60<br />

148<br />

83<br />

61<br />

61<br />

61<br />

121<br />

139<br />

186<br />

235<br />

74<br />

187<br />

65<br />

209<br />

182<br />

72<br />

73<br />

100<br />

50<br />

50<br />

242<br />

106<br />

195<br />

122<br />

99<br />

227<br />

102<br />

79<br />

204<br />

182<br />

133<br />

254<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Clone<br />

CT-1<br />

CT-3<br />

CTC03; same as 2B5<br />

CUB 7402<br />

CUB 7402 + TG100<br />

CWWB1<br />

D171<br />

D18<br />

D33<br />

D4.6<br />

D4.6 + A6.1 + MBC 200.1<br />

D5<br />

D5/16 B4<br />

DAK Calret 1<br />

DC10<br />

DC17 + DC34<br />

DC34<br />

DCS-11<br />

DCS-120<br />

DCS-180<br />

DCS-22<br />

DCS-28.1<br />

DCS-280<br />

DCS-3.1<br />

DCS-3.1 + DCS-5.2<br />

DCS-31<br />

DCS-31 + DCS-35<br />

DCS-341<br />

DCS-35<br />

DCS-6<br />

DCS-60.2<br />

DCS-72.F6<br />

DE-K10<br />

DE-SQ<br />

DF-T1<br />

DH01; same as DCS-266<br />

DM1A<br />

DO-1<br />

DO-7<br />

DO-7 + BP53-12<br />

E11<br />

e2-4001<br />

e2-4001 + 3B5<br />

E247<br />

E29<br />

E3<br />

E431-1<br />

EAW24<br />

EDM45<br />

EGFR.1<br />

EP1045Y<br />

EP1588Y<br />

EP1601Y<br />

EP1628Y<br />

EP38Y<br />

EP449E<br />

EP700Y<br />

EP798Y<br />

EPR2241IHC<br />

EPR2764Y<br />

ER-15<br />

EST.1<br />

F12B<br />

F4<br />

Product Description<br />

Insulin Receptor (β-Subunit) Ab-5<br />

Insulin Receptor (β-Subunit) Ab-6<br />

Cytochrome c Ab-3<br />

Transglutaminase II Ab-1<br />

Transglutaminase II Ab-3<br />

Villin Ab-1<br />

CD155/PVR (Poliovirus Receptor) Ab-1<br />

Laminin B2/γ1 Ab-2<br />

Desmin (Muscle Cell Marker) Ab-1<br />

Thrombospondin-1 (TSP-1) Ab-2<br />

Thrombospondin (TSP) Ab-11<br />

Microphthalmia (Transcription Factor) (MiTF) Ab-2<br />

Cytokeratin 5/6 Ab-2<br />

Calretinin Ab-2<br />

Cytokeratin 18 Ab-1<br />

Cdk5 Ab-4<br />

Cdk5 Ab-3<br />

Cyclin D1/Bcl-1 Ab-2<br />

CDC25A Ab-1<br />

CDC6 Ab-1<br />

Cyclin D3 Ab-1<br />

Cyclin D3 Ab-2<br />

Pds1 Ab-1<br />

Cyclin D2 Ab-2<br />

Cyclin D2 Ab-4<br />

Cdk4 Ab-2<br />

Cdk4 Ab-6<br />

CDC7 Kinase Ab-1<br />

Cdk4 Ab-1<br />

Cyclin D1/Bcl-1 Ab-1<br />

p21 WAF1 Ab-3<br />

p27 Kip1 Ab-1<br />

Cytokeratin 10 Ab-2<br />

Cytokeratin, High Molecular Weight Ab-2<br />

CD43/T-Cell Marker Ab-1<br />

Cdh1 Ab-1<br />

Tubulin, α Ab-2<br />

p53 Ab-6<br />

p53 Ab-5<br />

p53 Ab-8<br />

CD35/CR1 (Follicular Dendritic Cell Marker)<br />

HER-2/c-erbB-2/neu Ab-8<br />

HER-2/c-erbB-2/neu Ab-17<br />

Catenin, β<br />

Epithelial Membrane Antigen/EMA Ab-3<br />

Cytokeratin 17 Ab-1<br />

Cytokeratin 18<br />

Maspin Ab-1<br />

Milk Fat Globule 1, Human (HMFG1) Ab-1<br />

Epidermal Growth Factor Receptor/EGFR Ab-3<br />

HER-2/c-erbB-2/neu<br />

Prostate Specific Antigen (PSA)<br />

Cytokeratin 5<br />

Cytokeratin 8<br />

anti-EGFR<br />

CD3ε<br />

E-Cadherin<br />

Calponin<br />

Cyclin D1<br />

anti-CDX2<br />

p73α/β Ab-2<br />

Estrogen Sulfotransferase (Anti-Rat) Ab-1<br />

Myogenin Ab-2<br />

p170/p-Glycoprotein/MDR Ab-2<br />

Cat. No.<br />

MS-635<br />

MS-636<br />

MS-1273<br />

MS-224<br />

MS-300<br />

MS-1499<br />

MS-465<br />

MS-1356<br />

MS-376<br />

MS-419<br />

MS-1066<br />

MS-772<br />

MS-1814<br />

MS-1859<br />

MS-142<br />

MS-1059<br />

MS-906<br />

MS-211<br />

MS-638<br />

MS-867<br />

MS-215<br />

MS-216<br />

MS-1511<br />

MS-213<br />

MS-221<br />

MS-469<br />

MS-616<br />

MS-1888<br />

MS-299<br />

MS-210<br />

MS-230<br />

MS-256<br />

MS-611<br />

MS-346<br />

MS-146<br />

MS-1116<br />

MS-581<br />

MS-187<br />

MS-186<br />

MS-738<br />

MS-336<br />

MS-325<br />

MS-730<br />

RM-2101<br />

MS-741<br />

MS-489<br />

RM-2108<br />

MS-1767<br />

MS-512<br />

MS-311<br />

RM-2112<br />

RM-2104<br />

RM-2106<br />

RM-2107<br />

RM-2111<br />

RM-2109<br />

RM-2100<br />

RM-2102<br />

RM-2113<br />

RM-2116<br />

MS-762<br />

MS-233<br />

MS-1182<br />

MS-660<br />

Page<br />

170<br />

170<br />

114<br />

240<br />

241<br />

247<br />

92<br />

176<br />

123<br />

236<br />

235<br />

186<br />

115<br />

67<br />

118<br />

97<br />

97<br />

110<br />

93<br />

93<br />

112<br />

112<br />

214<br />

111<br />

111<br />

96<br />

97<br />

93<br />

96<br />

110<br />

203<br />

205<br />

116<br />

120<br />

82<br />

95<br />

243<br />

207<br />

206<br />

207<br />

81<br />

157<br />

158<br />

69<br />

131<br />

118<br />

118<br />

181<br />

186<br />

129<br />

159<br />

221<br />

114<br />

115<br />

128<br />

72<br />

63<br />

66<br />

111<br />

98<br />

208<br />

136<br />

196<br />

210<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

255


Clone<br />

Product Description<br />

F5D<br />

Myogenin Ab-1<br />

F7.2.38<br />

CD3ε (Early T-Cell Marker) Ab-9<br />

F8/86<br />

Factor VIII Related Antigen/von Willebrand Factor Ab-2<br />

FBN11<br />

Fibronectin Ab-11<br />

FCN01; same as 55K-2<br />

Fascin Ab-1<br />

FLG01<br />

Filaggrin Ab-1<br />

FLMN01; same as PM6/317<br />

Filamin Ab-1<br />

FP5A<br />

Human Sodium Iodide Symporter (hNIS) Ab-1<br />

FPC1<br />

CD22 Ab-4<br />

FSH03<br />

Follicle Stimulating Hormone (FSH) Ab-3<br />

G3.1<br />

Heat Shock Protein 27 (HSP27) Ab-1<br />

GA-5<br />

GFAP/Glial Fibrillary Acidic Protein Ab-1<br />

GA01<br />

IgA (α-Heavy Chain) Ab-1<br />

GE-213<br />

MMP-9 (92kDa Collagenase IV) Ab-1<br />

GE2; previously R47/94<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-2<br />

GFP01 (B34)<br />

GFP (Green Fluorescent Protein) Ab-1<br />

GFP02 (C163)<br />

GFP (Green Fluorescent Protein) Ab-2<br />

GH01 / #2 + GH02 / #7<br />

Growth Hormone, Human/hGH Ab-3<br />

GM30<br />

CD95/Fas Ab-3<br />

GNRH03; same as F1G4<br />

GnRH Receptor / LH-RH Receptor Ab-3<br />

GNS1<br />

Cyclin B1 Ab-3<br />

GNS11<br />

Cyclin B1 Ab-4<br />

GP1.4<br />

Epithelial Membrane Antigen/EMA Ab-2<br />

GRP01<br />

GRIP1 (Glucocorticoid Receptor Interacting Protein 1)<br />

GST01 (794)<br />

GST (Epitope Tag) Ab-1<br />

GZB01<br />

Granzyme B Ab-1<br />

h-CALD<br />

Caldesmon, HMW Ab-1<br />

H11<br />

Epidermal Growth Factor Receptor/EGFR Ab-5<br />

H1alpha67<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-4<br />

H222<br />

Estrogen Receptor Ab-21<br />

H3.105.5; same as Ab105<br />

HER-3/c-erbB-3 Ab-5<br />

H3.90.6; same as Ab90<br />

HER-3/c-erbB-3 Ab-4<br />

H4.72.8; same as Ab72<br />

HER-4/c-erbB-4 Ab-3<br />

H4.77.16 (Ab77)<br />

HER-4/c-erbB-4 Ab-1<br />

H9B4<br />

Epidermal Growth Factor Receptor/EGFR Ab-15<br />

Ham1/7B6<br />

Dysferlin Ab-1<br />

HBME-1<br />

Mesothelioma Ab-1<br />

HE12<br />

Cyclin E Ab-2<br />

HFN 7.1<br />

Fibronectin Ab-1<br />

HFR-1<br />

HER-4/c-erbB-4<br />

HHF35<br />

Actin, Muscle Specific Ab-4<br />

HJ21; same as WA-1<br />

p21 WAF1 Ab-6<br />

HM47/A9<br />

CD79a/mb-1 (B-Cell Marker) Ab-1<br />

HMB45<br />

Melanoma (gp100) Ab-1<br />

HMB45 (gp100, M2-7C10) MART-1 and M2-9E3Melanoma Marker, Pan Ab-1<br />

(MART-1)<br />

HNK-1; same as Leu-7<br />

CD57 (Natural Killer Cell Marker) Ab-2<br />

HO36-1.1<br />

CD99/MIC2 (Ewing's Sarcoma Marker) Ab-1<br />

HP6054<br />

Lambda Light Chain Ab-1<br />

hPRa 2<br />

Progesterone Receptor Ab-2<br />

hPRa 2+hPRa 3<br />

Progesterone Receptor Ab-8<br />

hPRa 6<br />

Progesterone Receptor Ab-6<br />

hPRa 7<br />

Progesterone Receptor Ab-7<br />

HRS4<br />

CD30 (Reed-Sternberg Cell Marker) Ab-4<br />

HZ52<br />

p21 WAF1 Ab-5<br />

IA5<br />

MMP-9 (92kDa Collagenase IV) Ab-4<br />

ID2<br />

MMP-7 (Matrilysin) Ab-1<br />

Ig33<br />

von Hippel-Lindau (vHL) Protein Ab-1<br />

II-14-10<br />

Prohibitin (Mitochondrial Marker) Ab-1<br />

IIA5<br />

MMP-9 (92kDa Collagenase IV) Ab-5<br />

IL2R.1<br />

CD25/IL-2Rα Ab-1<br />

INS04 + INS05<br />

Insulin Ab-6 (INS04 + INS05)<br />

INS04; same as E2-E3<br />

Insulin Ab-4<br />

INS05; same as 2D11-H5<br />

Insulin Ab-5<br />

Cat. No.<br />

MS-1113<br />

MS-1880<br />

MS-722<br />

MS-1351<br />

MS-1112<br />

MS-449<br />

MS-1211<br />

MS-1653<br />

MS-1087<br />

MS-1449<br />

MS-101<br />

MS-280<br />

MS-1008<br />

MS-569<br />

MS-199<br />

MS-1288<br />

MS-1315<br />

MS-1328<br />

MS-1098<br />

MS-1139<br />

MS-868<br />

MS-869<br />

MS-348<br />

MS-1140<br />

MS-707<br />

MS-1157<br />

MS-1169<br />

MS-316<br />

MS-1164<br />

RT-1641<br />

MS-303<br />

MS-262<br />

MS-304<br />

MS-270<br />

MS-665<br />

MS-1874<br />

MS-1494<br />

MS-870<br />

MS-165<br />

MS-637<br />

MS-742<br />

MS-454<br />

MS-357<br />

MS-364<br />

MS-939<br />

MS-1163<br />

MS-294<br />

MS-180<br />

MS-192<br />

MS-298<br />

MS-196<br />

MS-197<br />

MS-1857<br />

MS-387<br />

MS-816<br />

MS-813<br />

MS-690<br />

MS-261<br />

MS-817<br />

MS-203<br />

MS-1379<br />

MS-1377<br />

MS-1378<br />

Page<br />

196<br />

72<br />

138<br />

140<br />

139<br />

141<br />

141<br />

165<br />

77<br />

142<br />

151<br />

144<br />

165<br />

189<br />

222<br />

145<br />

146<br />

149<br />

89<br />

147<br />

109<br />

109<br />

131<br />

148<br />

149<br />

148<br />

65<br />

129<br />

163<br />

136<br />

160<br />

159<br />

161<br />

161<br />

131<br />

126<br />

184<br />

113<br />

140<br />

162<br />

51<br />

204<br />

88<br />

183<br />

183<br />

86<br />

89<br />

174<br />

218<br />

218<br />

218<br />

218<br />

80<br />

204<br />

190<br />

189<br />

248<br />

219<br />

190<br />

78<br />

169<br />

168<br />

169<br />

256<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Clone<br />

IPO-24<br />

IVC5<br />

JC/70A<br />

JC159<br />

JCB117<br />

JH121<br />

K1H8<br />

K45<br />

K6.83; same as DCS-83<br />

K6.90; same as DCS-90<br />

K8.8 + DC10<br />

KA2A5.6<br />

Kappa – L1C1, Lambda – N/A<br />

KH95<br />

Ki-S1<br />

KP1<br />

KP39<br />

Ks20.8<br />

l-CALD<br />

L12B4<br />

L1C1<br />

L26<br />

L26<br />

L87 + 2ERB19<br />

LAM03 + HP6054<br />

LH01<br />

LH7.2<br />

LHK15<br />

LHK6B<br />

LIPCO IID1<br />

LIV3G11<br />

LK1<br />

LK2H10<br />

LK2H10 + PHE5<br />

LL002<br />

LL025<br />

LN1<br />

LN2<br />

LN3<br />

LPL4A.1<br />

LT3<br />

Lu-5<br />

M11<br />

M2-7C10<br />

M2-7C10 + M2-9E3<br />

M23<br />

M3A7<br />

M53<br />

M58<br />

M58 + M73<br />

M73<br />

MA454<br />

MAC 387<br />

mcl<br />

MCPR3-2<br />

MF9<br />

MH1; same as CT2<br />

MI15<br />

MLuC5<br />

MMA; same as LeuM1<br />

MOC-31<br />

MP16-2<br />

MSA06; same as HUC1-1<br />

MT 3.1<br />

Product Description<br />

CD37 Ab-1<br />

MMP-10 (Stromelysin-2) Ab-2<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-1<br />

Glycophorin A Ab-4<br />

CD79a/mb-1 (B-Cell Marker) Ab-2<br />

Vascular Endothelial Growth Factor (VEGF) Ab-3<br />

Human Papilloma Virus (HPV) Ab-3<br />

CD117/c-Kit/SCF-Receptor Ab-3<br />

Cdk6 Ab-1<br />

Cdk6 Ab-2<br />

Cytokeratin 8/18 Ab-2<br />

HDJ-2/DNAJ Ab-1<br />

Kappa/Lambda<br />

E2F-1 Transcription Factor Ab-6<br />

Topoisomerase II α Ab-4<br />

CD68/Macrophage Marker Ab-3<br />

p57 Kip2<br />

Cytokeratin 20 Ab-1<br />

Caldesmon, LMW Ab-2<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-3<br />

Kappa Light Chain Ab-1<br />

CD20 Ab-1<br />

HER-2/c-erbB-2/neu Ab-16<br />

HER-2/c-erbB-2/neu Ab-20<br />

Lambda Light Chain Ab-4 (Cocktail)<br />

LH (Luteinizing Hormone) Ab-1<br />

Collagen VII Ab-1<br />

Cytokeratin 15 Ab-1<br />

Cytokeratin 6 Ab-1<br />

MMP-13 (Collagenase-3) (Anti-Rat) Ab-3<br />

Plasma Cell Ab-1<br />

Heat Shock Protein 60 (HSP60) Ab-1<br />

Chromogranin A Ab-1<br />

Chromogranin A Ab-3<br />

Cytokeratin 14 Ab-1<br />

Cytokeratin 16 Ab-1<br />

CDw75 Ab-1<br />

CD74 Ab-1<br />

MHC II (HLA-DR) Ab-1<br />

Plastin-L Ab-1<br />

Laminin B1/β1 Ab-1<br />

Cytokeratin, Pan Ab-3<br />

CA 125 Ab-2<br />

MART-1/Melan-A (Melanoma Marker) Ab-1<br />

MART-1/Melan-A (Melanoma Marker) (Cocktail) Ab-3<br />

IGF-I Ab-1<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-4<br />

Mucin 2 (MUC2) Ab-2<br />

Adenovirus Type 5 E1A Ab-1<br />

Adenovirus Type 2 and 5 Ab-5<br />

Adenovirus Type 2 E1A Ab-2<br />

MAGE-1 Ab-4<br />

Macrophage/L1 Protein/Calprotectin Ab-1<br />

Amyloid A Component Ab-1<br />

PR3 (Proteinase 3) Ab-1<br />

Transforming Growth Factor α (TGFα) Ab-1<br />

MUC-1 Ab-5<br />

CD138 Ab-2<br />

Laminin Receptor Ab-1<br />

CD15 Ab-3<br />

Epithelial Specific Antigen/Ep-CAM Ab-7<br />

Ornithine Decarboxylase (ODC) Ab-1<br />

Actin, Muscle Specific Ab-6<br />

MGMT (O-methylguanine-DNA methyltransferase) Ab-1<br />

Cat. No.<br />

MS-541<br />

MS-822<br />

MS-353<br />

MS-1843<br />

MS-1171<br />

MS-350<br />

MS-1826<br />

MS-289<br />

MS-398<br />

MS-399<br />

MS-1603<br />

MS-225<br />

MV-2003<br />

MS-879<br />

MS-1819<br />

MS-397<br />

MS-897<br />

MS-377<br />

MS-1251<br />

MS-1248<br />

MS-143<br />

MS-340<br />

MS-600<br />

MS-1350<br />

MS-1158<br />

MS-1448<br />

MS-444<br />

MS-1068<br />

MS-766<br />

MS-827<br />

MS-488<br />

MS-120<br />

MS-324<br />

MS-382<br />

MS-115<br />

MS-620<br />

MS-130<br />

MS-131<br />

MS-133<br />

MS-1326<br />

RT-796<br />

MS-744<br />

MS-1812<br />

MS-612<br />

MS-716<br />

MS-1508<br />

MS-1249<br />

MS-1037<br />

MS-587<br />

MS-1069<br />

MS-588<br />

MS-1067<br />

MS-148<br />

MS-1219<br />

MS-1333<br />

MS-670<br />

HM-1630<br />

MS-1793<br />

MS-259<br />

MS-1259<br />

MS-1825<br />

MS-464<br />

MS-1296<br />

MS-470<br />

Page<br />

81<br />

190<br />

80<br />

147<br />

88<br />

246<br />

164<br />

91<br />

97<br />

98<br />

116<br />

150<br />

172<br />

127<br />

239<br />

87<br />

208<br />

119<br />

65<br />

113<br />

171<br />

76<br />

158<br />

158<br />

174<br />

177<br />

106<br />

117<br />

115<br />

191<br />

216<br />

152<br />

101<br />

102<br />

117<br />

117<br />

98<br />

87<br />

185<br />

216<br />

175<br />

122<br />

63<br />

180<br />

181<br />

167<br />

113<br />

194<br />

53<br />

53<br />

53<br />

178<br />

178<br />

56<br />

217<br />

240<br />

193<br />

92<br />

176<br />

75<br />

132<br />

201<br />

51<br />

184<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

257


Clone<br />

MTB1<br />

MTC02<br />

MYSN02; same as MY-32<br />

N12<br />

N24<br />

N27<br />

N28<br />

N3H10<br />

NA24<br />

NCG01<br />

NCG2A.01<br />

NCG2B.01<br />

NGFR5<br />

NK1<br />

NKI/C-3; same as MX-49.129.5<br />

NM11<br />

O10<br />

O13<br />

OCH1E5<br />

OV-TL 12/30<br />

Ov185:1<br />

OZ12<br />

P-GF.44C<br />

PAb 122<br />

PAb 1801<br />

PAb 240<br />

PAb101; same as clone 412<br />

PAb108<br />

PAN-CK<br />

PASE/4LJ<br />

PC10<br />

PD7/26<br />

PD7/26/16 + 2B11<br />

PG-M1<br />

PgR636<br />

PHE5<br />

PHM-12<br />

PHM-12+CIV 22<br />

PN-15<br />

PN2A<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Product Description<br />

CD1a Ab-2<br />

Mitochondria Ab-2<br />

Myosin, Skeletal Muscle Ab-2<br />

HER-2/c-erbB-2/neu Ab-4<br />

HER-2/c-erbB-2/neu Ab-5<br />

Interferon-α (II)/IFN-α (II)<br />

HER-2/c-erbB-2/neu Ab-6<br />

Ku (p70) Ab-4<br />

Nucleophosmin (NPM) Ab-1<br />

Negative Control for Mouse IgG1 Ab-1<br />

Negative Control for Mouse IgG2a Ab-1<br />

Negative Control for Mouse IgG2b Ab-1<br />

Neurotrophin Receptor/NGF-Receptor (p75 NGFR ) Ab-1<br />

CD57 (Natural Killer Cell Marker) Ab-1<br />

CD63 Ab-1<br />

p300/CBP (CREB-Binding Protein) Ab-1<br />

CD1a Ab-5<br />

CD99/MIC2 (Ewing's Sarcoma Marker) Ab-2<br />

Hepatocyte Ab-1<br />

Cytokeratin 7 Ab-2<br />

CA 125 (Ovarian Cancer Antigen) Ab-1<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-1<br />

Thymidine Phosphorylase/PD-ECGF Ab-1<br />

p53 Ab-4<br />

p53 Ab-2<br />

p53 Ab-1<br />

SV40 Large T Antigen Ab-1<br />

SV40 Large T Antigen Ab-2<br />

Cytokeratin, Pan Ab-2<br />

Prostate Specific Acid Phosphatase (PSAP) Ab-1<br />

PCNA (Proliferating Cell Nuclear Antigen) Ab-1<br />

CD45RB Ab-3<br />

CD45/T200/LCA Ab-2<br />

CD68/Macrophage Marker Ab-4<br />

Progesterone Receptor Ab-14<br />

Chromogranin A Ab-2<br />

Collagen IV Ab-1<br />

Collagen IV Ab-3<br />

Renal Cell Carcinoma Marker (gp200) Ab-1<br />

HER-2/c-erbB-2/neu (Phospho-specific) Ab-18<br />

Actin β<br />

Actin, Smooth Muscle<br />

Albumin<br />

APC2 (Anaphase-Promoting Complex) Ab-1<br />

Bak Ab-2<br />

C1q Complement<br />

C3c Complement<br />

C4 Complement<br />

Cadherin, Pan Ab-4<br />

CD31/PECAM-1 (Endothelial Cell Marker)<br />

CD117/c-Kit/SCF-Receptor Ab-6<br />

CD117/c-Kit/SCF-Receptor<br />

Chorionic Gonadotropin, Human/hCG Ab-2<br />

Chromogranin A<br />

COX2<br />

Cyclin B1 Ab-2<br />

Cyclin D1/Bcl-1<br />

Cytokeratin 19<br />

D4-GDI<br />

Fibrinogen<br />

Glucagon Ab-1<br />

Helicobacter pylori<br />

Hepatitis B Virus Core Antigen (HBVcAg) Ab-1<br />

HER-2/c-erbB-2/neu<br />

Cat. No.<br />

MS-746<br />

MS-1372<br />

MS-1236<br />

MS-301<br />

MS-302<br />

MS-574<br />

MS-307<br />

MS-329<br />

MS-1849<br />

NC-748<br />

NC-1390<br />

NC-1391<br />

MS-394<br />

MS-136<br />

MS-1118<br />

MS-586<br />

MS-1856<br />

MS-1633<br />

MS-1810<br />

MS-1352<br />

MS-1151<br />

MS-701<br />

MS-499<br />

MS-182<br />

MS-105<br />

MS-104<br />

MS-1832<br />

MS-1833<br />

MS-356<br />

MS-321<br />

MS-106<br />

MS-1846<br />

MS-355<br />

MS-1808<br />

MS-1882<br />

MS-381<br />

MS-375<br />

MS-747<br />

MS-409<br />

MS-1072<br />

RB-9421<br />

RB-9010<br />

RB-1925<br />

RB-067<br />

RB-1520<br />

RB-1926<br />

SH-1923<br />

RB-1927<br />

RB-1524<br />

RB-10333<br />

RB-1518<br />

RB-9038<br />

RB-059<br />

RB-9003<br />

RB-9072<br />

RB-008<br />

RB-9041<br />

RB-9021<br />

RB-9042<br />

RB-1924<br />

RB-1422<br />

RB-9070<br />

RB-1413<br />

RB-9040<br />

Page<br />

70<br />

187<br />

197<br />

156<br />

156<br />

170<br />

156<br />

173<br />

201<br />

198<br />

198<br />

198<br />

199<br />

86<br />

86<br />

210<br />

70<br />

89<br />

154<br />

115<br />

62<br />

163<br />

236<br />

206<br />

206<br />

206<br />

230<br />

231<br />

121<br />

221<br />

213<br />

84<br />

83<br />

87<br />

219<br />

101<br />

105<br />

106<br />

223<br />

158<br />

51<br />

52<br />

54<br />

58<br />

58<br />

61<br />

61<br />

62<br />

64<br />

81<br />

91<br />

91<br />

100<br />

101<br />

107<br />

108<br />

111<br />

118<br />

122<br />

140<br />

146<br />

153<br />

154<br />

155<br />

258<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Clone<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

PRL02<br />

PS1<br />

pS2.1<br />

pS338[DPR/2/2A/3A]<br />

Q6<br />

R1<br />

R29<br />

R4.5<br />

Rab-50<br />

RC13<br />

RCK108<br />

Recombinant Protein<br />

Recombinant Protein<br />

Recombinant Protein<br />

RET-P1<br />

RS13<br />

SBF1<br />

SBF5<br />

SEN28<br />

SGP1<br />

SL-1 ID3<br />

SL-1 IID4<br />

SL3.05<br />

SM-M10<br />

SMD46; same as DCS-46<br />

SMMS-1<br />

SN3<br />

SN6h<br />

SP1<br />

SP11<br />

SP12<br />

SP13<br />

SP15<br />

SP16<br />

SP17<br />

SP18<br />

SP19<br />

SP2<br />

SP20<br />

Product Description<br />

HER-3/c-erbB3<br />

HER-4/c-erbB-4 Ab-2<br />

IgA (α-Heavy Chain) Ab-2<br />

IgA<br />

IgD (δ-Heavy Chain) Ab-1<br />

IgE (ε-Heavy Chain)<br />

IgG<br />

IgM<br />

Kappa Light Chain Ab-2<br />

Kappa Light Chain<br />

Lambda<br />

Lysozyme/Muramidase Ab-1<br />

MMP-13 (Collagenase-3) Ab-5<br />

MMP-14/MT1-MMP Ab-2<br />

MUC-1<br />

Myelin Basic Protein Ab-1<br />

Myeloperoxidase (MPO)<br />

Negative Control for Rabbit IgG Ab-1<br />

p14 ARF /p16Beta Ab-1<br />

Properdin<br />

S100<br />

S100 Protein Ab-2<br />

Somatostatin Ab-1<br />

TACE (TNF-α converting enzyme)/ADAM17 Ab-1<br />

TAU Ab-3<br />

Prolactin Ab-2<br />

CD3ε (Early T-Cell Marker) Ab-2<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-1<br />

Raf-1 (Phospho-specific) Ab-2<br />

Cytokeratin 20 Ab-6<br />

Inhibin, α Ab-1<br />

Maltose Binding Protein Ab-2<br />

Gαi1 G-Protein Ab-3<br />

Rabies Virus Ab-1<br />

Mcl-1 Ab-1<br />

Cytokeratin 19 Ab-5<br />

Helicobacter pylori<br />

Heregulin β1 (HRGβ1)<br />

HRGα1<br />

Rhodopsin (Opsin) Ab-1<br />

Tid-1 Ab-2<br />

Plasminogen Ab-1<br />

Hepatocyte Growth Factor Ab-2<br />

TdT/Terminal Deoxyribonucleotidyl Transferase Ab-1<br />

HER-3 /c-erbB-3 Ab-8<br />

MMP-3 (Stromelysin-1) Ab-1<br />

MMP-3 (Stromelysin-1) Ab-2<br />

MMP-11 (Stromelysin-3) Ab-5<br />

Myosin, Smooth Muscle Heavy Chain Ab-3<br />

SMAD4/DPC4 Ab-1<br />

Myosin, Smooth Muscle Heavy Chain Ab-1<br />

CD24 (GPI-Linked Surface Mucin) Ab-1<br />

CD105/Endoglin/TGF-β1/3 Receptor Ab-3<br />

Estrogen Receptor (SP1)<br />

Synaptophysin (Neuroendocrine Marker)<br />

Chromogranin A<br />

Calretinin<br />

Placental Alk Phosphatase (PLAP)<br />

CD8<br />

Calcitonin<br />

CD79a/mb-1 (B-Cell Marker)<br />

CD5<br />

Progesterone Receptor (SP2)<br />

Vimentin<br />

Cat. No.<br />

RB-9211<br />

RB-284<br />

RB-1433<br />

SH-1920<br />

RB-1436<br />

RB-1435<br />

SH-1921<br />

RB-1922<br />

RB-333<br />

RB-1929<br />

RB-1930<br />

RB-372<br />

RB-1681<br />

RB-1545<br />

RB-9222<br />

RB-1460<br />

RB-373<br />

NC-100<br />

RB-045<br />

GT-1928<br />

RB-9018<br />

RB-044<br />

RB-038<br />

RB-1660<br />

RB-1429<br />

MS-1362<br />

MS-401<br />

MS-111<br />

RT-1732<br />

MS-1854<br />

MS-1863<br />

MS-765<br />

MS-243<br />

MS-549<br />

MS-681<br />

MS-1902<br />

RP-9326<br />

RP-318<br />

RP-317<br />

MS-1233<br />

MS-1564<br />

MS-659<br />

MS-775<br />

MS-1105<br />

MS-725<br />

MS-809<br />

MS-810<br />

MS-1035<br />

MS-1348<br />

MS-865<br />

MS-1177<br />

MS-1278<br />

MS-1290<br />

RM-9101<br />

RM-9111<br />

RM-9112<br />

RM-9113<br />

RM-9115<br />

RM-9116<br />

RM-9117<br />

RM-9118<br />

RM-9119<br />

RM-9102<br />

RM-9120<br />

Page<br />

159<br />

161<br />

165<br />

165<br />

165<br />

166<br />

167<br />

168<br />

171<br />

171<br />

175<br />

177<br />

192<br />

192<br />

193<br />

195<br />

195<br />

198<br />

202<br />

220<br />

226<br />

227<br />

229<br />

233<br />

234<br />

220<br />

71<br />

222<br />

223<br />

120<br />

168<br />

178<br />

143<br />

223<br />

182<br />

119<br />

153<br />

162<br />

162<br />

225<br />

237<br />

216<br />

155<br />

234<br />

160<br />

188<br />

189<br />

191<br />

197<br />

228<br />

197<br />

78<br />

90<br />

134<br />

231<br />

101<br />

66<br />

215<br />

74<br />

64<br />

88<br />

73<br />

217<br />

247<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

259


Clone<br />

SP21<br />

SP23<br />

SP28<br />

SP29<br />

SP3<br />

SP31<br />

SP34<br />

SP4<br />

SP5<br />

SP6<br />

SP7<br />

SP8<br />

SPB01; same as 1-2-A5-9<br />

SPB02; same as 1B9<br />

SPM103<br />

SPM105<br />

SPM108<br />

SPM110<br />

SPM111<br />

SPM471<br />

SPM492<br />

SPM498<br />

SPV-L3<br />

SY5<br />

syn211<br />

SYP02<br />

T2-101<br />

T2H5<br />

T311<br />

T9; same as 3E7<br />

TA99<br />

TAU-5<br />

TBN06; same as Tub 2.5<br />

TE111.5D11<br />

TG100<br />

TGB04 (2H11) + TGB05 (6E1)<br />

TS 106<br />

TS1<br />

TSH01 + TSH02<br />

TVG701Y<br />

UCHL-1<br />

UJ127<br />

V152<br />

V9<br />

VB3<br />

VG1<br />

VIIIA2<br />

Vimentin – SP20, gp100 – HMB45<br />

VLN01<br />

VU-1D9<br />

W-CAM-1; same as Wehi-CAM-1 or 1H4<br />

W27<br />

W6/32<br />

X-AC9<br />

XM26<br />

XZ133<br />

Y12<br />

Y5<br />

YR85<br />

Product Description<br />

COX2<br />

CD23<br />

Vascular Endothelial Growth Factor (VEGF)<br />

Prostate Specific Membrane Antigen (PMSA)<br />

HER-2/c-erB-2/neu<br />

DOG1<br />

PAX-5<br />

Cyclin D1/Bcl-1<br />

p53<br />

Ki-67<br />

CD3 (Early T-Cell Marker)<br />

ALK (Anaplastic Lymphoma Kinase)/p80<br />

Surfactant Protein B (Precursor) Ab-1<br />

Surfactant Protein B (Mature) Ab-2<br />

LH (Luteinizing Hormone)<br />

Chorionic Gonadotropin, Human/hCG<br />

Prolactin<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker)<br />

CA 125<br />

Cadherin E/E-Cadherin<br />

MUC-1<br />

GLUT-1<br />

MHC II (HLA-DQ) Ab-1<br />

Involucrin Ab-1<br />

Synuclein Ab-2<br />

Synaptophysin Ab-2<br />

TIMP-2 Ab-1<br />

Tenascin Ab-1<br />

Tyrosinase Ab-1<br />

Hepatitis B Virus Surface Antigen (HBVsAg) Ab-1<br />

Tyrosinase Related Protein 75 (TRP75/gp75) Ab-1<br />

TAU Ab-2<br />

Tubulin-β Ab-6<br />

Estrogen Receptor Ab-10<br />

Transglutaminase II Ab-2<br />

Thyroglobulin Ab-6<br />

Thymidylate Synthase Ab-1<br />

Cytokeratin 8 Ab-4<br />

Thyroid Stimulating Hormone (TSH) Ab-3<br />

Human Papilloma Virus Type 16-E7 (HPV 16-E7) Ab-1<br />

CD45RO (T-Cell Marker) Ab-1<br />

L1 Cell Adhesion Molecule Ab-1<br />

Cyclin B1<br />

Vimentin Ab-2<br />

MMP-2 (72kDa Collagenase IV) Ab-2<br />

Vascular Endothelial Growth Factor (VEGF) Ab-7<br />

MMP-13 (Collagenase-3) Ab-1<br />

Vimentin/gp100<br />

Vinculin Ab-1<br />

Epithelial Specific Antigen/Ep-CAM Ab-1<br />

CD54/ICAM-1 Ab-2<br />

Heat Shock Protein 70 (HSP70) Ab-2<br />

MHC I (HLA-A, B, C) Ab-3<br />

Collagen X Ab-1<br />

Cytokeratin 5 Ab-1<br />

Retinoblastoma (Rb) Ab-5<br />

sm (Smith Antigen) Ab-1<br />

p53<br />

Progesterone Receptor, Rabbit Monoclonal Antibody<br />

Cat. No.<br />

RM-9121<br />

RM-9123<br />

RM-9128<br />

RM-9131<br />

RM-9103<br />

RM-9132<br />

RM-9133<br />

RM-9104<br />

RM-9105<br />

RM-9106<br />

RM-9107<br />

RM-9108<br />

MS-704<br />

MS-1300<br />

MS-9078<br />

MS-9080<br />

MS-9083<br />

MS-9085<br />

MS-9086<br />

MS-9470<br />

MS-10340<br />

MS-10637<br />

MS-163<br />

MS-126<br />

MS-1572<br />

MS-1150<br />

MS-571<br />

MS-128<br />

MS-800<br />

MS-314<br />

MS-1634<br />

MS-247<br />

MS-1226<br />

MS-315<br />

MS-279<br />

MS-1380<br />

MS-471<br />

MS-997<br />

MS-1453<br />

MS-768<br />

MS-112<br />

MS-770<br />

MS-338<br />

MS-129<br />

MS-804<br />

MS-1467<br />

MS-825<br />

MV-2004<br />

MS-1209<br />

MS-144<br />

MS-305<br />

MS-482<br />

MS-1218<br />

MS-852<br />

MS-1896<br />

MS-595<br />

MS-450<br />

RM-2103<br />

RM-2114<br />

Page<br />

107<br />

77<br />

245<br />

221<br />

155<br />

125<br />

212<br />

109<br />

205<br />

172<br />

71<br />

55<br />

229<br />

229<br />

176<br />

100<br />

220<br />

62<br />

63<br />

64<br />

193<br />

147<br />

185<br />

171<br />

232<br />

232<br />

238<br />

234<br />

244<br />

154<br />

244<br />

233<br />

244<br />

134<br />

241<br />

236<br />

236<br />

116<br />

237<br />

164<br />

84<br />

174<br />

108<br />

247<br />

188<br />

246<br />

191<br />

247<br />

248<br />

132<br />

85<br />

152<br />

185<br />

106<br />

114<br />

225<br />

228<br />

205<br />

217<br />

260<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

GT-1928<br />

HM-1630<br />

MS-66<br />

MS-104<br />

MS-105<br />

MS-106<br />

MS-107<br />

MS-110<br />

MS-111<br />

MS-112<br />

MS-113<br />

MS-114<br />

MS-115<br />

MS-120<br />

MS-123<br />

MS-126<br />

MS-127<br />

MS-128<br />

MS-129<br />

MS-130<br />

MS-131<br />

MS-133<br />

MS-136<br />

MS-138<br />

MS-139<br />

MS-142<br />

MS-143<br />

MS-145<br />

MS-146<br />

MS-148<br />

MS-149<br />

MS-163<br />

MS-164<br />

MS-165<br />

MS-168<br />

MS-178<br />

MS-180<br />

MS-181<br />

MS-182<br />

MS-185<br />

MS-186<br />

MS-187<br />

MS-189<br />

MS-190<br />

MS-192<br />

MS-196<br />

MS-197<br />

MS-198<br />

MS-199<br />

MS-201<br />

MS-203<br />

MS-204<br />

MS-208<br />

MS-210<br />

MS-211<br />

MS-213<br />

MS-215<br />

MS-216<br />

MS-224<br />

MS-225<br />

MS-226<br />

MS-229<br />

MS-230<br />

MS-231<br />

Product Description<br />

Properdin, FITC Labeled Antibody<br />

MUC-1 Ab-5, Hamster Monoclonal Antibody<br />

6-Histidine (Epitope Tag) Ab-1, Mouse Monoclonal Antibody<br />

p53 Ab-1, Mouse Monoclonal Antibody<br />

p53 Ab-2, Mouse Monoclonal Antibody<br />

PCNA (Proliferating Cell Nuclear Antigen) Ab-1, Mouse Monoclonal Antibody<br />

Retinoblastoma (Rb) Ab-1, Mouse Monoclonal Antibody<br />

Cdk1/p34 cdc2 Ab-1, Mouse Monoclonal Antibody<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-1, Mouse Monoclonal Antibody<br />

CD45RO (T-Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Actin, Smooth Muscle Ab-1, Mouse Monoclonal Antibody<br />

CD54/ICAM-1 Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 14 Ab-1, Mouse Monoclonal Antibody<br />

Heat Shock Protein 60 (HSP60) Ab-1, Mouse Monoclonal Antibody<br />

Bcl-2α Ab-1, Mouse Monoclonal Antibody<br />

Involucrin Ab-1, Mouse Monoclonal Antibody<br />

c-myc Ab-1, Mouse Monoclonal Antibody<br />

Tenascin Ab-1, Mouse Monoclonal Antibody<br />

Vimentin Ab-2, Mouse Monoclonal Antibody<br />

CDw75 Ab-1, Mouse Monoclonal Antibody<br />

CD74 Ab-1, Mouse Monoclonal Antibody<br />

MHC II (HLA-DR) Ab-1, Mouse Monoclonal Antibody<br />

CD57 (Natural Killer Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

TAG-72/CA 72-4∗ Ab-1, Mouse Monoclonal Antibody<br />

c-myc Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin 18 Ab-1, Mouse Monoclonal Antibody<br />

Kappa Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Mucin 5AC (MUC5AC)/Gastric Mucin Ab-1, Mouse Monoclonal Antibody<br />

CD43/T-Cell Marker Ab-1, Mouse Monoclonal Antibody<br />

Calprtectin-Monocyte/Macrophage/L1 protein Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, Multi Ab-1, Mouse Monoclonal Antibody<br />

MHC II (HLA-DQ) Ab-1, Mouse Monoclonal Antibody<br />

LCK (p56 lck ) Ab-1, Mouse Monoclonal Antibody<br />

Fibronectin Ab-1, Mouse Monoclonal Antibody<br />

Estrogen Receptor Ab-1, Mouse Monoclonal Antibody<br />

CD44 Std./H-CAM Ab-2, Mouse Monoclonal Antibody<br />

Lambda Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-3, Mouse Monoclonal Antibody<br />

p53 Ab-4, Mouse Monoclonal Antibody<br />

Actin, Skeletal Muscle Ab-2, Mouse Monoclonal Antibody<br />

p53 Ab-5, Mouse Monoclonal Antibody<br />

p53 Ab-6, Mouse Monoclonal Antibody<br />

Granulocyte (Myeloid Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

p170/p-Glycoprotein/MDR (Anti-Hamster) Ab-1, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-2, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-6, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-7, Mouse Monoclonal Antibody<br />

Cytokeratin 19 Ab-1, Mouse Monoclonal Antibody<br />

pS2/pNR-2 Estrogen-Regulated Protein Ab-2, Mouse Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-2, Mouse Monoclonal Antibody<br />

CD25/IL-2Rα Ab-1, Mouse Monoclonal Antibody<br />

CD56/NCAM-1 Ab-2, Mouse Monoclonal Antibody<br />

Placental Alk. Phosphatase (PLAP) Ab-1, Mouse Monoclonal Antibody<br />

Cyclin D1/Bcl-1 Ab-1, Mouse Monoclonal Antibody<br />

Cyclin D1/Bcl-1 Ab-2, Mouse Monoclonal Antibody<br />

Cyclin D2 Ab-2, Mouse Monoclonal Antibody<br />

Cyclin D3 Ab-1, Mouse Monoclonal Antibody<br />

Cyclin D3 Ab-2, Mouse Monoclonal Antibody<br />

Transglutaminase II Ab-1, Mouse Monoclonal Antibody<br />

HDJ-2/DNAJ Ab-1, Mouse Monoclonal Antibody<br />

α-Fetoprotein (AFP) Ab-1, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-2, Mouse Monoclonal Antibody<br />

p21 WAF1 Ab-3, Mouse Monoclonal Antibody<br />

Fibrillin-1 Ab-1, Mouse Monoclonal Antibody<br />

Clone<br />

Polyclonal<br />

MH1; same as CT2<br />

4D11<br />

PAb 240<br />

PAb 1801<br />

PC10<br />

1F8; same as Rb1<br />

A17.1.1<br />

pS2.1<br />

UCHL-1<br />

1A4; same as asm-1<br />

15.2<br />

LL002<br />

LK1<br />

100/D5<br />

SY5<br />

9E11; same as A3B2<br />

T2H5<br />

V9<br />

LN1<br />

LN2<br />

LN3<br />

NK1<br />

B72.3<br />

9E10.3<br />

DC10<br />

L1C1<br />

45M1<br />

DF-T1<br />

MAC 387<br />

C-11<br />

SPV-L3<br />

3A5<br />

HFN 7.1<br />

AER314<br />

5F12<br />

HP6054<br />

323/A3<br />

PAb 122<br />

5C5.F8.C7 or alpha-1<br />

DO-7<br />

DO-1<br />

BM-2<br />

265/F4<br />

hPRa 2<br />

hPRa 6<br />

hPRa 7<br />

A53-B/A2.26; also known as Ks19.1<br />

GE2; same as R47/94<br />

2F12<br />

IL2R.1<br />

123C3.D5<br />

8B6.18<br />

DCS-6<br />

DCS-11<br />

DCS-3.1<br />

DCS-22<br />

DCS-28.1<br />

CUB 7402<br />

KA2A5.6<br />

C3<br />

9G6.10<br />

DCS-60.2<br />

11C1.3<br />

Page<br />

220<br />

193<br />

50<br />

206<br />

206<br />

213<br />

224<br />

95<br />

222<br />

84<br />

52<br />

84<br />

117<br />

152<br />

59<br />

171<br />

104<br />

234<br />

247<br />

98<br />

87<br />

185<br />

86<br />

233<br />

104<br />

118<br />

171<br />

194<br />

82<br />

178<br />

121<br />

185<br />

176<br />

140<br />

134<br />

83<br />

174<br />

132<br />

206<br />

52<br />

206<br />

207<br />

148<br />

210<br />

218<br />

218<br />

218<br />

119<br />

222<br />

159<br />

78<br />

85<br />

215<br />

110<br />

110<br />

111<br />

112<br />

112<br />

240<br />

150<br />

139<br />

156<br />

203<br />

140<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

261


Cat. No.<br />

MS-233<br />

MS-234<br />

MS-235<br />

MS-240<br />

MS-243<br />

MS-247<br />

MS-248<br />

MS-249<br />

MS-250<br />

MS-256<br />

MS-259<br />

MS-261<br />

MS-262<br />

MS-268<br />

MS-269<br />

MS-270<br />

MS-272<br />

MS-273<br />

MS-278<br />

MS-279<br />

MS-280<br />

MS-285<br />

MS-286<br />

MS-289<br />

MS-290<br />

MS-294<br />

MS-295<br />

MS-296<br />

MS-298<br />

MS-299<br />

MS-300<br />

MS-301<br />

MS-302<br />

MS-303<br />

MS-304<br />

MS-305<br />

MS-306<br />

MS-307<br />

MS-310<br />

MS-311<br />

MS-313<br />

MS-314<br />

MS-315<br />

MS-316<br />

MS-321<br />

MS-322<br />

MS-324<br />

MS-325<br />

MS-329<br />

MS-336<br />

MS-338<br />

MS-339<br />

MS-340<br />

MS-341<br />

MS-342<br />

MS-343<br />

MS-346<br />

MS-348<br />

MS-349<br />

MS-350<br />

MS-353<br />

MS-354<br />

MS-355<br />

MS-356<br />

Product Description<br />

Estrogen Sulfotransferase (Anti-Rat) Ab-1, Mouse Monoclonal Antibody<br />

Collagen II Ab-1, Mouse Monoclonal Antibody<br />

Collagen II Ab-2, Mouse Monoclonal Antibody<br />

CD45/T200/LCA Ab-1, Mouse Monoclonal Antibody<br />

Gα i1 G-Protein Ab-3, Mouse Monoclonal Antibody<br />

Tau Ab-2, Mouse Monoclonal Antibody<br />

MAP1B/MAP5 (Microtubule-Associated Protein) Ab-1, Mouse Monoclonal Antibody<br />

MAP 2a,b (Microtubule-Associated Protein) Ab-2, Mouse Monoclonal Antibody<br />

MAP 2a,b,c (Microtubule-Associated Protein) Ab-3, Mouse Monoclonal Antibody<br />

p27 Kip1 Ab-1, Mouse Monoclonal Antibody<br />

Laminin Receptor Ab-1, Mouse Monoclonal Antibody<br />

Prohibitin (Mitochondrial Marker) Ab-1, Mouse Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-4, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-1, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-2, Mouse Monoclonal Antibody<br />

HER-4/c-erbB-4 Ab-1, Mouse Monoclonal Antibody<br />

Heregulin/NDF/GGF/Neuregulin Ab-1, Mouse Monoclonal Antibody<br />

MyoD1 Ab-1, Mouse Monoclonal Antibody<br />

MyoD1 Ab-2, Mouse Monoclonal Antibody<br />

Transglutaminase II Ab-2, Mouse Monoclonal Antibody<br />

GFAP/Glial Fibrillary Acidic Protein Ab-1, Mouse Monoclonal Antibody<br />

Ku (p80) Ab-2, Mouse Monoclonal Antibody<br />

Ku (p70/p80) Ab-3, Mouse Monoclonal Antibody<br />

CD117/c-Kit/SCF-Receptor Ab-3, Mouse Monoclonal Antibody<br />

Vascular Endothelial Growth Factor (VEGF) Ab-2, Mouse Monoclonal Antibody<br />

CD99/MIC2 (Ewing s Sarcoma Marker) Ab-1, Mouse Monoclonal Antibody<br />

Troponin T, Cardiac Isoform Ab-1, Mouse Monoclonal Antibody<br />

S100 Protein Ab-1, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-8, Mouse Monoclonal Antibody<br />

Cdk4 Ab-1, Mouse Monoclonal Antibody<br />

Transglutaminase II Ab-3, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-4, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-5, Mouse Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-5, Mouse Monoclonal Antibody<br />

HER-4/c-erbB-4 Ab-3, Mouse Monoclonal Antibody<br />

CD54/ICAM-1 Ab-2, Mouse Monoclonal Antibody<br />

Collagen II Ab-3, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-6, Mouse Monoclonal Antibody<br />

c-erbB-3/HER-3 Ab-6, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-3, Mouse Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-7, Mouse Monoclonal Antibody<br />

Hepatitis B Virus Surface Antigen (HBVsAg) Ab-1, Mouse Monoclonal Antibody<br />

Estrogen Receptor Ab-10, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-5, Mouse Monoclonal Antibody<br />

Prostate Specific Acid Phosphatase (PSAP) Ab-1, Mouse Monoclonal Antibody<br />

Syk Signaling Protein Ab-1, Mouse Monoclonal Antibody<br />

Chromogranin A Ab-1, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-8, Mouse Monoclonal Antibody<br />

Ku (p70) Ab-4, Mouse Monoclonal Antibody<br />

CD35/CR1 (Follicular Dendritic Cell Marker), Mouse Monoclonal Antibody<br />

Cyclin B1, Mouse Monoclonal Antibody<br />

Fyn (p59 fyn ) Ab-1, Mouse Monoclonal Antibody<br />

CD20 Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, Low Molecular Weight Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, High Molecular Weight Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, Pan Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, High Molecular Weight Ab-2, Mouse Monoclonal Antibody<br />

Epithelial Membrane Antigen/EMA Ab-2, Mouse Monoclonal Antibody<br />

CNPase Ab-1 (Oligodendrocyte & Schwann Cell Marker), Mouse Monoclonal Antibody<br />

Vascular Endothelial Growth Factor (VEGF) Ab-3, Mouse Monoclonal Antibody<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Estrogen Receptor Ab-11, Mouse Monoclonal Antibody<br />

CD45/T200/LCA Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin, Pan Ab-2, Mouse Monoclonal Antibody<br />

Clone<br />

EST.1<br />

5B2.5<br />

2B1.5<br />

Bra55<br />

R4.5<br />

TAU-5<br />

3G5<br />

AP20<br />

AP18<br />

DCS-72.F6<br />

MLuC5<br />

II-14-10<br />

H3.90.6; same as Ab90<br />

528<br />

225<br />

H4.77.16; same as Ab77<br />

7D5<br />

5.8A<br />

5.2F<br />

TG100<br />

GA-5<br />

111<br />

162<br />

K45<br />

5C3.F8<br />

HO36-1.1<br />

13-11<br />

4C4.9<br />

hPRa 2 + hPRa 3<br />

DCS-35<br />

CUB 7402 + TG100<br />

N12<br />

N24<br />

H3.105.5; same as Ab105<br />

H4.72.8; same as Ab72<br />

W-CAM-1; same as Wehi-CAM-1 or 1H4<br />

6B3<br />

N28<br />

2B5<br />

EGFR.1<br />

2C3<br />

T9; same as 3E7<br />

TE111.5D11<br />

H11<br />

PASE/4LJ<br />

4D10.1<br />

LK2H10<br />

e2-4001<br />

N3H10<br />

E11<br />

V152<br />

1S<br />

L26<br />

AE1<br />

AE3<br />

AE1/AE3<br />

DEQ<br />

GP1.4<br />

11-5B<br />

JH121<br />

JC/70A<br />

1D5<br />

PD7/26/16 + 2B11<br />

PAN-CK<br />

Page<br />

136<br />

105<br />

105<br />

83<br />

143<br />

233<br />

180<br />

179<br />

179<br />

205<br />

176<br />

219<br />

159<br />

128<br />

128<br />

161<br />

162<br />

196<br />

196<br />

241<br />

144<br />

173<br />

173<br />

91<br />

246<br />

89<br />

242<br />

227<br />

218<br />

96<br />

241<br />

156<br />

156<br />

160<br />

161<br />

85<br />

105<br />

156<br />

160<br />

129<br />

160<br />

154<br />

134<br />

129<br />

221<br />

231<br />

101<br />

157<br />

173<br />

81<br />

108<br />

142<br />

76<br />

121<br />

120<br />

121<br />

120<br />

131<br />

104<br />

246<br />

80<br />

135<br />

83<br />

121<br />

262<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

MS-357<br />

MS-359<br />

MS-361<br />

MS-364<br />

MS-369<br />

MS-370<br />

MS-371<br />

MS-375<br />

MS-376<br />

MS-377<br />

MS-378<br />

MS-379<br />

MS-381<br />

MS-382<br />

MS-387<br />

MS-390<br />

MS-391<br />

MS-393<br />

MS-394<br />

MS-396<br />

MS-397<br />

MS-398<br />

MS-399<br />

MS-400<br />

MS-401<br />

MS-404<br />

MS-409<br />

MS-418<br />

MS-419<br />

MS-420<br />

MS-421<br />

MS-423<br />

MS-434<br />

MS-440<br />

MS-443<br />

MS-444<br />

MS-448<br />

MS-449<br />

MS-450<br />

MS-452<br />

MS-454<br />

MS-455<br />

MS-457<br />

MS-459<br />

MS-464<br />

MS-465<br />

MS-469<br />

MS-470<br />

MS-471<br />

MS-482<br />

MS-486<br />

MS-488<br />

MS-489<br />

MS-499<br />

MS-502<br />

MS-512<br />

MS-524<br />

MS-541<br />

MS-549<br />

MS-551<br />

MS-557<br />

MS-567<br />

MS-569<br />

MS-571<br />

Product Description<br />

Clone<br />

CD79a/mb-1 (B-Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

HM47/A9<br />

Neurofilament (200kDa & 68kDa) Ab-1, Mouse Monoclonal Antibody<br />

2F11<br />

CD30 (Reedternberg Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

Ber-H2<br />

Melanoma (gp100) Ab-1, Mouse Monoclonal Antibody<br />

HMB45<br />

DNA-PKcs Ab-1, Mouse Monoclonal Antibody<br />

18-2<br />

DNA-PKcs Ab-2, Mouse Monoclonal Antibody<br />

25-4<br />

DNA-PKcs Ab-3, Mouse Monoclonal Antibody<br />

42-psc; same as 42-26 or 42-27<br />

Collagen IV Ab-1, Mouse Monoclonal Antibody<br />

PHM-12<br />

Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody<br />

D33<br />

Cytokeratin 20 Ab-1, Mouse Monoclonal Antibody<br />

Ks20.8<br />

Epidermal Growth Factor Receptor/EGFR Ab-10, Mouse Monoclonal Antibody<br />

111.6<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-1, Mouse Monoclonal Antibody<br />

121SLE<br />

Chromogranin A Ab-2, Mouse Monoclonal Antibody<br />

PHE5<br />

Chromogranin A Ab-3, Mouse Monoclonal Antibody<br />

LK2H10 + PHE5<br />

p21 WAF1 Ab-5, Mouse Monoclonal Antibody<br />

HZ52<br />

Progesterone Receptor Ab-9, Mouse Monoclonal Antibody<br />

1A6<br />

Estrogen Receptor Ab-12, Mouse Monoclonal Antibody<br />

6F11<br />

CD5 Ab-1, Mouse Monoclonal Antibody<br />

4C7<br />

Neurotrophin Receptor/NGF-Receptor (p75 NGFR ) Ab-1, Mouse Monoclonal Antibody NGFR5<br />

Epidermal Growth Factor Receptor/EGFR Ab-11, Mouse Monoclonal Antibody<br />

199.12<br />

CD68/Macrophage Marker Ab-3, Mouse Monoclonal Antibody<br />

KP1<br />

Cdk6 Ab-1, Mouse Monoclonal Antibody<br />

K6.83; same as DCS-83<br />

Cdk6 Ab-2, Mouse Monoclonal Antibody<br />

K6.90; same as DCS-90<br />

Epidermal Growth Factor Receptor/EGFR Ab-12 (Cocktail R19/48), Mouse Monoclonal Antibody111.6 + 199.12 + F4 + 11E8<br />

CD3ε; (Early T-Cell Marker) Ab-2, Mouse Monoclonal Antibody<br />

PS1<br />

Paxillin Ab-1, Mouse Monoclonal Antibody<br />

5H11<br />

Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody<br />

PN-15<br />

Thrombospondin (TSP) Ab-1, Mouse Monoclonal Antibody<br />

A4.1<br />

Thrombospondin-1 (TSP-1) Ab-2, Mouse Monoclonal Antibody<br />

D4.6<br />

Thrombospondin (TSP) Ab-3, Mouse Monoclonal Antibody<br />

C6.7<br />

Thrombospondin (TSP) Ab-4, Mouse Monoclonal Antibody<br />

A6.1<br />

DNA-PKcs Ab-4 (Cocktail), Mouse Monoclonal Antibody<br />

18-2 + 25-4 + 42-psc<br />

XRCC1 (X-Ray Repair Cross Complementing Protein 1) Ab-1, Mouse Monoclonal Antibody 33-2-5<br />

Microglobulin β -2 Ab-1, Mouse Monoclonal Antibody<br />

246-E8.E7; same as HLA-ABC-m2<br />

Androgen Receptor Ab-1, Mouse Monoclonal Antibody<br />

AR 441<br />

Collagen VII Ab-1, Mouse Monoclonal Antibody<br />

LH7.2<br />

Collagen IV Ab-2, Mouse Monoclonal Antibody<br />

CIV 22<br />

Filaggrin Ab-1, Mouse Monoclonal Antibody<br />

FLG01<br />

sm (Smith Antigen) Ab-1, Mouse Monoclonal Antibody<br />

Y12<br />

Adrenocorticotrophic Hormone (ACTH) Ab-1, Mouse Monoclonal Antibody<br />

AH26<br />

p21 WAF1 Ab-6, Mouse Monoclonal Antibody<br />

HJ21; same as WA-1<br />

Thomsen-Friedenreich Antigen Ab-1, Mouse Monoclonal Antibody<br />

A78-G/A7<br />

CD8 Ab-1, Mouse Monoclonal Antibody<br />

C8/144B<br />

Cdk2 Ab-1, Mouse Monoclonal Antibody<br />

2B6<br />

Ornithine Decarboxylase (ODC) Ab-1, Mouse Monoclonal Antibody<br />

MP16-2<br />

CD155/PVR (Poliovirus Receptor) Ab-1, Mouse Monoclonal Antibody<br />

D171<br />

Cdk4 Ab-2, Mouse Monoclonal Antibody<br />

DCS-31<br />

MGMT (O-methylguanine-DNA methyltransferase) Ab-1, Mouse Monoclonal Antibody MT 3.1<br />

Thymidylate Synthase Ab-1, Mouse Monoclonal Antibody<br />

TS 106<br />

Heat Shock Protein 70 (HSP70) Ab-2, Mouse Monoclonal Antibody<br />

W27<br />

Dystrophin Ab-1, Mouse Monoclonal Antibody<br />

1808<br />

Plasma Cell Ab-1, Mouse Monoclonal Antibody<br />

LIV3G11<br />

Cytokeratin 17 Ab-1, Mouse Monoclonal Antibody<br />

E3<br />

Thymidine Phosphorylase/PD-ECGF Ab-1, Mouse Monoclonal Antibody<br />

P-GF.44C<br />

CD81/TAPA-1 Ab-1, Mouse Monoclonal Antibody<br />

1.3.3.22<br />

Milk Fat Globule 1, Human (HMFG1) Ab-1, Mouse Monoclonal Antibody<br />

EDM45<br />

CD26/DPP IV/ADA-Binding Protein Ab-1, Mouse Monoclonal Antibody<br />

202-36<br />

CD37 Ab-1, Mouse Monoclonal Antibody<br />

IPO-24<br />

Rabies Virus Ab-1, Mouse Monoclonal Antibody<br />

Rab-50<br />

Mucin 5AC (MUC5AC)/Gastric Mucin Ab-2, Mouse Monoclonal Antibody<br />

1-13M1<br />

MHC I (HLA-A, B, C) Ab-1, Mouse Monoclonal Antibody<br />

246-B8.E7<br />

MMP-2 (72kDa Collagenase IV) Ab-1, Mouse Monoclonal Antibody<br />

CA-4001 or CA719E3C<br />

MMP-9 (92kDa Collagenase IV) Ab-1, Mouse Monoclonal Antibody<br />

GE-213<br />

TIMP-2 Ab-1, Mouse Monoclonal Antibody<br />

T2-101<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

Page<br />

88<br />

199<br />

80<br />

183<br />

123<br />

124<br />

124<br />

105<br />

123<br />

119<br />

130<br />

62<br />

101<br />

102<br />

204<br />

219<br />

135<br />

73<br />

199<br />

130<br />

87<br />

97<br />

98<br />

130<br />

71<br />

212<br />

223<br />

235<br />

236<br />

235<br />

235<br />

124<br />

250<br />

185<br />

57<br />

106<br />

106<br />

141<br />

228<br />

54<br />

204<br />

234<br />

74<br />

96<br />

201<br />

92<br />

96<br />

184<br />

236<br />

152<br />

126<br />

216<br />

118<br />

236<br />

89<br />

186<br />

78<br />

81<br />

223<br />

195<br />

184<br />

187<br />

189<br />

238<br />

263


Cat. No.<br />

MS-574<br />

MS-576<br />

MS-581<br />

MS-586<br />

MS-587<br />

MS-588<br />

MS-595<br />

MS-596<br />

MS-597<br />

MS-599<br />

MS-600<br />

MS-608<br />

MS-609<br />

MS-611<br />

MS-612<br />

MS-613<br />

MS-616<br />

MS-617<br />

MS-620<br />

MS-621<br />

MS-628<br />

MS-631<br />

MS-632<br />

MS-633<br />

MS-635<br />

MS-636<br />

MS-637<br />

MS-638<br />

MS-641<br />

MS-642<br />

MS-643<br />

MS-644<br />

MS-645<br />

MS-647<br />

MS-650<br />

MS-651<br />

MS-659<br />

MS-660<br />

MS-661<br />

MS-664<br />

MS-665<br />

MS-668<br />

MS-669<br />

MS-670<br />

MS-671<br />

MS-675<br />

MS-679<br />

MS-681<br />

MS-690<br />

MS-692<br />

MS-699<br />

MS-701<br />

MS-704<br />

MS-707<br />

MS-710<br />

MS-711<br />

MS-714<br />

MS-715<br />

MS-716<br />

MS-717<br />

MS-722<br />

MS-725<br />

MS-727<br />

MS-728<br />

Product Description<br />

Interferon-α (II)/IFN-α (II), Mouse Monoclonal Antibody<br />

DNA Polymerase, ε; Ab-1, Mouse Monoclonal Antibody<br />

Tubulin-α Ab-2, Mouse Monoclonal Antibody<br />

p300/CBP (CREB-Binding Protein) Ab-1, Mouse Monoclonal Antibody<br />

Adenovirus Type 5 E1A Ab-1, Mouse Monoclonal Antibody<br />

Adenovirus Type 2 E1A Ab-2, Mouse Monoclonal Antibody<br />

Retinoblastoma (Rb) Ab-5, Mouse Monoclonal Antibody<br />

CD29 (Integrin β -1) Ab-1, Mouse Monoclonal Antibody<br />

Bcl-2α Ab-3, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu5 Ab-15, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-16, Mouse Monoclonal Antibody<br />

TIMP-1 Ab-2, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-13, Mouse Monoclonal Antibody<br />

Cytokeratin 10 Ab-2, Mouse Monoclonal Antibody<br />

MART-1/Melan-A (Melanoma Marker) Ab-1, Mouse Monoclonal Antibody<br />

CEA (Carcinoembryonic Antigen)/CD66e Ab-3, Mouse Monoclonal Antibody<br />

Cdk4 Ab-6, Mouse Monoclonal Antibody<br />

Cdk2 Ab-4, Mouse Monoclonal Antibody<br />

Cytokeratin 16 Ab-1, Mouse Monoclonal Antibody<br />

CD137 (4-1BB) Ab-1, Mouse Monoclonal Antibody<br />

Histone H1 Ab-1, Mouse Monoclonal Antibody<br />

Insulin Receptor (α ubunit) Ab-1, Mouse Monoclonal Antibody<br />

Insulin Receptor (α ubunit) Ab-2, Mouse Monoclonal Antibody<br />

Insulin Receptor (α ubunit) Ab-3, Mouse Monoclonal Antibody<br />

Insulin Receptor (β ubunit) Ab-5, Mouse Monoclonal Antibody<br />

Insulin Receptor (β ubunit) Ab-6, Mouse Monoclonal Antibody<br />

HER-4/c-erbB-4, Mouse Monoclonal Antibody<br />

CDC25A Ab-1, Mouse Monoclonal Antibody<br />

IGF-1R (α ubunit) Ab-1, Mouse Monoclonal Antibody<br />

IGF-1 R (α ubunit) Ab-2, Mouse Monoclonal Antibody<br />

IGF-1R (α ubunit) Ab-3, Mouse Monoclonal Antibody<br />

IGF-1R (α ubunit) Ab-4, Mouse Monoclonal Antibody<br />

IGF-1R (β ubunit) Ab-5, Mouse Monoclonal Antibody<br />

ERCC1 Ab-1, Mouse Monoclonal Antibody<br />

XPA Ab-1, Mouse Monoclonal Antibody<br />

Hepatocyte Growth Factor Ab-1, Mouse Monoclonal Antibody<br />

Plasminogen Ab-1, Mouse Monoclonal Antibody<br />

p170/p-Glycoprotein/MDR Ab-2, Mouse Monoclonal Antibody<br />

Ezrin/p81/80K/Cytovillin Ab-1, Mouse Monoclonal Antibody<br />

LRP/MVP (Major Vault Protein) Ab-2, Mouse Monoclonal Antibody<br />

Epidermal Growth Factor Receptor/EGFR Ab-15, Mouse Monoclonal Antibody<br />

CD44 Std./H-CAM Ab-4, Mouse Monoclonal Antibody<br />

DNA Polymerase, β Ab-1, Mouse Monoclonal Antibody<br />

Transforming Growth Factor α (TGFα) Ab-1, Mouse Monoclonal Antibody<br />

ERCC1 Ab-2, Mouse Monoclonal Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-2, Mouse Monoclonal Antibody<br />

CD43/T-Cell Marker Ab-3, Mouse Monoclonal Antibody<br />

Mcl-1 Ab-1, Mouse Monoclonal Antibody<br />

von Hippel-Lindau (vHL) Protein Ab-1, Mouse Monoclonal Antibody<br />

RPA/p70 (Replication Protein A) Ab-2, Mouse Monoclonal Antibody<br />

TTF-1 (Thyroid Transcription Factor-1) Ab-1, Mouse Monoclonal Antibody<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-1, Mouse Monoclonal Antibody<br />

Surfactant Protein B (Precursor) Ab-1, Mouse Monoclonal Antibody<br />

GST (Epitope Tag) Ab-1, Mouse Monoclonal Antibody<br />

TR2/HVEM Ab-1, Mouse Monoclonal Antibody<br />

Bax Ab-1, Mouse Monoclonal Antibody<br />

Bax Ab-4, Mouse Monoclonal Antibody<br />

Bcl-X Ab-1, Mouse Monoclonal Antibody<br />

MART-1/Melan-A (Melanoma Marker) (Cocktail) Ab-3, Mouse Monoclonal Antibody<br />

Cytomegalovirus Ab-1, Mouse Monoclonal Antibody<br />

Factor VIII Related Antigen/von Willebrand Factor Ab-2, Mouse Monoclonal Antibody<br />

HER-3/c-erbB-3 Ab-8, Mouse Monoclonal Antibody<br />

Moesin Ab-1, Mouse Monoclonal Antibody<br />

CD10/CALLA (Neutral Endopeptidase) Ab-2, Mouse Monoclonal Antibody<br />

Clone<br />

N27<br />

93H3A<br />

DM1A<br />

NM11<br />

M58<br />

M73<br />

XZ133<br />

4B7R<br />

8C8<br />

3B5<br />

L26<br />

102D1<br />

528 + 199.12<br />

DE-K10<br />

M2-7C10<br />

COL-1<br />

DCS-31 + DCS-35<br />

2B6 + 8D4<br />

LL025<br />

BBK-2<br />

1415-1<br />

83-14<br />

83-7<br />

47-9<br />

CT-1<br />

CT-3<br />

HFR-1<br />

DCS-120<br />

24-31<br />

17-69<br />

24-57<br />

24-60<br />

1-2<br />

3H11<br />

12F5<br />

4C12.1<br />

SBF1<br />

F4<br />

3C12<br />

1032<br />

H9B4<br />

156-3C11<br />

18S<br />

MF9<br />

8F1<br />

AUA1<br />

84-3C1<br />

RC13<br />

Ig33<br />

2H10 or 70C or alphaSSB70C<br />

8G7G3/1<br />

OZ12<br />

SPB01; same as 1-2-A5-9<br />

GST01; same as #794<br />

122<br />

2D2<br />

6A7<br />

2H12<br />

M2-7C10 + M2-9E3<br />

CMV01<br />

F8/86<br />

SGP1<br />

38/87<br />

56C6<br />

Page<br />

170<br />

125<br />

243<br />

210<br />

53<br />

53<br />

225<br />

79<br />

60<br />

157<br />

158<br />

237<br />

131<br />

116<br />

180<br />

99<br />

97<br />

96<br />

117<br />

91<br />

164<br />

169<br />

169<br />

170<br />

170<br />

170<br />

162<br />

93<br />

166<br />

166<br />

166<br />

167<br />

167<br />

133<br />

249<br />

155<br />

216<br />

210<br />

137<br />

177<br />

131<br />

83<br />

124<br />

240<br />

134<br />

132<br />

82<br />

182<br />

248<br />

226<br />

243<br />

163<br />

229<br />

149<br />

239<br />

59<br />

59<br />

60<br />

181<br />

122<br />

138<br />

160<br />

192<br />

75<br />

264<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

MS-729<br />

MS-730<br />

MS-734<br />

MS-738<br />

MS-741<br />

MS-742<br />

MS-743<br />

MS-744<br />

MS-746<br />

MS-747<br />

MS-750<br />

MS-751<br />

MS-756<br />

MS-762<br />

MS-765<br />

MS-766<br />

MS-768<br />

MS-770<br />

MS-771<br />

MS-772<br />

MS-775<br />

MS-799<br />

MS-800<br />

MS-804<br />

MS-806<br />

MS-809<br />

MS-810<br />

MS-813<br />

MS-816<br />

MS-817<br />

MS-822<br />

MS-825<br />

MS-827<br />

MS-835<br />

MS-850<br />

MS-852<br />

MS-855<br />

MS-858<br />

MS-862<br />

MS-865<br />

MS-866<br />

MS-867<br />

MS-868<br />

MS-869<br />

MS-870<br />

MS-879<br />

MS-891<br />

MS-897<br />

MS-906<br />

MS-938<br />

MS-939<br />

MS-983<br />

MS-988<br />

MS-997<br />

MS-1008<br />

MS-1010<br />

MS-1027<br />

MS-1035<br />

MS-1037<br />

MS-1040<br />

MS-1048<br />

MS-1054<br />

Product Description<br />

CD23 Ab-1, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-17, Mouse Monoclonal Antibody<br />

Placental Alk. Phosphatase (PLAP) Ab-4, Mouse Monoclonal Antibody<br />

p53 Ab-8, Mouse Monoclonal Antibody<br />

Epithelial Membrane Antigen/EMA Ab-3, Mouse Monoclonal Antibody<br />

Actin, Muscle Specific Ab-4, Mouse Monoclonal Antibody<br />

Cytokeratin 8/18 Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, Pan Ab-3, Mouse Monoclonal Antibody<br />

CD1a Ab-2, Mouse Monoclonal Antibody<br />

Collagen IV Ab-3, Mouse Monoclonal Antibody<br />

Estrogen Receptor Ab-14, Mouse Monoclonal Antibody<br />

CDC25C Ab-1, Mouse Monoclonal Antibody<br />

CD36/GPIIIb/GPIV Ab-3, Mouse Monoclonal Antibody<br />

p73α /β Ab-2, Mouse Monoclonal Antibody<br />

Maltose Binding Protein Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin 6 Ab-1, Mouse Monoclonal Antibody<br />

Human Papilloma Virus Type 16-E7 (HPV 16-E7) Ab-1, Mouse Monoclonal Antibody<br />

L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody<br />

Microphthalmia (Transcription Factor) (MiTF) Ab-1, Mouse Monoclonal Antibody<br />

Microphthalmia (Transcription Factor) (MiTF) Ab-2, Mouse Monoclonal Antibody<br />

Hepatocyte Growth Factor Ab-2, Mouse Monoclonal Antibody<br />

MART-1/Melan-A (Melanoma Marker) Ab-4, Mouse Monoclonal Antibody<br />

Tyrosinase Ab-1, Mouse Monoclonal Antibody<br />

MMP-2 (72kDa Collagenase IV) Ab-2, Mouse Monoclonal Antibody<br />

MMP-2 (72kDa Collagenase IV) Ab-4, Mouse Monoclonal Antibody<br />

MMP-3 (Stromelysin-1) Ab-1, Mouse Monoclonal Antibody<br />

MMP-3 (Stromelysin-1) Ab-2, Mouse Monoclonal Antibody<br />

MMP-7 (Matrilysin) Ab-1, Mouse Monoclonal Antibody<br />

MMP-9 (92kDa Collagenase IV) Ab-4, Mouse Monoclonal Antibody<br />

MMP-9 (92kDa Collagenase IV) Ab-5, Mouse Monoclonal Antibody<br />

MMP-10 (Stromelysin-2) Ab-2, Mouse Monoclonal Antibody<br />

MMP-13 (Collagenase-3) Ab-1, Mouse Monoclonal Antibody<br />

MMP-13 (Collagenase-3) (Anti-Rat) Ab-3, Mouse Monoclonal Antibody<br />

uPA (Urokinase-type Plasminogen Activator) Ab-2, Mouse Monoclonal Antibody<br />

p14 ARF /p16β Ab-2, Mouse Monoclonal Antibody<br />

Collagen X Ab-1, Mouse Monoclonal Antibody<br />

p130 Cas Ab-1, Mouse Monoclonal Antibody<br />

p18 INK4c Ab-3, Mouse Monoclonal Antibody<br />

CDC47/MCM7 Ab-2, Mouse Monoclonal Antibody<br />

SMAD4/DPC4 Ab-1, Mouse Monoclonal Antibody<br />

p130/Rb2 Ab-2, Mouse Monoclonal Antibody<br />

CDC6 Ab-1, Mouse Monoclonal Antibody<br />

Cyclin B1 Ab-3, Mouse Monoclonal Antibody<br />

Cyclin B1 Ab-4, Mouse Monoclonal Antibody<br />

Cyclin E Ab-2, Mouse Monoclonal Antibody<br />

E2F-1 Transcription Factor Ab-6, Mouse Monoclonal Antibody<br />

p21 WAF1 Ab-11, Mouse Monoclonal Antibody<br />

p57 Kip2 Ab-3, Mouse Monoclonal Antibody<br />

Cdk5 Ab-3, Mouse Monoclonal Antibody<br />

c-Abl Ab-1, Mouse Monoclonal Antibody<br />

Melanoma Marker, Pan Ab-1, Mouse Monoclonal Antibody<br />

CD38 Ab-3, Mouse Monoclonal Antibody<br />

RAD51 Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 8 Ab-4, Mouse Monoclonal Antibody<br />

IgA (α -Heavy Chain) Ab-1, Mouse Monoclonal Antibody<br />

Heat Shock Protein 27 (HSP27) Ab-1, Mouse Monoclonal Antibody<br />

Adenovirus Fiber (Monomer and Trimer) Ab-4, Mouse Monoclonal Antibody<br />

MMP-11 (Stromelysin-3) Ab-5, Mouse Monoclonal Antibody<br />

Mucin 2 (MUC2) Ab-2, Mouse Monoclonal Antibody<br />

Progesterone Ab-1, Mouse Monoclonal Antibody<br />

Biotin Ab-2, Mouse Monoclonal Antibody<br />

c-myc Ab-5, Mouse Monoclonal Antibody<br />

Clone<br />

1B12<br />

e2-4001 + 3B5<br />

8A9<br />

DO-7 + BP53-12<br />

E29<br />

HHF35<br />

5D3<br />

Lu-5<br />

MTB1<br />

PHM-12 + CIV 22<br />

1D5 + 6F11<br />

25C14; same as TC-14<br />

185-1G2<br />

ER-15<br />

R29<br />

LHK6B<br />

TVG701Y<br />

UJ127<br />

C5<br />

D5<br />

SBF5<br />

A103<br />

T311<br />

VB3<br />

A-Gel VC2<br />

SL-1 ID3<br />

SL-1 IID4<br />

ID2<br />

IA5<br />

IIA5<br />

IVC5<br />

VIIIA2<br />

LIPCO IID1<br />

7-18<br />

14P02; same as DCS-240<br />

X-AC9<br />

CAS-14; same as 35B-1A4<br />

18P118; same as DCS-118<br />

47DC141; same as DCS-141<br />

SMD46; same as DCS-46<br />

130P215; same as DCS-215<br />

DCS-180<br />

GNS1<br />

GNS11<br />

HE12<br />

KH95<br />

CP74<br />

KP39<br />

DC34<br />

8E9<br />

HMB45 (gp100, M2-7C10) MART-1 and M2-9E3<br />

(MART-1)<br />

38C03; same as SPC32<br />

51RAD01; same as 3C10<br />

TS1<br />

GA01<br />

G3.1<br />

4D2<br />

SL3.05<br />

M53<br />

4P01; same as 1E11<br />

BTN.4<br />

67P05<br />

Page<br />

77<br />

158<br />

215<br />

207<br />

131<br />

51<br />

116<br />

122<br />

70<br />

106<br />

135<br />

94<br />

81<br />

208<br />

178<br />

115<br />

164<br />

174<br />

186<br />

186<br />

155<br />

181<br />

244<br />

188<br />

188<br />

188<br />

189<br />

189<br />

190<br />

190<br />

190<br />

191<br />

191<br />

245<br />

202<br />

106<br />

209<br />

203<br />

94<br />

228<br />

209<br />

93<br />

109<br />

109<br />

113<br />

127<br />

204<br />

208<br />

97<br />

63<br />

183<br />

82<br />

223<br />

116<br />

165<br />

151<br />

52<br />

191<br />

194<br />

217<br />

61<br />

104<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

265


Cat. No.<br />

MS-1056<br />

MS-1057<br />

MS-1058<br />

MS-1059<br />

MS-1060<br />

MS-1061<br />

MS-1062<br />

MS-1063<br />

MS-1065<br />

MS-1066<br />

MS-1067<br />

MS-1068<br />

MS-1069<br />

MS-1072<br />

MS-1074<br />

MS-1077<br />

MS-1079<br />

MS-1080<br />

MS-1085<br />

MS-1086<br />

MS-1087<br />

MS-1088<br />

MS-1089<br />

MS-1094<br />

MS-1095<br />

MS-1096<br />

MS-1098<br />

MS-1101<br />

MS-1102<br />

MS-1103<br />

MS-1104<br />

MS-1105<br />

MS-1110<br />

MS-1112<br />

MS-1113<br />

MS-1114<br />

MS-1116<br />

MS-1118<br />

MS-1120<br />

MS-1121<br />

MS-1123<br />

MS-1126<br />

MS-1139<br />

MS-1140<br />

MS-1143<br />

MS-1149<br />

MS-1150<br />

MS-1151<br />

MS-1153<br />

MS-1157<br />

MS-1158<br />

MS-1163<br />

MS-1167<br />

MS-1168<br />

MS-1169<br />

MS-1170<br />

MS-1171<br />

MS-1174<br />

MS-1177<br />

MS-1182<br />

MS-1185<br />

MS-1190<br />

MS-1192<br />

MS-1201<br />

Product Description<br />

DP-1 Transcription Factor Ab-6, Mouse Monoclonal Antibody<br />

E2F-4 Transcription Factor Ab-4, Mouse Monoclonal Antibody<br />

Bromodeoxyuridine (BrdU) Ab-3, Mouse Monoclonal Antibody<br />

Cdk5 Ab-4, Mouse Monoclonal Antibody<br />

Cyclin E Ab-5, Mouse Monoclonal Antibody<br />

Cyclin A Ab-6, Mouse Monoclonal Antibody<br />

p57 Kip2 Ab-6, Mouse Monoclonal Antibody<br />

E2F-3 Transcription Factor Ab-4, Mouse Monoclonal Antibody<br />

Chorionic Gonadotropin, Human/hCG Ab-5, Mouse Monoclonal Antibody<br />

Thrombospondin (TSP) Ab-11, Mouse Monoclonal Antibody<br />

MAGE-1 Ab-4, Mouse Monoclonal Antibody<br />

Cytokeratin 15 Ab-1, Mouse Monoclonal Antibody<br />

Adenovirus Type 2 and 5 Ab-5, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu (Phosphopecific) Ab-18, Mouse Monoclonal Antibody<br />

CD2 (LFA-2) Ab-2, Mouse Monoclonal Antibody<br />

CD9/Motility-Related Protein-1 Ab-1, Mouse Monoclonal Antibody<br />

CD13/Aminopeptidase-N Ab-3, Mouse Monoclonal Antibody<br />

CD14 Ab-2, Mouse Monoclonal Antibody<br />

CD16/Fcγ Receptor III, Mouse Monoclonal Antibody<br />

CD21 Ab-2, Mouse Monoclonal Antibody<br />

CD22 Ab-4, Mouse Monoclonal Antibody<br />

CD25/IL-2Rα Ab-4, Mouse Monoclonal Antibody<br />

CD29 (Integrin β -1) Ab-3, Mouse Monoclonal Antibody<br />

CD54/ICAM-1 Ab-4, Mouse Monoclonal Antibody<br />

CD61 (GPIIIa) Ab-1, Mouse Monoclonal Antibody<br />

CD71/Transferrin Receptor Ab-3, Mouse Monoclonal Antibody<br />

CD95/Fas Ab-3, Mouse Monoclonal Antibody<br />

CD106/VCAM-1 Ab-3, Mouse Monoclonal Antibody<br />

CD141/Thrombomodulin Ab-1, Mouse Monoclonal Antibody<br />

CD163 Ab-1, Mouse Monoclonal Antibody<br />

ALK (Anaplastic Lymphoma Kinase)/p80 Ab-1, Mouse Monoclonal Antibody<br />

TdT/Terminal Deoxyribonucleotidyl Transferase Ab-1, Mouse Monoclonal Antibody<br />

Calretinin Ab-1, Mouse Monoclonal Antibody<br />

Fascin Ab-1, Mouse Monoclonal Antibody<br />

Myogenin Ab-1, Mouse Monoclonal Antibody<br />

Bcl-6 Ab-2, Mouse Monoclonal Antibody<br />

Cdh1 Ab-1, Mouse Monoclonal Antibody<br />

CD63 Ab-1, Mouse Monoclonal Antibody<br />

Ret Oncoprotein Ab-1, Mouse Monoclonal Antibody<br />

Caspase 3 (CPP32) Ab-1, Mouse Monoclonal Antibody<br />

Caspase 3 (CPP32) Ab-3, Mouse Monoclonal Antibody<br />

Caspase 6 (Mch 2) Ab-3, Mouse Monoclonal Antibody<br />

GnRH Receptor/LH-RH Receptor Ab-3, Mouse Monoclonal Antibody<br />

GRIP1 (Glucocorticoid Receptor Interacting Protein 1), Mouse Monoclonal Antibody<br />

Caspase 8 (FLICE) Ab-3, Mouse Monoclonal Antibody<br />

CD56/NCAM-1 Ab-4, Mouse Monoclonal Antibody<br />

Synaptophysin Ab-2, Mouse Monoclonal Antibody<br />

CA 125 (Ovarian Cancer Antigen) Ab-1, Mouse Monoclonal Antibody<br />

Mucin 6 (MUC-6) Ab-1, Mouse Monoclonal Antibody<br />

Granzyme B Ab-1, Mouse Monoclonal Antibody<br />

Lambda Light Chain Ab-4 (Cocktail), Mouse Monoclonal Antibody<br />

CD57 (Natural Killer Cell Marker) Ab-2, Mouse Monoclonal Antibody<br />

Amyloid A4/Amyloid β Ab-1, Mouse Monoclonal Antibody<br />

Calponin Ab-1, Mouse Monoclonal Antibody<br />

Caldesmon, HMW Ab-1, Mouse Monoclonal Antibody<br />

GCDFP-15 (Gross Cystic Disease Fluid Protein-15) Ab-1, Mouse Monoclonal Antibody<br />

CD79a/mb-1 (B-Cell Marker) Ab-2, Mouse Monoclonal Antibody<br />

CD42b (GPIb) Ab-1, Mouse Monoclonal Antibody<br />

Myosin, Smooth Muscle Heavy Chain Ab-1, Mouse Monoclonal Antibody<br />

Myogenin Ab-2, Mouse Monoclonal Antibody<br />

14.3.3σ Ab-1, Mouse Monoclonal Antibody<br />

SHP-1 Ab-1, Mouse Monoclonal Antibody<br />

Cytochrome c Ab-2, Mouse Monoclonal Antibody<br />

Survivin Ab-1, Mouse Monoclonal Antibody<br />

Clone<br />

1DP06; same as TFD10<br />

4E2F04; same as WUF10<br />

BRD.3<br />

DC17 + DC34<br />

13A3<br />

6E6<br />

57P06; same as KP10<br />

3E2F04; same as PF37<br />

CG04 + CG05<br />

D4.6 + A6.1 + MBC 200.1<br />

MA454<br />

LHK15<br />

M58 + M73<br />

PN2A<br />

AB75<br />

72F6<br />

38C12<br />

7<br />

2H7<br />

2G9<br />

FPC1<br />

4C9<br />

7F10<br />

23G12<br />

2f2<br />

10F11<br />

GM30<br />

1.4C3<br />

141C01; same as 1009<br />

10D6<br />

5A4<br />

SEN28<br />

5A5<br />

FCN01; same as 55K-2<br />

F5D<br />

BL6.02; same as PG-B6p<br />

DH01; same as DCS-266<br />

NKI/C-3; same as MX-49.129.5<br />

3F8<br />

3CSP01; same as 7.1.44<br />

3CSP03; same as 4.1.18<br />

6CSP03; same as 14.1 .190<br />

GNRH03; same as F1G4<br />

GRP01<br />

8CSP03; same as 4.1.20<br />

56C04; same as 123A8<br />

SYP02<br />

Ov185:1<br />

CLH5<br />

GZB01<br />

LAM03 + HP6054<br />

HNK-1; same as Leu-7<br />

BAM01; same as 6F/3D<br />

CALP<br />

h-CALD<br />

23A3<br />

JCB117<br />

42C01<br />

SMMS-1<br />

F12B<br />

1433S01<br />

1SH01; same as 11D7C8H5<br />

7H8.2C12<br />

8E2<br />

Page<br />

126<br />

127<br />

61<br />

97<br />

113<br />

108<br />

208<br />

127<br />

100<br />

235<br />

178<br />

117<br />

53<br />

158<br />

71<br />

74<br />

75<br />

75<br />

76<br />

77<br />

77<br />

78<br />

79<br />

85<br />

86<br />

87<br />

89<br />

90<br />

92<br />

93<br />

54<br />

234<br />

66<br />

139<br />

196<br />

60<br />

95<br />

86<br />

224<br />

67<br />

67<br />

68<br />

147<br />

148<br />

68<br />

85<br />

232<br />

62<br />

195<br />

148<br />

174<br />

86<br />

57<br />

65<br />

65<br />

144<br />

88<br />

82<br />

197<br />

196<br />

50<br />

228<br />

114<br />

230<br />

266<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

MS-1207<br />

MS-1209<br />

MS-1211<br />

MS-1216<br />

MS-1217<br />

MS-1218<br />

MS-1219<br />

MS-1226<br />

MS-1233<br />

MS-1236<br />

MS-1237<br />

MS-1248<br />

MS-1249<br />

MS-1251<br />

MS-1256<br />

MS-1259<br />

MS-1269<br />

MS-1270<br />

MS-1272<br />

MS-1273<br />

MS-1278<br />

MS-1288<br />

MS-1290<br />

MS-1291<br />

MS-1295<br />

MS-1296<br />

MS-1300<br />

MS-1302<br />

MS-1315<br />

MS-1320<br />

MS-1326<br />

MS-1328<br />

MS-1329<br />

MS-1330<br />

MS-1333<br />

MS-1334<br />

MS-1338<br />

MS-1339<br />

MS-1348<br />

MS-1350<br />

MS-1351<br />

MS-1352<br />

MS-1356<br />

MS-1362<br />

MS-1367<br />

MS-1372<br />

MS-1376<br />

MS-1377<br />

MS-1378<br />

MS-1379<br />

MS-1380<br />

MS-1381<br />

MS-1385<br />

MS-1393<br />

MS-1402<br />

MS-1427<br />

MS-1431<br />

MS-1440<br />

MS-1447<br />

MS-1448<br />

MS-1449<br />

MS-1453<br />

MS-1457<br />

MS-1458<br />

Product Description<br />

SREBP-1 (Sterol Regulatory Element Binding Protein-1) Ab-1, Mouse Monoclonal Antibody<br />

Vinculin Ab-1, Mouse Monoclonal Antibody<br />

Filamin Ab-1, Mouse Monoclonal Antibody<br />

Mast Cell Tryptase Ab-2, Mouse Monoclonal Antibody<br />

Mast Cell Chymase Ab-1, Mouse Monoclonal Antibody<br />

MHC I (HLA-A, B, C) Ab-3, Mouse Monoclonal Antibody<br />

Amyloid A Component Ab-1, Mouse Monoclonal Antibody<br />

Tubulin-β Ab-6, Mouse Monoclonal Antibody<br />

Rhodopsin (Opsin) Ab-1, Mouse Monoclonal Antibody<br />

Myosin, Skeletal Muscle Ab-2, Mouse Monoclonal Antibody<br />

Factor XIII A Ab-1, Mouse Monoclonal Antibody<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-3, Mouse Monoclonal Antibody<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) Ab-4, Mouse Monoclonal Antibody<br />

Caldesmon, LMW Ab-2, Mouse Monoclonal Antibody<br />

Tropomyosin Ab-1, Mouse Monoclonal Antibody<br />

CD15 Ab-3, Mouse Monoclonal Antibody<br />

ADP-Ribosylation Factor (ARF) 6 Ab-1, Mouse Monoclonal Antibody<br />

Parathyroid Hormone Receptor (PTH-Receptor) Type 1 Ab-1, Mouse Monoclonal Antibody<br />

Glutamyl Transferase, γ Ab-1, Mouse Monoclonal Antibody<br />

Cytochrome c Ab-3, Mouse Monoclonal Antibody<br />

CD24 (GPI-Linked Surface Mucin) Ab-1, Mouse Monoclonal Antibody<br />

GFP (Green Fluorescent Protein) Ab-1, Mouse Monoclonal Antibody<br />

CD105/Endoglin/TGF-β 1/3 Receptor Ab-3, Mouse Monoclonal Antibody<br />

Clathrin, Light Chain Ab-1, Mouse Monoclonal Antibody<br />

Actin, pan Ab-5, Mouse Monoclonal Antibody<br />

Actin, Muscle Specific Ab-6, Mouse Monoclonal Antibody<br />

Surfactant Protein B (Mature) Ab-2, Mouse Monoclonal Antibody<br />

CD47 Ab-2, Mouse Monoclonal Antibody<br />

GFP (Green Fluorescent Protein) Ab-2, Mouse Monoclonal Antibody<br />

Mesothelin Ab-1, Mouse Monoclonal Antibody<br />

Plastin-L Ab-1, Mouse Monoclonal Antibody<br />

Growth Hormone, Human/hGH Ab-3, Mouse Monoclonal Antibody<br />

β -Galactosidase Ab-1, Mouse Monoclonal Antibody<br />

Chk2 Ab-1, Mouse Monoclonal Antibody<br />

PR3 (Proteinase 3) Ab-1, Mouse Monoclonal Antibody<br />

Bcl-XL Ab-2, Mouse Monoclonal Antibody<br />

Prolactin Receptor Ab-1, Mouse Monoclonal Antibody<br />

Notch-1 Ab-1, Mouse Monoclonal Antibody<br />

Myosin, Smooth Muscle Heavy Chain Ab-3, Mouse Monoclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-20, Mouse Monoclonal Antibody<br />

Fibronectin Ab-11, Mouse Monoclonal Antibody<br />

Cytokeratin 7 Ab-2, Mouse Monoclonal Antibody<br />

Laminin B2/γ 1 Ab-2, Mouse Monoclonal Antibody<br />

Prolactin Ab-2, Mouse Monoclonal Antibody<br />

Secretory Component Ab-2, Mouse Monoclonal Antibody<br />

Mitochondria Ab-2, Mouse Monoclonal Antibody<br />

GFAP (Glial Fibrillary Acidic Protein), Mouse Monoclonal Antibody<br />

Insulin Ab-4, Mouse Monoclonal Antibody<br />

Insulin Ab-5, Mouse Monoclonal Antibody<br />

Insulin Ab-6 (INS0 4 + INS0 5 ), Mouse Monoclonal Antibody<br />

Thyroglobulin Ab-6, Mouse Monoclonal Antibody<br />

XPF Ab-1, Mouse Monoclonal Antibody<br />

XPF Ab-5, Mouse Monoclonal Antibody<br />

XRCC1 (X-Ray Repair Cross Complementing Protein 1) Ab-3, Mouse Monoclonal Antibody<br />

DNA Polymerase, β Ab-2, Mouse Monoclonal Antibody<br />

Pneumocystis jiroveci (P. Carinii) Ab-1, Mouse Monoclonal Antibody<br />

Serotonin Ab-1, Mouse Monoclonal Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin, High Molecular Weight Ab-3, Mouse Monoclonal Antibody<br />

LH (Luteinizing Hormone) Ab-1, Mouse Monoclonal Antibody<br />

Follicle Stimulating Hormone (FSH) Ab-3, Mouse Monoclonal Antibody<br />

Thyroid Stimulating Hormone (TSH) Ab-3, Mouse Monoclonal Antibody<br />

Grb2/sem5/ASH Signaling Protein Ab-4, Mouse Monoclonal Antibody<br />

Epstein-Barr Virus/LMP Ab-1, Mouse Monoclonal Antibody<br />

Clone<br />

2A4<br />

VLN01<br />

FLMN01; same as PM6/317<br />

AA1<br />

CC1<br />

W6/32<br />

mcl<br />

TBN06; same as Tub 2.5<br />

RET-P1<br />

MYSN02; same as MY-32<br />

AC-1A1<br />

L12B4<br />

M3A7<br />

l-CALD<br />

CH1<br />

MMA; same as LeuM1<br />

6ARF01<br />

3D1.1<br />

138H11<br />

CTC03; same as 2B5<br />

SN3<br />

GFP01; same as B34<br />

SN6h<br />

CON.1<br />

ACTN05; same as C4<br />

MSA06; same as HUC1-1<br />

SPB02; same as 1B9<br />

B6H12.2<br />

GFP02; same as C163<br />

5B2<br />

LPL4A.1<br />

GH01 / #2 + GH02 / #7<br />

BGAL01<br />

2CHK01; same as DCS-293<br />

MCPR3-2<br />

7D9<br />

B6.2<br />

A6<br />

SM-M10<br />

L87 + 2ERB19<br />

FBN11<br />

OV-TL 12/30<br />

D18<br />

PRL02<br />

COMPO2; same as SC-05<br />

MTC02<br />

ASTRO6<br />

INS04; same as E2-E3<br />

INS05; same as 2D11-H5<br />

INS04 + INS05<br />

TGB04 (2H11 ) + TGB05 (6E1)<br />

219<br />

51<br />

144<br />

61<br />

3F6<br />

5HT-H209<br />

VU-1D9<br />

34BetaE12<br />

LH01<br />

FSH03<br />

TSH01+ TSH02<br />

2GB04; same as C1.4<br />

CS1 + CS2 + CS3 + CS4<br />

Page<br />

229<br />

248<br />

141<br />

182<br />

182<br />

185<br />

56<br />

244<br />

225<br />

197<br />

138<br />

113<br />

113<br />

65<br />

242<br />

75<br />

53<br />

211<br />

147<br />

114<br />

78<br />

145<br />

90<br />

102<br />

51<br />

51<br />

229<br />

84<br />

146<br />

184<br />

216<br />

149<br />

143<br />

100<br />

217<br />

60<br />

220<br />

201<br />

197<br />

158<br />

140<br />

115<br />

176<br />

220<br />

227<br />

187<br />

145<br />

168<br />

169<br />

169<br />

236<br />

249<br />

249<br />

250<br />

125<br />

216<br />

228<br />

132<br />

120<br />

177<br />

142<br />

237<br />

148<br />

133<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

267


Cat. No.<br />

MS-1467<br />

MS-1468<br />

MS-1485<br />

MS-1494<br />

MS-1498<br />

MS-1499<br />

MS-1502<br />

MS-1504<br />

MS-1508<br />

MS-1511<br />

MS-1528<br />

MS-1534<br />

MS-1564<br />

MS-1572<br />

MS-1601<br />

MS-1603<br />

MS-1633<br />

MS-1634<br />

MS-1653<br />

MS-1671<br />

MS-1726<br />

MS-1728<br />

MS-1729<br />

MS-1734<br />

MS-1750<br />

MS-1751<br />

MS-1756<br />

MS-1760<br />

MS-1762<br />

MS-1763<br />

MS-1767<br />

MS-1768<br />

MS-1793<br />

MS-1808<br />

MS-1810<br />

MS-1811<br />

MS-1812<br />

MS-1814<br />

MS-1819<br />

MS-1825<br />

MS-1826<br />

MS-1832<br />

MS-1833<br />

MS-1834<br />

MS-1835<br />

MS-1836<br />

MS-1837<br />

MS-1843<br />

MS-1846<br />

MS-1848<br />

MS-1849<br />

MS-1854<br />

MS-1856<br />

MS-1857<br />

MS-1859<br />

MS-1863<br />

MS-1873<br />

MS-1874<br />

MS-1880<br />

MS-1882<br />

MS-1883<br />

MS-1888<br />

MS-1896<br />

MS-1898<br />

Product Description<br />

Vascular Endothelial Growth Factor (VEGF) Ab-7, Mouse Monoclonal Antibody<br />

CD27 Ab-2, Mouse Monoclonal Antibody<br />

TIMP-2 Ab-5, Mouse Monoclonal Antibody<br />

Mesothelioma Ab-1, Mouse Monoclonal Antibody<br />

MSH2 (Mismatch Repair Protein 2) Ab-1, Mouse Monoclonal Antibody<br />

Villin Ab-1, Mouse Monoclonal Antibody<br />

14.3.3γ Ab-2, Mouse Monoclonal Antibody<br />

14.3.3 pan Ab-4, Mouse Monoclonal Antibody<br />

IGF-I Ab-1, Mouse Monoclonal Antibody<br />

Pds1 Ab-1, Mouse Monoclonal Antibody<br />

CD4 Ab-8, Mouse Monoclonal Antibody<br />

Exo1 Ab-4, Mouse Monoclonal Antibody<br />

Tid-1 Ab-2, Mouse Monoclonal Antibody<br />

Synuclein Ab-2, Mouse Monoclonal Antibody<br />

PTEN/MMAC1 Ab-4, Mouse Monoclonal Antibody<br />

Cytokeratin 8/18 Ab-2, Mouse Monoclonal Antibody<br />

CD99/MIC2 (Ewing s Sarcoma Marker) Ab-2, Mouse Monoclonal Antibody<br />

Tyrosinase Related Protein 75 (TRP75/gp75) Ab-1, Mouse Monoclonal Antibody<br />

Human Sodium Iodide Symporter (hNIS) Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 19 Ab-4, Mouse Monoclonal Antibody<br />

MCM2 Ab-1, Mouse Monoclonal Antibody<br />

c-myb/v-myb Ab-1, Mouse Monoclonal Antibody<br />

Mucin 2 (MUC2) Ab-3, Mouse Monoclonal Antibody<br />

Mucin 3 (MUC3) Ab-2, Mouse Monoclonal Antibody<br />

Excitatory Amino Acid Transporter 2 Ab-1, Mouse Monoclonal Antibody<br />

Emerin Ab-1, Mouse Monoclonal Antibody<br />

Galectin-3 Ab-1, Mouse Monoclonal Antibody<br />

Protein Gene Product 9.5 (PGP9.5) Ab-1, Mouse Monoclonal Antibody<br />

Ets-1 Ab-1, Mouse Monoclonal Antibody<br />

Catenin, β Ab-3, Mouse Monoclonal Antibody<br />

Maspin Ab-1, Mouse Monoclonal Antibody<br />

Tartrate Resistant Acid Phosphatase (TRAP) Ab-1, Mouse Monoclonal Antibody<br />

CD138 Ab-2, Mouse Monoclonal Antibody<br />

CD68/Macrophage Marker Ab-4, Mouse Monoclonal Antibody<br />

Hepatocyte Ab-1, Mouse Monoclonal Antibody<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker) Ab-3, Mouse Monoclonal Antibody<br />

CA 125 Ab-2, Mouse Monoclonal Antibody<br />

Cytokeratin 5/6 Ab-2, Mouse Monoclonal Antibody<br />

Topoisomerase II α Ab-4, Mouse Monoclonal Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-7, Mouse Monoclonal Antibody<br />

Human Papilloma Virus (HPV) Ab-3, Mouse Monoclonal Antibody<br />

SV40 Large T Antigen Ab-1, Mouse Monoclonal Antibody<br />

SV40 Large T Antigen Ab-2, Mouse Monoclonal Antibody<br />

Perforin Ab-2, Mouse Monoclonal Antibody<br />

Cathepsin G Ab-1, Mouse Monoclonal Antibody<br />

MAGE-1 Ab-6, Mouse Monoclonal Antibody<br />

Wilm's Tumor Protein (WT1) Ab-5, Mouse Monoclonal Antibody<br />

Glycophorin A Ab-4, Mouse Monoclonal Antibody<br />

CD45RB Ab-3, Mouse Monoclonal Antibody<br />

Bromodeoxyuridine (BrdU) Ab-4, Mouse Monoclonal Antibody<br />

Nucleophosmin (NPM) Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 20 Ab-6, Mouse Monoclonal Antibody<br />

CD1a Ab-5, Mouse Monoclonal Antibody<br />

CD30 (Reedternberg Cell Marker) Ab-4, Mouse Monoclonal Antibody<br />

Calretinin Ab-2, Mouse Monoclonal Antibody<br />

Inhibin, α Ab-1, Mouse Monoclonal Antibody<br />

CD31/PECAM-1 (Endothelial Cell Marker) Ab-6, Mouse Monoclonal Antibody<br />

Dysferlin Ab-1, Mouse Monoclonal Antibody<br />

CD3ε; (Early T-Cell Marker) Ab-9, Mouse Monoclonal Antibody<br />

Progesterone Receptor Ab-14, Mouse Monoclonal Antibody<br />

Retinoblastoma (Rb) (Phosphopecific Serine) Ab-7, Mouse Monoclonal Antibody<br />

CDC7 Kinase Ab-1, Mouse Monoclonal Antibody<br />

Cytokeratin 5 Ab-1, Mouse Monoclonal Antibody<br />

Epithelial Specific Antigen/Ep-CAM Ab-9, Mouse Monoclonal Antibody<br />

Clone<br />

VG1<br />

137B4<br />

3A4<br />

HBME-1<br />

25D12<br />

CWWB1<br />

CG31<br />

CG15<br />

M23<br />

DCS-280<br />

4B12<br />

266<br />

RS13<br />

syn211<br />

17.A<br />

K8.8 + DC10<br />

O13<br />

TA99<br />

FP5A<br />

BA17<br />

CRCT2.1<br />

4E3<br />

996/1<br />

1143/B7<br />

1H8<br />

4G5<br />

9C4<br />

10A1<br />

1G11<br />

17C2<br />

EAW24<br />

26E5<br />

MI15<br />

PG-M1<br />

OCH1E5<br />

116-NS-19-9<br />

M11<br />

D5/16 B4<br />

Ki1<br />

MOC-31<br />

K1H8<br />

PAb101; same as clone 412<br />

PAb108<br />

5B10<br />

19C3<br />

6C1<br />

6F-H2<br />

JC159<br />

PD7/26<br />

Bu20a<br />

NA24<br />

Q6<br />

O10<br />

HRS4<br />

DAK Calret 1<br />

R1<br />

1A10<br />

Ham1/7B6<br />

F7.2.38<br />

PgR636<br />

51B7<br />

DCS-341<br />

XM26<br />

Ber-EP4<br />

Page<br />

246<br />

79<br />

238<br />

184<br />

193<br />

247<br />

50<br />

50<br />

167<br />

214<br />

73<br />

137<br />

237<br />

232<br />

222<br />

116<br />

89<br />

244<br />

165<br />

119<br />

182<br />

103<br />

194<br />

194<br />

137<br />

128<br />

143<br />

222<br />

136<br />

69<br />

181<br />

233<br />

92<br />

87<br />

154<br />

62<br />

63<br />

115<br />

239<br />

132<br />

164<br />

230<br />

231<br />

214<br />

70<br />

178<br />

249<br />

147<br />

84<br />

61<br />

201<br />

120<br />

70<br />

80<br />

67<br />

168<br />

80<br />

126<br />

72<br />

219<br />

225<br />

93<br />

114<br />

133<br />

268<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

MS-1902<br />

MS-1911<br />

MS-1914<br />

MS-1915<br />

MS-1919<br />

MS-1933<br />

MS-2211<br />

MS-9078<br />

MS-9080<br />

MS-9083<br />

MS-9085<br />

MS-9086<br />

MS-9470<br />

MS-10340<br />

MS-10637<br />

MS-11641<br />

MV-2001<br />

MV-2002<br />

MV-2003<br />

MV-2004<br />

MV-2005<br />

MV-2006<br />

MV-2007<br />

MV-2008<br />

NC-100<br />

NC-748<br />

NC-1390<br />

NC-1391<br />

RB-008<br />

RB-009<br />

RB-010<br />

RB-012<br />

RB-028<br />

RB-032<br />

RB-038<br />

RB-044<br />

RB-045<br />

RB-050<br />

RB-059<br />

RB-060<br />

RB-067<br />

RB-069<br />

RB-082<br />

RB-087<br />

RB-103<br />

RB-117<br />

RB-118<br />

RB-119<br />

RB-212<br />

RB-222<br />

RB-257<br />

RB-258<br />

RB-276<br />

RB-281<br />

RB-282<br />

RB-284<br />

RB-333<br />

RB-334<br />

RB-360<br />

RB-365<br />

RB-367<br />

RB-368<br />

RB-372<br />

Product Description<br />

Cytokeratin 19 Ab-5, Mouse Monoclonal Antibody<br />

ZAP-70 Ab-1, Mouse Monoclonal Antibody<br />

Thyroid Cancer Marker, Mouse Monoclonal Antibody<br />

CD30 (Reedternberg Cell Marker), Mouse Monoclonal Antibody<br />

Mammaglobin, Mouse Monoclonal Antibody<br />

DOG1, Mouse Monoclonal Antibody<br />

Cyclin D2 Ab-4, Mouse Monoclonal Antibody<br />

LH (Luteinizing Hormone), Mouse Monoclonal Antibody<br />

Chorionic Gonadotropin, Human/hCG, Mouse Monoclonal Antibody<br />

Prolactin, Mouse Monoclonal Antibody<br />

CA19-9/Sialyl Lewis a (GI Tumor Marker), Mouse Monoclonal Antibody<br />

CA 125 (Ovarian Cancer Antigen), Mouse Monoclonal Antibody<br />

Cadherin E, Mouse Monoclonal Antibody<br />

MUC-1, Mouse Monoclonal Antibody<br />

GLUT-1, Mouse Monoclonal Antibody<br />

HIF-1α (Hypoxia-Inducible Factor-1α) Ab-4, Mouse Monoclonal Antibody<br />

CD4/CD8, MultiVision Antibody Cocktail<br />

CD3/CD20, MultiVision Antibody Cocktail<br />

Kappa/Lambda, MultiVision Antibody Cocktail<br />

Vimentin/gp100, MultiVision Antibody Cocktail<br />

CD3ε;/Ki-67, MultiVision Antibody Cocktail<br />

CD20/Ki-67, MultiVision Antibody Cocktail<br />

GFAP/Ki-67, MultiVision Antibody Cocktail<br />

Alk/CD30, MultiVision Antibody Cocktail<br />

Negative Control for Rabbit IgG Ab-1, Rabbit Polyclonal Antibody<br />

Negative Control for Mouse IgG1 Ab-1, Mouse Monoclonal Antibody<br />

Negative Control for Mouse IgG2a Ab-1, Mouse Monoclonal Antibody<br />

Negative Control for Mouse IgG2b Ab-1, Mouse Monoclonal Antibody<br />

Cyclin B1 Ab-2, Rabbit Polyclonal Antibody<br />

Cyclin C Ab-1, Rabbit Polyclonal Antibody<br />

Cyclin D1/Bcl-1 Ab-3, Rabbit Polyclonal Antibody<br />

Cyclin E Ab-1, Rabbit Polyclonal Antibody<br />

p15 INK4b Ab-3, Rabbit Polyclonal Antibody<br />

p21 WAF1 (Anti-Mouse) Ab-9, Rabbit Polyclonal Antibody<br />

Somatostatin Ab-1, Rabbit Polyclonal Antibody<br />

S100 Protein Ab-2, Rabbit Polyclonal Antibody<br />

p14 ARF /p16β Ab-1, Rabbit Polyclonal Antibody<br />

GST, Π Ab-1, Rabbit Polyclonal Antibody<br />

Chorionic Gonadotropin, Human/hCG Ab-2, Rabbit Polyclonal Antibody<br />

Transglutaminase II Ab-4, Rabbit Polyclonal Antibody<br />

APC2 (Anaphase-Promoting Complex) Ab-1, Rabbit Polyclonal Antibody<br />

ROC1 Ab-1, Rabbit Polyclonal Antibody<br />

Laminin Ab-1, Rabbit Polyclonal Antibody<br />

GFAP (Glial Fibrillary Acidic Protein), Rabbit Polyclonal Antibody<br />

HER-2/c-erbB-2/neu Ab-1, Rabbit Polyclonal Antibody<br />

Topoisomerase II α Ab-1, Rabbit Polyclonal Antibody<br />

Heat Shock Protein 90β /hsp90β (HSP84) Ab-1, Rabbit Polyclonal Antibody<br />

Heat Shock Protein 90α /hsp90α (HSP86) Ab-1, Rabbit Polyclonal Antibody<br />

Cyclin D1/Bcl-1 Ab-4, Rabbit Polyclonal Antibody<br />

Vascular Endothelial Growth Factor (VEGF) Ab-1, Rabbit Polyclonal Antibody<br />

Amphiregulin Ab-1, Rabbit Polyclonal Antibody<br />

Amphiregulin Ab-1, Rabbit Polyclonal Antibody<br />

Heregulin/NDF/GGF/Neuregulin Ab-2, Rabbit Polyclonal Antibody<br />

Factor VIII Related Antigen/von Willebrand Factor Ab-1, Rabbit Polyclonal Antibody<br />

Toxoplasma gondii Ab-1, Rabbit Polyclonal Antibody<br />

HER-4/c-erbB-4 Ab-2, Rabbit Polyclonal Antibody<br />

Kappa Light Chain Ab-2, Rabbit Polyclonal Antibody<br />

Lambda Light Chain, Rabbit Polyclonal Antibody<br />

CD3ε; (Early T-Cell Marker) Ab-1, Rabbit Polyclonal Antibody<br />

α-Fetoprotein (AFP) Ab-2, Rabbit Polyclonal Antibody<br />

α -1-Antitrypsin Ab-1, Rabbit Polyclonal Antibody<br />

CEA (Carcinoembryonic Antigen)/CD66e Ab-2, Rabbit Polyclonal Antibody<br />

Lysozyme/Muramidase Ab-1, Rabbit Polyclonal Antibody<br />

Clone<br />

RCK108<br />

2F3.2<br />

373E1<br />

CON6D/ C2<br />

304-1A5<br />

1.1<br />

DCS-3.1 + DCS-5.2<br />

SPM103<br />

SPM105<br />

SPM108<br />

SPM110<br />

SPM111<br />

SPM471<br />

SPM492<br />

SPM498<br />

H1alpha67<br />

CD4 4B12, CD8 SP16<br />

CD3 SP7; CD20 L26<br />

Kappa L1C1, Lambda N/A<br />

Vimentin SP20, gp100 HMB45<br />

CD3&epsi;/Ki-67<br />

CD20/Ki-67<br />

GFAP/Ki-67<br />

Alk/CD30<br />

Polyclonal<br />

NCG01<br />

NCG2A.01<br />

NCG2B.01<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Page<br />

119<br />

250<br />

237<br />

79<br />

179<br />

125<br />

111<br />

176<br />

100<br />

220<br />

62<br />

63<br />

64<br />

193<br />

147<br />

163<br />

73<br />

72<br />

172<br />

247<br />

72<br />

76<br />

145<br />

55<br />

198<br />

198<br />

198<br />

198<br />

108<br />

109<br />

110<br />

112<br />

202<br />

203<br />

229<br />

227<br />

202<br />

149<br />

100<br />

242<br />

58<br />

225<br />

175<br />

145<br />

155<br />

238<br />

153<br />

153<br />

110<br />

246<br />

56<br />

56<br />

163<br />

138<br />

239<br />

161<br />

171<br />

174<br />

71<br />

55<br />

56<br />

99<br />

177<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

269


Cat. No.<br />

RB-373<br />

RB-477<br />

RB-1197<br />

RB-1205<br />

RB-1358<br />

RB-1413<br />

RB-1422<br />

RB-1426<br />

RB-1429<br />

RB-1432<br />

RB-1433<br />

RB-1434<br />

RB-1435<br />

RB-1436<br />

RB-1438<br />

RB-1459<br />

RB-1460<br />

RB-1461<br />

RB-1464<br />

RB-1491<br />

RB-1492<br />

RB-1493<br />

RB-1510<br />

RB-1516<br />

RB-1518<br />

RB-1519<br />

RB-1520<br />

RB-1521<br />

RB-1524<br />

RB-1526<br />

RB-1527<br />

RB-1536<br />

RB-1537<br />

RB-1539<br />

RB-1548<br />

RB-1605<br />

RB-1615<br />

RB-1629<br />

RB-1637<br />

RB-1638<br />

RB-1660<br />

RB-1662<br />

RB-1680<br />

RB-1681<br />

RB-1691<br />

RB-1692<br />

RB-1697<br />

RB-1804<br />

RB-1805<br />

RB-1875<br />

RB-1922<br />

RB-1924<br />

RB-1925<br />

RB-1926<br />

RB-1927<br />

RB-1929<br />

RB-1930<br />

RB-9002<br />

RB-9003<br />

RB-9009<br />

RB-9010<br />

RB-9013<br />

RB-9014<br />

RB-9017<br />

Product Description<br />

Clone<br />

Myeloperoxidase (MPO), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

FAK (Focal Adhesion Kinase) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Caspase 3 (CPP32) Ab-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Caspase 9/LAP6 Ab-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Androgen Receptor Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Hepatitis B Virus Core Antigen (HBVcAg) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Glucagon Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Herpes Simplex Virus Type 2 (HSV II) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Tau Ab-3, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgG (γ -Heavy Chain) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgA (α -Heavy Chain) Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgM (μ-Heavy Chain) Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgE (ε; -Heavy Chain), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgD (δ -Heavy Chain) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

HA (Hemagglutinin) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Gastrin Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Myelin Basic Protein Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Synaptophysin Ab-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Factor XIII A Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Catenin, β Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Progesterone Receptor Ab-13, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Estrogen Receptor Ab-16, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Ki-67 Ab-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PARP (Poly ADP-Ribose Polymerase) Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD117/c-Kit/SCF-Receptor Ab-6, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Calcitonin Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Bak Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Estrogen Receptor Ab-17, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cadherin, Pan Ab-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Flk-1/KDR/VEGFR2 Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Flt-1/VEGFR1 Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-1 (Collagenase-1) Ab-6, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-2 (72kDa Collagenase IV) Ab-7, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-9 (92kDa Collagenase IV) Ab-9, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cyclin A Ab-7, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Nitric Oxide Synthase, inducible (iNOS) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CXCR4/Fusin/LESTR/HUMSTR Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Survivin Ab-6, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

p57 Kip2 Ab-7, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

NFκ B/p65 (Rel A) Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

TACE (TNF-α converting enzyme)/ADAM17 Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MEK-1 Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PARP (Poly ADP-Ribose Polymerase) Ab-3, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-13 (Collagenase-3) Ab-5, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PDGFRα Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PDGFRβ Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

γ Glutamylcysteine Synthetase (GCS)/Glutamate-cysteine Ligase Ab-1, Rabbit Polyclonal AntibodyPolyclonal<br />

S100 A4 Ab-8, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

S100 A6 Ab-9, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Helicobacter pylori Ab-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

IgM, FITC Labeled Antibody<br />

Polyclonal<br />

Fibrinogen, FITC Labeled Antibody<br />

Polyclonal<br />

Albumin, FITC Labeled Antibody<br />

Polyclonal<br />

C1q Complement, FITC Labeled Antibody<br />

Polyclonal<br />

C4 Complement, FITC Labeled Antibody<br />

Polyclonal<br />

Kappa Light Chain, FITC Labeled Antibody<br />

Polyclonal<br />

Lambda, FITC Labeled Antibody<br />

Polyclonal<br />

Calretinin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Chromogranin A, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD8, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Actin, Smooth Muscle, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD20, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Desmin (Muscle Cell Marker), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Progesterone Receptor, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Page<br />

195<br />

139<br />

68<br />

69<br />

57<br />

154<br />

146<br />

163<br />

234<br />

167<br />

165<br />

168<br />

166<br />

165<br />

150<br />

144<br />

195<br />

232<br />

138<br />

70<br />

219<br />

135<br />

172<br />

211<br />

91<br />

65<br />

58<br />

136<br />

64<br />

141<br />

142<br />

187<br />

188<br />

190<br />

108<br />

200<br />

107<br />

230<br />

208<br />

200<br />

233<br />

183<br />

211<br />

192<br />

214<br />

214<br />

143<br />

226<br />

227<br />

153<br />

168<br />

140<br />

54<br />

61<br />

62<br />

171<br />

175<br />

66<br />

101<br />

74<br />

52<br />

76<br />

122<br />

217<br />

270<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Cat. No.<br />

RB-9018<br />

RB-9020<br />

RB-9021<br />

RB-9023<br />

RB-9024<br />

RB-9026<br />

RB-9027<br />

RB-9029<br />

RB-9030<br />

RB-9031<br />

RB-9034<br />

RB-9035<br />

RB-9036<br />

RB-9038<br />

RB-9040<br />

RB-9041<br />

RB-9042<br />

RB-9043<br />

RB-9045<br />

RB-9052<br />

RB-9055<br />

RB-9064<br />

RB-9067<br />

RB-9068<br />

RB-9070<br />

RB-9072<br />

RB-9097<br />

RB-9202<br />

RB-9203<br />

RB-9209<br />

RB-9211<br />

RB-9217<br />

RB-9218<br />

RB-9219<br />

RB-9222<br />

RB-9234<br />

RB-9242<br />

RB-9245<br />

RB-9249<br />

RB-9251<br />

RB-9255<br />

RB-9266<br />

RB-9267<br />

RB-9276<br />

RB-9279<br />

RB-9281<br />

RB-9291<br />

RB-9295<br />

RB-9297<br />

RB-9406<br />

RB-9411<br />

RB-9421<br />

RB-9422<br />

RB-9423<br />

RB-10333<br />

RB-10642<br />

RB-10687<br />

RB-15450<br />

RM-2100<br />

RM-2101<br />

RM-2102<br />

RM-2103<br />

RM-2104<br />

RM-2106<br />

Product Description<br />

Clone<br />

S100, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cytokeratin 14, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cytokeratin 19, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Amyloid Precursor Protein (APP), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Dystrophin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Synuclein α, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PDGFRα, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Fas Ligand, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Androgen Receptor, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Vascular Endothelial Growth Factor (VEGF), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

NFκ B/p65 (Rel A), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Catenin, β, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cadherin, Pan, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD117/c-Kit/SCF-Receptor, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

HER-2/c-erbB-2/neu, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cyclin D1/Bcl-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

D4-GDI, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Ki-67, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

HER-4/c-erbB-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

GLUT-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

PCNA (Proliferating Cell Nuclear Antigen), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

α-Fetoprotein (AFP), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Placental Lactogen (hPL), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Myoglobin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Helicobacter pylori, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

COX2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Osteopontin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Protein Gene Product 9.5 (PGP9.5), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Ubiquitin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Claudin 1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

HER-3/c-erbB-3, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Adrenocorticotrophic Hormone (ACTH), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MDM2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CITED1 (CBP/p300-interacting transactivator 1)/Melanocytepecific protein 1, Rabbit Polyclonal Polyclonal<br />

Antibody<br />

MUC-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-9 (92kDa Collagenase IV), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Nitric Oxide Synthase, inducible (iNOS), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Survivin, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Tubulin-β, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Claudin 3, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Flt-4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Claudin 4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Wilm s Tumor Protein (WT1), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

APC (Adenomateous Polyposis Coli), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Nitric Oxide Synthase, endothelial (eNOS), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Tubulin-α, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD105/Endoglin/TGF β 1/3 Receptor, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Fli-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Oct-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Pax-5, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

S100 A4, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Actin β, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD138, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Toxoplasma gondii, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody<br />

Polyclonal<br />

GRP94, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

COX-1, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

MMP-14/MT1-MMP Ab-2, Rabbit Polyclonal Antibody<br />

Polyclonal<br />

Cadherin E, Rabbit Monoclonal Antibody<br />

EP700Y<br />

Catenin, β, Rabbit Monoclonal Antibody<br />

E247<br />

Calponin-1, Rabbit Monoclonal Antibody<br />

EP798Y<br />

p53, Rabbit Monoclonal Antibody<br />

Y5<br />

Prostate Specific Antigen (PSA), Rabbit Monoclonal Antibody<br />

EP1588Y<br />

Cytokeratin 5, Rabbit Monoclonal Antibody<br />

EP1601Y<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

Page<br />

226<br />

117<br />

118<br />

57<br />

126<br />

232<br />

213<br />

139<br />

58<br />

245<br />

199<br />

69<br />

64<br />

91<br />

155<br />

111<br />

122<br />

172<br />

161<br />

146<br />

213<br />

55<br />

215<br />

197<br />

153<br />

107<br />

202<br />

221<br />

245<br />

102<br />

159<br />

54<br />

183<br />

102<br />

193<br />

189<br />

200<br />

230<br />

244<br />

103<br />

142<br />

103<br />

248<br />

58<br />

200<br />

243<br />

90<br />

141<br />

201<br />

212<br />

226<br />

51<br />

92<br />

239<br />

81<br />

149<br />

107<br />

192<br />

63<br />

69<br />

66<br />

205<br />

221<br />

114<br />

271


Cat. No.<br />

RM-2107<br />

RM-2108<br />

RM-2109<br />

RM-2111<br />

RM-2112<br />

RM-2113<br />

RM-2114<br />

RM-2116<br />

RM-9101<br />

RM-9102<br />

RM-9103<br />

RM-9104<br />

RM-9105<br />

RM-9106<br />

RM-9107<br />

RM-9108<br />

RM-9111<br />

RM-9112<br />

RM-9113<br />

RM-9115<br />

RM-9116<br />

RM-9117<br />

RM-9118<br />

RM-9119<br />

RM-9120<br />

RM-9121<br />

RM-9123<br />

RM-9128<br />

RM-9130<br />

RM-9131<br />

RM-9132<br />

RM-9133<br />

RP-3170<br />

RP-3180<br />

RP-9326<br />

RT-102<br />

RT-405<br />

RT-601<br />

RT-629<br />

RT-794<br />

RT-795<br />

RT-1732<br />

RT-1912<br />

RT-2001<br />

RT-7961<br />

RT-16410<br />

SH-1920<br />

SH-1921<br />

SH-1923<br />

Product Description<br />

Cytokeratin 8, Rabbit Monoclonal Antibody<br />

Cytokeratin 18, Rabbit Monoclonal Antibody<br />

CD3ε;, Rabbit Monoclonal Antibody<br />

Epidermal Growth Factor Receptor (EGFR), Rabbit Monoclonal Antibody<br />

HER-2/c-erbB-2/neu, Rabbit Monoclonal Antibody<br />

Cyclin D1, Rabbit Monoclonal Antibody<br />

anti-Progesterone Receptor, Rabbit Monoclonal Antibody<br />

CDX2, Rabbit Monoclonal Antibody<br />

Estrogen Receptor (SP1), Rabbit Monoclonal Antibody<br />

Progesterone Receptor, Rabbit Monoclonal Antibody<br />

HER-2/c-erB-2/neu, Rabbit Monoclonal Antibody<br />

Cyclin D1/Bcl-1, Rabbit Monoclonal Antibody<br />

p53, Rabbit Monoclonal Antibody<br />

Ki-67, Rabbit Monoclonal Antibody<br />

CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody<br />

ALK (Anaplastic Lymphoma Kinase)/p80, Rabbit Monoclonal Antibody<br />

Synaptophysin (Neuroendocrine Marker), Rabbit Monoclonal Antibody<br />

Chromogranin A, Rabbit Monoclonal Antibody<br />

Calretinin, Rabbit Monoclonal Antibody<br />

Placental Alk. Phosphatase (PLAP), Rabbit Monoclonal Antibody<br />

CD8, Rabbit Monoclonal Antibody<br />

Calcitonin, Rabbit Monoclonal Antibody<br />

CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody<br />

CD5, Rabbit Monoclonal Antibody<br />

Vimentin, Rabbit Monoclonal Antibody<br />

COX2, Rabbit Monoclonal Antibody<br />

CD23, Rabbit Monoclonal Antibody<br />

Vascular Endothelial Growth Factor (VEGF), Rabbit Monoclonal Antibody<br />

p504s/AMACR, Rabbit Monoclonal Antibody<br />

Prostate Specific Membrane Antigen (PSMA), Rabbit Monoclonal Antibody<br />

DOG1, Rabbit Monoclonal Antibody<br />

Pax-5, Rabbit Monoclonal Antibody<br />

Heregulin α1 (HRGα1), Recombinant Protein<br />

Heregulin β1 (HRGβ1), Recombinant Protein<br />

Helicobacter pylori Antigen, Recombinant Protein<br />

Glucose-Regulated Protein 94 (Grp94)/gp96 Ab-1, Rat Monoclonal Antibody<br />

Heat Shock Factor 1 (HSF1) Ab-1, Rat Monoclonal Antibody<br />

CD115/c-fms/CSF-1R/M-CSFR Ab-1, Rat Monoclonal Antibody<br />

Heat Shock Factor 1 (HSF1) Ab-4, Rat Monoclonal Antibody<br />

Heparan Sulfate Proteoglycan/Perlecan Ab-1, Rat Monoclonal Antibody<br />

Laminin B2/γ 1 Ab-1, Rat Monoclonal Antibody<br />

Raf-1 (Phosphopecific) Ab-2, Rat Monoclonal Antibody<br />

Epithelial Specific ETS3 (ESE3), Rat Monoclonal Antibody<br />

Vitamin D Receptor (VDR) Ab-1, Rat Monoclonal Antibody<br />

Laminin B1/β 1 Ab-1, Rat Monoclonal Antibody<br />

Estrogen Receptor Ab-21, Rat Monoclonal Antibody<br />

IgA, FITC Labeled Antibody<br />

IgG, FITC Labeled Antibody<br />

C3c Complement, FITC Labeled Antibody<br />

Clone<br />

EP1628Y<br />

E431-1<br />

EP449E<br />

EP38Y<br />

EP1045Y<br />

EPR2241IHC<br />

YR85<br />

EPR2764Y<br />

SP1<br />

SP2<br />

SP3<br />

SP4<br />

SP5<br />

SP6<br />

SP7<br />

SP8<br />

SP11<br />

SP12<br />

SP13<br />

SP15<br />

SP16<br />

SP17<br />

SP18<br />

SP19<br />

SP20<br />

SP21<br />

SP23<br />

SP28<br />

13H4<br />

SP29<br />

SP31<br />

SP34<br />

Recombinant Protein<br />

Recombinant Protein<br />

Recombinant Protein<br />

9G10.F8.2<br />

4B4<br />

2-4A5-4<br />

4B4 + 10H4 + 10H8<br />

A7L6<br />

A5<br />

pS338[DPR/2/2A/3A]<br />

ETS3<br />

9A7gamma.E10.E4<br />

LT3<br />

H222<br />

Polyclonal<br />

Polyclonal<br />

Polyclonal<br />

Page<br />

115<br />

118<br />

72<br />

128<br />

159<br />

111<br />

217<br />

98<br />

134<br />

217<br />

155<br />

109<br />

205<br />

172<br />

71<br />

55<br />

231<br />

101<br />

66<br />

215<br />

74<br />

64<br />

88<br />

73<br />

247<br />

107<br />

77<br />

245<br />

211<br />

221<br />

125<br />

212<br />

162<br />

162<br />

153<br />

146<br />

151<br />

90<br />

151<br />

154<br />

175<br />

223<br />

133<br />

248<br />

175<br />

136<br />

165<br />

167<br />

61<br />

272<br />

• Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Recommended Protocol Index<br />

This index lists our recommended protocols for our primary detection systems UltraVision Labeled Polymer (UVLP) and<br />

UltraVision Quanto when available. This list is provided for general reference only. Please consult the data sheet for the<br />

latest product information as recommendations can change at any time. If you are using the Quanto detection system<br />

and no recommendations are listed, we recommend using the UVLP recommendations as a starting point for mouse<br />

monoclonal antibodies. For rabbit antibodies we recommend increasing the dilution factor 2 fold (i.e. 1:50 to 1:100) or<br />

decreasing incubation time (i.e., 30 min. – 20min.) to account for the increased sensitivity. If you have futher questions,<br />

please contact your local representative or e-mail our technical service team at lab.reagents@thermofisher.com.<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

14.3.3 sigma Ab-1 1433S01 MS-1185 30 min. 1:50-1:100 Low pH 6 Skin<br />

ACTH Ab-1 AH26 MS-452 30 min. 1:500-1:1000 None Normal pituitary gland or pituitary adenoma<br />

ACTH Ab-1 AH26 MS-452 30 min. 1:500-1:1000 None Normal pituitary gland or pituitary adenoma<br />

Actin Beta RB-9421 30 min. 1:50-1:100 Low pH 6 Human leiomyoma<br />

Actin, Muscle Specific Ab-4 HHF35 MS-742 30 min. 1:50-1:100 None 20 min. 1:50 Med pH 8 Muscle<br />

Actin, Muscle Specific Ab-6 MSA06 MS-1296 30 min. 1:100-1:200 None Muscle or sarcoma<br />

Actin, pan Ab-5 ACTN05 MS-1295 30 min. 1:50 Low pH 6 Skeletal Muscle<br />

Actin, Skeletal Muscle Ab-2 5C5.F8.C7 MS-185 20 min. 1:50-100 None Skeletal, Cardiac muscle,<br />

Rhabdomyosarcoma<br />

Actin, Smooth Muscle Ab-1 1A4 MS-113 20 min. 1:800 None 20 min. 1:800 Med pH 8 Smooth muscle, leiomyosarcoma or<br />

Squamous cell CA<br />

Actin, Smooth Muscle. RB-9010 30 min. 1:50-1:100 None Smooth muscle or Leiomyosarcoma<br />

Adenovirus Type 2 and 5 Ab-5 M58 + M73 MS-1069 30 min. 1:100-1:200 Low pH 6 Adenovirus infected tissues<br />

Adenovirus Type 2 E1A Ab-2 M73 MS-588 30 min. 1:50-1:100 Low pH 6 Adenovirus infected tissues<br />

Adenovirus Type 5 E1A Ab-1 M58 MS-587 30 min. 1:50-1:100 Low pH 6 Adenovirus infected cells and tissues<br />

ALK / p80 Ab-1 5A4 MS-1104 60 min. 1:40-1:80 Low pH 6 Anaplastic lymphoma<br />

ALK / p80 SP8 RM-9108 30 min. 1:50-1:100 Low pH 6 20 min. 1:200 Low pH 6 Anaplastic lymphoma<br />

Alpha Fetoprotein (AFP) Ab-1 C3 MS-226 30 min. 1:100-1:200 None Fetal liver or hepatocellular CA<br />

Alpha Fetoprotein (AFP) Ab-2 RB-365 30 min. 1:100-1:200 None Fetal liver or hepatocellular CA<br />

Alpha Fetoprotein (AFP) RB-9064 20 min. 1:500-1000 None 20 min. 1:250 Low pH 6 Fetal liver or hepatocellular CA<br />

Alpha-1-Antitrypsin Ab-1 RB-367 30 min. 1:100-1:200 None Tonsil<br />

Amyloid A Component Ab-1 mcl MS-1219 20 min. 1:200-1:400 Low pH 6 Amyloid deposits in kidney<br />

Amyloid A4 / Amyloid Beta Ab-1 BAM01 MS-1167 60 min. 1:25-1:50 Formic Acid Human brain of Alzheimer’s disease<br />

Amyloid Precursor Protein (APP) RB-9023 30 min. 1:200 Low pH 6 Brain<br />

Androgen Receptor Ab-1 AR 441 MS-443 20 min. 1:25 Low pH 6 20 min. 1:50 Med pH 8 Prostate CA<br />

Androgen Receptor RB-9030 30 min. 1:100-1:200 Low pH 6 Prostate CA<br />

APC (Adenomateous Polyposis Coli) RB-9276 20 min. 1:50 Low pH 6 Colon CA<br />

Bak Ab-2 RB-1520 30 min. 1:200-1:400 Low pH 6 Tonsil<br />

Bax Ab-1 2D2 MS-711 30 min. 1:50-1:100 Low pH 6 Hodgkin’s lymphoma<br />

BCL-2alpha Ab-1 100/D5 MS-123 20min. 1:50 Low pH 6 20 min. 1:50 Low pH 6 Tonsil or follicular lymphomas<br />

BCL-2alpha Ab-3 8C8 MS-597 30 min. 1:100-1:200 Low pH 6 Tonsil, follicular lymphoma<br />

BCL-6 Ab-1 P1F6 MS-579 60 min. 1:20-1:40 Med pH 8 Tonsil<br />

BCL-6 Ab-2 BL6.02 MS-1114 60 min. 1:20 Med pH 8 20 min. 1:20 Med pH 8 Tonsil<br />

BCL-6 Ab-3 P1F6 + PG-B6p MS-1897 60 min. 1:10-1:20 Med pH 8 Tonsil<br />

BCL-X Ab-1 2H12 MS-715 30 min. 1:50-1:100 Low pH 6 Hodgkin’s lymphoma<br />

BCL-XL Ab-2 7D9 MS-1334 30 min. 1:400 Low pH 6 Hodgkin’s lymphoma<br />

Beta-catenin E247 RM-2101 20 min. 1:125 Med pH 8 20 min. 1:250 Med pH 8 Breast CA<br />

Bromodeoxyuridine (BrdU) Ab-3 BRD.3 MS-1058 30 min. 1:500 HCl+Trypsin Tissue from animals injected with Brdu<br />

Bromodeoxyuridine (BrdU) Ab-4 Bu20a MS-1848 20 min. 1:50-1:100 HCl+Trypsin tissues from animals injected with Brdu<br />

CA 125 (Ovarian Cancer Antigen) Ab-1 Ov185:1 MS-1151 60 min. 1:10 Low pH 6 20 min. 1:10 Low pH 6 Ovarian CA<br />

CA 125 Ab-2 M11 MS-1812 30 min. 1:20-1:40 Low pH 6 Breast, ovarian, endometrial, colon and<br />

lung CA<br />

CA 125 SPM111 MS-9086 30 min. 1:400 Low pH 6 Colon CA<br />

CA 15-3 Ab-1 DF3 MS-1827 30 min. 1:40-1:80 Low pH 6 Ovarian CA<br />

CA19-9 (GI Tumor Marker) Ab-1 121SLE MS-379 30 min. 1:50-1:100 None Colon CA<br />

CA19-9 (GI Tumor Marker) Ab-3 116-NS-19-9 MS-1811 30 min. 1:10-1:20 None Colon CA<br />

CA19-9 (GI Tumor Marker) SPM110 MS-9085 30 min. 1:100 None Colon CA<br />

c-Abl Ab-1 8E9 MS-938 30 min. 1:50-1:100 Med pH 8 Placenta<br />

Cadherin E / E-Cadherin SPM471 MS-9470 20 min. 1:50-1:100 Low pH 6 20 min. 1:50 Med pH 8 Colon CA<br />

Cadherin E / E-Cadherin Ab-3 36B5 MS-1479 90 min. 1:20-1:40 Low pH 6 Tonsil, squamous epithelium<br />

Cadherin E / E-Cadherin Ab-4 NCH-38 MS-1862 30 min. 1:5-1:10 Low pH 6 Breast CA<br />

Cadherin, Pan Ab-4 RB-1524 30 min. 1:200-1:400 Low pH 6 Tonsil, squamous epithelium<br />

Cadherin, Pan RB-9036 30 min. 1:200 Low pH 6 Tonsil or squamous epithelium<br />

Cadherin-P / P-cadherin Ab-1 56C1 MS-1741 30 min. 1:20 Low pH 6 Skin<br />

Calcitonin (Rabbit Monoclonal) SP17 RM-9117 30 min. 1:200 None 20 min. 1:400 Low pH 6 Thyroid or medullary CA<br />

Calcitonin Ab-2 RB-1519 30 min. 1:200-1:400 Low pH 6 Thyroid or medullary CA<br />

Caldesmon, HMW Ab-1 h-CALD MS-1169 30 min. 1:200-1:400 Low pH 6 20 min. 1:200 Low pH 6 Uterus<br />

Caldesmon, LMW Ab-2 l-CALD MS-1251 30 min. 1:100-1:200 Low pH 6 Uterus<br />

Calponin Ab-1 CALP MS-1168 20 min. 1:200-1:400 Low pH 6 20 min. 1:1600 Low pH 6 Myoepithelial cells in breast ducts<br />

Calponin-1 EP798Y RM-2102 20 min. 1:100 Low pH 6 20 min. 1:200 Low pH 6 Breast CA<br />

Calprotectin-Monocyte / Macrophage /<br />

MAC 387 MS-148 20 min. 1:1000 Trypsin Tonsil, lymph node, spleen<br />

L1 Protein / Ab-1<br />

Calretinin RB-9002 20 min. 1:100 Low pH 6 Mesothelioma<br />

Calretinin (SP13) SP13 RM-9113 30 min. 1:100-1:200 Low pH 6 20 min. 1:100 Low pH 6 Mesothelioma<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

273


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

Calretinin Ab-1 5A5 MS-1110 60 min. 1:40-1:80 Low pH 6 Mesothelioma<br />

Calretinin Ab-2 DAK Calret 1 MS-1859 30 min. 1:10-1:20 Low pH 6 Mesothelioma<br />

Caspase 3 (CPP32) Ab-1 3CSP01 MS-1121 30 min. 1:50-1:100 Low pH 6 Tonsil and appendix<br />

Caspase 3 (CPP32) Ab-3 3CSP03 MS-1123 30 min. 1:100-1:200 Low pH 6 Tonsil and appendix<br />

Caspase 3 (CPP32) Ab-4 RB-1197 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

Caspase 9 / LAP6 Ab-4 RB-1205 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

Catenin, beta Ab-1 RB-090 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Catenin, beta Ab-2 RB-1491 30 min. 1:500-1:1000 Low pH 6 Breast CA<br />

Catenin, beta Ab-3 17C2 MS-1763 60 min. 1:30 Low pH 6 Breast CA<br />

Catenin, beta. RB-9035 30 min. 1:250-1:500 Low pH 6 Breast CA<br />

Cathepsin D Ab-1 C5 MS-402 60 min. 1:40-1:60 Low pH 6 Breast CA<br />

Cathepsin G Ab-1 19C3 MS-1835 30 min. 1:40 Low pH 6 Tonsil<br />

CD10/CALLA (Neutral Endopeptidase) Ab-2 56C6 MS-728 60 min. 1:30-1:60 Med pH 8 60 min. 1:15 Med pH 8 Small intestine, tonsil<br />

CD105 / Endoglin / TGF beta 1/3 Receptor RB-9291 20 min. 1:25-1:50 Low pH 6 Placenta<br />

CD105 / Endoglin / TGF-beta1/3 Receptor Ab-3 SN6h MS-1290 60 min. 1:100 Protease Tonsil, lymph node and thymus<br />

CD106 / VCAM-1 Ab-3 1.4C3 MS-1101 30 min. 1:12.5-1:25 Med pH 8 Placenta<br />

CD117 / c-Kit / SCF-Receptor Ab-6 RB-1518 30 min. 1:50 Med pH 8 Tonsil, GI Stromal Tumor (GIST)<br />

CD117 / c-Kit / SCF-Receptor. RB-9038 30 min. 1:100-1:200 Low pH 6 20 min. 1:200- Med pH 8 Stromal tumor, skin or tonsil<br />

400<br />

CD13 / Aminopeptidase-N Ab-3 38C12 MS-1079 20 min. 1:40-1:80 Low pH 6 Prostate, Liver<br />

CD138 Ab-1 5F7 MS-1769 30 min. 1:20 Med pH 8 Tonsil<br />

CD138 Ab-2 MI15 MS-1793 30 min. 1:10-1:20 Low pH 6 20 min. 1:10 Med pH 8 Tonsil<br />

CD138. RB-9422 60 min. 1:25-1:50 Low pH 6 Tonsil<br />

CD14 Ab-2 7 MS-1080 60 min. 1:20-1:40 Low pH 6 Placenta<br />

CD141 / Thrombomodulin Ab-1 141C01 MS-1102 60 min. 1:25-1:50 Low pH 6 Mesothelioma<br />

CD15 SPM490 MS-10338 30 min. 1:50 Low pH 6 Reed-Sternberg’s cells in Hodgkin’s<br />

lymphoma<br />

CD15 / Lewis x Ab-2 15C02 MS-739 60 min. 1:50-1:100 Low pH 6<br />

+ Pep<br />

Reed-Sternberg’s cells in Hodgkin’s<br />

lymphoma<br />

CD15 Ab-3 MMA MS-1259 20 min. 1:100-1:200 Low pH 6<br />

+ Pep<br />

20 min. 1:50 Low pH 6<br />

+ Pep<br />

Reed-Sternberg’s cells in Hodgkin’s<br />

lymphoma<br />

CD16 / Fcgamma Receptor III Ab-2 2H7 MS-1085 20 min. 1:10-1:20 Low pH 6 Tonsil<br />

CD163 Ab-1 10D6 MS-1103 60 min. 1:25-1:50 Low pH 6 Placenta<br />

CD1a Ab-2 MTB1 MS-746 30 min. 1:15 Med pH 8 Thymus<br />

CD1a Ab-5 O10 MS-1856 30 min. 1:50-1:100 Med pH 8 20 min. 1:50 Med pH 8 Tonsil<br />

CD2 (LFA-2) Ab-2 AB75 MS-1074 20 min. 1:30-1:60 Med pH 8 Tonsil<br />

CD20 RB-9013 20 min. 1:400-800 None Tonsil<br />

CD20 Ab-1 L26 MS-340 60 min. 1:250 None 60 min. 1:250 Low pH 6 Tonsil<br />

CD21 Ab-2 2G9 MS-1086 60 min. 1:10-1:20 Low pH 6 20 min. 1:10 Med pH 8 Tonsil<br />

CD22 Ab-4 FPC1 MS-1087 20 min. 1:10-1:30 Med pH 8 20 min. 1:10 Med pH 8 Tonsil<br />

CD23 (SP23) SP23 RM-9123 20 min. 1:100 Low pH 6 20 min. 1:200 Low pH 6 Tonsil<br />

CD23 Ab-1 1B12 MS-729 60 min. 1:20-1:40 Low pH 6 20 min. 1:20 Med pH 8 Tonsil<br />

CD24 (GPI-linked surface mucin) Ab-2 SN3b MS-1279 30 min. 1:50 Low pH 6 Breast Carcinoma, Ovarian Carcinoma.<br />

CD25 / IL-2Ralpha Ab-4 4C9 MS-1088 60 min. 1:40-1:80 Low pH 6 Tonsil or lymph node<br />

CD27 Ab-2 137B4 MS-1468 20 min. 1:20-1:40 Med pH 8 Tonsil<br />

CD29 (Integrin Beta-1) Ab-3 7F10 MS-1089 60 min. 1:15-1:30 Med pH 8 Tonsil<br />

CD3 (Early T Cell Marker) SP7 RM-9107 20 min. 1:150 Low pH 6 20 min. 1:300 Low pH 6 Tonsil<br />

CD30 (Reed-Sternberg Cell Marker) CON6D/ C2 MS-1915 30 min 1:50 Med pH 8 Hodgkin’s Lymphoma<br />

CD30 (Reed-Sternberg Cell Marker) Ab-1 Ber-H2 MS-361 20 min. 1:40-1:80 Med pH 8 20 min. 1:40 Med pH 8 Hodgkin’s lymphoma<br />

CD30 (Reed-Sternberg Cell Marker) Ab-4 HRS4 MS-1857 30 min. 1:40-1:80 Low pH 6 Hodgkin’s lymphoma<br />

CD31 / (Endothelial Cell Marker) RB-10333 30 min. 1:25-1:50 Low pH 6 Tonsil<br />

CD31 / (Endothelial Cell Marker) Ab-1 JC/70A MS-353 20 min. 1:100 Med pH 8 20 min. 1:50 Med pH 8 Placenta<br />

CD31 / (Endothelial Cell Marker) Ab-6 1A10 MS-1873 60 min. 1:50 Low pH 6 Tonsil<br />

CD35 / CR1 (Follicular Dendritic Cell Marker) Ab-2 E11 MS-336 20 min. 1:50-1:100 Low pH 6 Tonsil<br />

CD38 Ab-3 38C03 MS-983 60 min. 1:100 Low pH 6. Tonsil<br />

CD3-CD20 CD3:SP7; CD20:L26 MV-2002 30 min. RTU Low pH 6 Tonsil<br />

CD3epsilon EP449E RM-2109 20 min. 1:125 Low pH 6 20 min. 1:250 Low pH 6 Tonsil<br />

CD3epsilon (Early T-Cell Marker) Ab-1 RB-360 20 min. 1:20-40 Low pH 6 Tonsil<br />

CD3epsilon (Early T-Cell Marker) Ab-2 PS1 MS-401 60 min. 1:30-1:60 Med pH 8 Tonsil<br />

CD3epsilon (Early T-Cell Marker) Ab-9 F7.2.38 MS-1880 30 min. 1:10-1:20 Low pH 6 Tonsil<br />

CD4 Ab-8 4B12 MS-1528 60 min. 1:10-1:20 Med pH 8 20 min. 1:10 Med pH 8 Tonsil<br />

CD42b (GPIb) Ab-1 42C01 MS-1174 30 min. 1:100-1:200 None Tonsil<br />

CD43 / T-Cell Marker Ab-1 DF-T1 MS-146 20 min. 1:50 None 20 min. 1:100 Low pH 6 Tonsil or lymph node<br />

CD43 / T-Cell Marker Ab-3 84-3C1 MS-679 30 min. 1:100-1:200 Low pH 6 Tonsil or lymph node<br />

CD44 Std. / HCAM Ab-4 156-3C11 MS-668 30 min. 1:100-1:200 Low pH 6. Tonsil, Esophageal CA, Breast CA., and<br />

Squamous Cell CA<br />

CD45 / T200 / LCA Ab-2 PD7/26/16 + 2B11 MS-355 20 min. 1:200 None 20 min. 1:200 Low pH 6 Tonsil<br />

CD45 / T200 / LCA Ab-3 (Cocktail, PAN-LCA) PAN-LCA MS-413 30 min. 1:100-1:200 None Tonsil<br />

CD45RA Ab-1 111-1C5 MS-625 30 min. 1:100-1:200 None Lymph node or tonsil<br />

CD45RA Ab-3 4KB5 MS-1845 30 min. 1:100-1:200 None Lymph node or tonsil<br />

CD45RB Ab-3 PD7/26 MS-1846 30 min. 1:100-1:200 None Tonsil or lymph node<br />

CD45RO (T-Cell Marker) Ab-1 UCHL-1 MS-112 20 min. 1:200-1:400 None 20 min. 1:800 Low pH 6 Tonsil, lymph node<br />

CD4-CD8 CD4:4B12, CD8:SP16 MV-2001 30 min. RTU Med pH 8 Tonsil<br />

CD5 (clone SP19) SP19 RM-9119 20 min. 1:50-1:100 Low pH 6 20 min. 1:100 Low pH 6 Tonsil<br />

274 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

CD5 Ab-1 4C7 MS-393 30 min. 1:20-1:40 Med pH 8 20 min. 1:10 Med pH 8 Tonsil<br />

CD54 / ICAM-1 Ab-4 23G12 MS-1094 2 hrs. 1:10-1:20 Low pH 6 Tonsil<br />

CD56 / NCAM-1 Ab-2 123C3.D5 MS-204 20 min. 1:50-1:100 Low pH 6 20 min. 1:50 Low pH 6 Neuroblastoma, Pancreas<br />

CD56 / NCAM-1 Ab-4 56C04 MS-1149 30 min. 1:100-1:200 Low pH 6 Neuroblastoma<br />

CD57 (Natural Killer Cell Marker) Ab-2 HNK-1 MS-1163 30 min. 1:50-1:100 None Lymph node or tonsil<br />

CD57 Ab-1 NK1 MS-136 30 min. 1:100-1:200 None Lymph node or tonsil<br />

CD61 (GPIIIa) Ab-1 2f2 MS-1095 20 min. 1:25-1:50 Low pH 6 Tonsil<br />

CD63 Ab-1 NKI/C-3 MS-1118 30 min. 1:500 Low pH 6 Melanoma<br />

CD68 / Macrophage Marker Ab-3 KP1 MS-397 30 min. 1:100-1:200 Protease 20 min. 1:6000 Low pH 6 Tonsil, lymph node, or spleen<br />

CD68 / Macrophage Marker Ab-4 PG-M1 MS-1808 30 min. 1:50-1:100 Low pH 6 Tonsil<br />

CD71 / Transferrin Receptor Ab-3 10F11 MS-1096 20 min. 1:20-1:40 Low pH 6 Breast CA<br />

CD74 Ab-1 LN2 MS-131 30 min. 1:50-1:100 Low pH 6 Tonsil, lymph node<br />

CD79a / mb-1 (B Cell Marker) Ab-1 HM47/A9 MS-357 30 min. 1:200-1:400 Low pH 6 Lymph node or tonsil<br />

CD79a / mb-1 (B Cell Marker) Ab-2 JCB117 MS-1171 30 min. 1:50-1:100 Low pH 6 Lymph node or tonsil<br />

CD79a / mb-1 (B-Cell Marker) (SP18) SP18 RM-9118 20 min. 1:100-1:300 Low pH 6 20 min. 1:300 Low pH 6 Tonsil<br />

CD8 RB-9009 20 min. 1:500-1000 Low pH 6 Tonsil<br />

CD8 (SP16) SP16 RM-9116 30 min. 1:50 Low pH 6 20 min. 1:100 Low pH 6 Tonsil<br />

CD8 Ab-1 C8/144B MS-457 20 min. 1:25-1:50 Low pH 6 Lymph node or tonsil<br />

CD82 Ab-1 5B5 MS-1742 60 min. 1:10-1:20 Med pH 8 Tonsil<br />

CD9 / Motility-Related Protein-1 Ab-1 72F6 MS-1077 60 min. 1:25-1:50 Med pH 8 Tonsil<br />

CD95 / Fas Ab-3 95C03 MS-1098 60 min. 1:15-1:30 Low pH 6 Small intestine<br />

CD99 / MIC2 (Ewing’s Sarcoma Marker) Ab-1 HO36-1.1 MS-294 20 min. 1:100-1:200 Low pH 6 Pancreas or Ewing’s sarcoma<br />

CD99 / MIC2 (Ewing’s Sarcoma Marker) Ab-2 O13 MS-1633 30 min. 1:100-1:200 Low pH 6 Pancreas or Ewing’s sarcoma<br />

CDC47 / MCM7 Ab-2 47DC141 MS-862 30 min. 1:200-1:400 Low pH 6 Tonsil or breast CA<br />

CDC7 Kinase Ab-1 DCS-341 MS-1888 60 min. 1:25 Low pH 6 Tonsil<br />

Cdk1 / p34 cdc2 Ab-1 A17.1.1 MS-110 30 min. 1:50-1:100 Low pH 6 Tonsil or lymph node<br />

Cdk2 Ab-1 2B6 MS-459 60 min. 1:25-1:50 Med pH 8 Tonsil<br />

CDw75 Ab-1 LN1 MS-130 30 min. 1:25-1:50 Low pH 6 Tonsil or lymph node<br />

CDX2 EPR2764Y RM-2116 20 min. 1:100 Low pH 6 20 min. 1:100 Low pH 6 Colon CA<br />

CEA (Carcinoembryonic Antigen) / CD66e Ab-2 RB-368 30 min. 1:500-1:1000 None 20 min. 1:500 None Colon CA<br />

CEA (Carcinoembryonic Antigen) / CD66e Ab-3 COL-1 MS-613 30 min. 1:1000 Low pH 6 Colon CA<br />

c-erbB-2 / HER-2 / neu SP3 RM-9103 30 min. 1:100 Low pH 6 20 min. 1:100 Low pH 6 Breast CA<br />

c-erbB-2 / HER-2 / neu Ab-1 RB-103 30 min. 1:200-1:400 Low pH 6 Breast CA<br />

c-erbB-2 / HER-2 / neu Ab-15 3B5 MS-599 20 min. 1:1000-1:1500 Low pH 6 Breast CA<br />

c-erbB-2 / HER-2 / neu Ab-17 e2-4001 + 3B5 MS-730 30 min. 1:400-1:800 Low pH 6 Breast CA<br />

c-erbB-2 / HER-2 / neu Ab-8 e2-4001 MS-325 20 min. 1:200-400 Low pH 6 Breast CA<br />

c-erbB-2 / HER-2 / neu EP1045Y MS-2112 20 min. 1:100 Med pH 8 20 min. 1:100 Med pH 8 Breast CA<br />

c-erbB3 / HER-3 RB-9211 20 min. 1:15-1:30 Low pH 6 Skeletal muscle<br />

c-erbB-4 / HER-4 RB-9045 30 min. 1:50 Low pH 6 Breast CA<br />

Chorionic Gonadotropin, Human / HCG Ab-2 RB-059 30 min. 1:50-1:100 Pepsin Placenta or choriocarcinoma<br />

Chorionic Gonadotropin, Human / HCG Ab-5 CG04 + CG05 MS-1065 30 min. 1:100-1:200 Low pH 6 Placenta or choriocarcinoma<br />

Chorionic Gonadotropin, Human / HCG SPM105 MS-9080 20 min. 1:50 Low pH 6 Placenta<br />

Chromogranin A RB-9003 30 min. 1:400 Low pH 6 Pancreas<br />

Chromogranin A ( SP12) SP12 RM-9112 20 min. 1:200 Low pH 6 20 min. 1:400 Low pH 6 Pancreas<br />

Chromogranin A Ab-1 LK2H10 MS-324 20 min. 1:800 Low pH 6 Pancreas<br />

Chromogranin A Ab-2 PHE5 MS-381 30 min. 1:200-1:400 Low pH 6 Pancreas<br />

Chromogranin A Ab-3 LK2H10 + PHE5 MS-382 30 min. 1:1000 Low pH 6 Pancreas<br />

CITED1 RB-9219 20 min. 1:12.5-1:25 Low pH 6 Papillary thyroid CA<br />

Clathrin, Light Chain Ab-1 CON.1 MS-1291 30 min. 1:100-1:200 Low pH 6 Placenta<br />

Claudin 1 RB-9209 20 min. 1:50-1:100 Low pH 6 Skin or Breast CA<br />

Claudin 3 RB-9251 20 min. 1:100 Low pH 6 Small intestine<br />

Claudin 4 RB-9266 30 min. 1:50 Low pH 6 Tonsil and Ovarian CA<br />

c-myb / v-myb Ab-1 4E3 MS-1728 20 min. 1:12.5-1:25 Low pH 6 Testis<br />

c-myc Ab-2 9E10.3 MS-139 30 min. 1:50-1:100 Low pH 6 Breast carcinoma<br />

CNPase Ab-1 (Oligodendrocyte & Schwann Cell 11-5B MS-349 30 min. 1:50-1:100 Low pH 6 Brain<br />

Marker)<br />

Collagen II Ab-2 2B1.5 MS-235 30 min. 1:100-1:200 Pepsin Cartilage in lung or fetus<br />

Collagen II Ab-3 6B3 MS-306 30 min. 1:100-1:200 Pepsin Cartilage in lung or fetus<br />

Collagen IV Ab-1 PHM-12 MS-375 30 min. 1:50-1:100 Protease Skin<br />

Collagen IV Ab-2 CIV 22 MS-448 30 min. 1:50-1:100 Protease Skin<br />

Collagen IV Ab-3 PHM-12+CIV 22 MS-747 30 min. 1:50-1:100 Protease Skin<br />

Collagen X Ab-1 X-AC9 MS-852 30 min. 1:50-1:100 Low pH 6 Chicken Cartilage<br />

COX-1 RB-10687 30 min. 1:25 Low pH 6 Esophagus<br />

COX2 RB-9072 20 min. 1:100-1:200 Low pH 6 Lung and Colon CAs<br />

COX2 SP21 RM-9121 20 min. 1:50-1:100 Low pH 6 20 min. 1:100 Low pH 6 Lung and Colon CA<br />

Cyclin A Ab-6 6E6 MS-1061 60 min. 1:40 Low pH 6 Tonsil<br />

Cyclin A Ab-7 RB-1548 20 min. 1:50-1:100 Low pH 6 Tonsil<br />

Cyclin B1 Ab-1 V152 MS-338 30 min. 1:100-1:200 Low pH 6 Tonsil or breast CA<br />

Cyclin B1 Ab-2 RB-008 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Cyclin B1 Ab-4 GNS11 MS-869 30 min. 1:50-1:100 Low pH 6 Tonsil or breast CA<br />

Cyclin D1 / Bcl-1(SP4) SP4 RM-9104 30 min. 1:25-1:50 Low pH 6 20 min. 1:50 Low pH 6 Breast CA or mantle cell lymphoma<br />

Cyclin D1 (EPR2241IHC) (EPR2241IHC) MS-2113 20 min. 1:100 Med pH 8 20 min. 1:200 Med pH 8 Mantle cell lymphoma<br />

Cyclin D1 / Bcl-1 RB-9041 60 min. 1:200 Low pH 6 Breast CA or mantle cell lymphoma<br />

Cyclin D3 Ab-1 DCS-22 MS-215 60 min. 1:25 Low pH 6 Breast CA or tonsil<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

275


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

Cyclin E Ab-2 HE12 MS-870 30 min. 1:50-1:100 Low pH 6 Breast CA or placenta<br />

Cyclin E Ab-5 13A3 MS-1060 20 min. 1:40 Low pH 6 Breast CA or placenta<br />

Cystic Fibrosis Transmembrane Regulator (CFTR) M3A7 MS-1249 20 min. 1:25-1:50 Low pH 6 Pancreas<br />

Ab-4<br />

Cytochrome c Ab-2 7H8.2C12 MS-1192 30 min. 1:100-1:200 Low pH 6 Cardiac muscle<br />

Cytokeratin 10 Ab-2 DE-K10 MS-611 30 min. 1:200-1:400 None Skin<br />

Cytokeratin 10 Ab-2 DE-K10 MS-611 30 min. 1:200-1:400 None Skin<br />

Cytokeratin 14 RB-9020 30 min. 1:400-1:800 Low pH 6 Skin or Squamous cell CA<br />

Cytokeratin 14 Ab-1 LL002 MS-115 30 min. 1:100-1:200 Low pH 6 Skin or Squamous cell CA<br />

Cytokeratin 16 Ab-1 LL025 MS-620 30 min. 1:100-1:200 Low pH 6 Squamous cell CA<br />

Cytokeratin 17 Ab-1 E3 MS-489 30 min. 1:40 – 1:80 Low pH 6 Squamous cell CA or Skin<br />

Cytokeratin 18 E431-1 RM-2108 20 min. 1:25-50 Med pH 8 20 min. 1:50-100 Med pH 8 Mesothelioma, Pancreas<br />

Cytokeratin 18 Ab-1 DC10 MS-142 30 min. 1:100-1:200 Low pH 6 Skin Breast or lung CA<br />

Cytokeratin 19 RB-9021 30 min. 1:50-1:100 Low pH 6 Tonsil<br />

Cytokeratin 19 Ab-1 A53-B/A2.26 MS-198 30 min. 1:100-1:200 Low pH 6 20 min. 1:100 Low pH 6 Skin<br />

Cytokeratin 19 Ab-4 BA17 MS-1671 30 min. 1:200-1:400 Low pH 6 Colon CA<br />

Cytokeratin 19 Ab-5 RCK108 MS-1902 30 min. 1:100-1:200 Low pH 6 Colon CA<br />

Cytokeratin 20 Ab-1 Ks20.8 MS-377 30 min. 1:50 - 1:100 Pepsin 20 min. 1:50 Med pH 8 Colon CA<br />

Cytokeratin 20 Ab-5 Q2 MS-1853 30 min. 1:100-1:200 Low pH 6 Colon CA<br />

Cytokeratin 20 Ab-6 Q6 MS-1854 30 min. 1:100-1:200 Low pH 6 Colon CA<br />

Cytokeratin 4 Ab-1 6B10 MS-923 60 min. 1:10 Med pH 8 Epithelial cells in tonsil<br />

Cytokeratin 5 EP1601Y RM-2106 20 min. 1:100 Low pH 6 20 min. 1:200 Med pH 8 Mesothelioma<br />

Cytokeratin 5 / 6 Ab-2 D5/16 B4 MS-1814 30 min. 1:10 Med pH 8 20 min. 1:10 Med pH 8 Mesothelioma, Squamous cell CA<br />

Cytokeratin 5 Ab-1 XM26 MS-1896 30 min. 1:20 Low pH 6 Squamous cell CA or skin<br />

Cytokeratin 7 Ab-2 OV-TL 12/30 MS-1352 20 min. 1:100-1:200 Trypsin 20 min. 1:50- Med pH 8 Ovarian CA<br />

1:100<br />

Cytokeratin 8 / 18 Ab-1 5D3 MS-743 30 min. 1:50-1:100 Trypsin 20 min. 1:50 Med pH 8 Skin<br />

Cytokeratin 8 / 18 Ab-2 K8.8 + DC10 MS-1603 30 min. 1:100-1:200 Low pH 6 Skin or Breast CA<br />

Cytokeratin 8 Ab-4 TS1 MS-997 30 min. 1:200-1:400 Low pH 6 Skin, Colon, lung or breast CA<br />

Cytokeratin 8 EP1628Y RM-2107 20 min. 1:100 Low pH 6 20 min. 1:200 Low pH 6 Pancreas, Mesothelioma<br />

Cytokeratin, HMW Ab-1 AE3 MS-342 20 min. 1:100-1:200 Trypsin Skin, Lung CA<br />

Cytokeratin, HMW Ab-2 DE-SQ MS-346 30 min. 1:50-1:100 Protease or<br />

Prostate<br />

Pepsin<br />

Cytokeratin, HMW Ab-3 34BetaE12 MS-1447 20 min. 1:50-1:100 Protease 20 min. 1:50 Med pH 8 Squamous cell CA<br />

Cytokeratin, Low Molecular Weight Ab-1 AE1 MS-341 30 min. 1:50 Low pH 6 20 min. 1:50 Low pH 6 Skin, Squamous cell CA<br />

Cytokeratin, Multi Ab-1 C-11 MS-149 30 min. 1:100-1:200 Low pH 6 Skin, Colon CA<br />

Cytokeratin, Pan Ab-1 AE1/AE3 MS-343 20 min. 1:50 Protease 20 min. 1:50 Med pH 8 Skin, Lung CA<br />

Cytokeratin, Pan Ab-2 PAN-CK MS-356 30 min. 1:100-1:200 Protease or<br />

Skin<br />

Trypsin<br />

Cytokeratin, Pan Ab-3 Lu-5 MS-744 20 min. 1:25-1:50 Pepsin Skin or Squamous cell CA<br />

Cytomegalovirus Ab-1 CMV01 MS-717 30 min. 1:25-1:50 Pepsin 20 min. 1:12.5 Pepsin CMV infected tissue<br />

D4-GDI RB-9042 20 min. 1:100 Low pH 6 Placenta and tonsil<br />

Desmin (Muscle Cell Marker) Ab-1 D33 MS-376 20 min. 1:50-1:100 None 20 min. 1:100 Med pH 8 Muscle or Sarcoma<br />

Desmin (Muscle Cell Marker) RB-9014 30 min. 1:200 None Muscle or Sarcoma<br />

DNA-PKcs Ab-1 18-2 MS-369 20 min. 1:50-1:100 Low pH 6 Tonsil<br />

DNA-PKcs Ab-3 42-psc MS-371 20 min. 1:400 Low pH 6 Testis<br />

DNA-PKcs Ab-4 (Cocktail) 18-2 + 25-4 + MS-423 30 min. 1:50-1:100 Low pH 6 Tonsil or testis<br />

42-psc<br />

Dog1 SP31 RM-9132 20 min. 1:25-50 Med pH 8 20 min. 1:100 Med pH 8 Gastrointestinal Stromal Tumors<br />

Dog1 1.1 MS-1933 20 min. 1:100 Med pH 8 20 min. 1:200 Med pH 8 Gastrointestinal Stromal Tumors<br />

Dysferlin Ab-1 Ham1/7B6 MS-1874 30 min. 1:20 Low pH 6 Skeletal muscle<br />

Dystrophin Ab-1 1808 MS-486 30 min. 1:50-1:100 Med pH 8 Skeletal muscle<br />

Dystrophin RB-9024 30 min. 1:100-1:200 Med pH 8 Skeletal muscle<br />

E2F-1 Transcription Factor Ab-6 KH95 MS-879 30 min. 1:50-1:100 Med pH 8 Tonsil or breast CA<br />

E2F-4 Transcription Factor Ab-4 4E2F04 MS-1057 30 min. 1:50-1:100 Low pH 6 Tonsil<br />

E-Cadherin EP700Y RM-2100 60 min. 1:50 Low pH 6 60 min. 1:100 Low pH 6 Breast CA<br />

EGFR EP38Y MS-2111 20 min. 1:100 Med pH 8 20 min. 1:200 Med pH 8 Squamous carcinoma<br />

Emerin Ab-1 4G5 MS-1751 60 min. 1:10 Low pH 6 Tonsil<br />

Epidermal Growth Factor Receptor / EGFR Ab-10 111.6 MS-378 30 min. 1:50-1:100 Protease Skin, placenta or Squamous cell CA<br />

Epidermal Growth Factor Receptor / EGFR Ab-5 H11 MS-316 30 min. 1:50-1:100 Protease Placenta or Squamous cell CA<br />

Epithelial Membrane Antigen / EMA Ab-2 GP1.4 MS-348 30 min. 1:1000-1:2000 None Breast or colon CA<br />

Epithelial Membrane Antigen / EMA Ab-3 E29 MS-741 20 min. 1:400-1:800 None 20 min. 1:800 None Breast or colon CA<br />

Epithelial Specific Antigen / Ep-CAM Ab-1 VU-1D9 MS-144 30 min. 1:100-1:200 Pepsin Breast CA<br />

Epithelial Specific Antigen / Ep-CAM Ab-2 AUA1 MS-675 30 min. 1:100-1:200 High pH 10 Breast CA<br />

Epithelial Specific Antigen / Ep-CAM Ab-3 323/A3 MS-181 30 min. 1:100-1:200 Pepsin Breast CA<br />

Epithelial Specific Antigen / Ep-CAM Ab-7 MOC-31 MS-1825 20 min. 1:25-1:50 Pepsin 20 min. 1:50 Med pH 8 Colon CA<br />

Epithelial Specific Antigen / Ep-CAM Ab-9 Ber-EP4 MS-1898 30 min. 1:10 Pepsin Breast CA<br />

Epstein-Barr Virus / LMP Ab-1 CS1+CS2+CS3+CS4 MS-1458 60 min. 1:25-1:50 Low pH 6 EBV-positive lymphoblastoma<br />

Estrogen Receptor (SP1) SP1 RM-9101 30 min. 1:100-1:400 Low pH 6 20 min. 1:400 Low pH 6 Breast CA<br />

Estrogen Receptor Ab-11 1D5 MS-354 30 min. 1:250-1:500 Low pH 6 Breast CA<br />

Estrogen Receptor Ab-12 6F11 MS-391 30 min. 1:40-1:80 Low pH 6 Breast CA<br />

Estrogen Receptor Ab-14 1D5 + 6F11 MS-750 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Estrogen Receptor Ab-16 RB-1493 20 min. 1:250-500 Low pH 6 Breast CA<br />

Estrogen Receptor Ab-17 RB-1521 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

276 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

Estrogen Receptor beta RB-10658 60 min. 1:25-50 Low pH 6 Breast CA<br />

Estrogen Sulfotransferase (Anti-Rat) Ab-1 EST.1 MS-233 30 min. 1:50-1:100 Low pH 6 Rat liver<br />

Ets-1 Ab-1 1G11 MS-1762 60 min. 1:10 Low pH 6 Tonsil<br />

Excitatory Amino Acid Transporter 2 Ab-1 1H8 MS-1750 60 min. 1:10 Low pH 6 Brain<br />

Ezrin / p81 / 80K / Cytovillin Ab-1 3C12 MS-661 30 min. 1:100-1:200 Low pH 6 Lung<br />

Factor VIII Related Antigen / von Willebrand Factor<br />

RB-281 20 min. 1:80-1:160 Low pH 6 Tonsil, Placenta<br />

Ab-1<br />

Factor VIII Related Antigen / von Willebrand Factor F8/86 MS-722 20 min. 1:50-1:100 Med pH 8 20 min. 1:25 Med pH 8 Blood vessels in Skin or intestine<br />

Ab-2<br />

Factor XIII A Ab-1 AC-1A1 MS-1237 20 min. 1:100 None 20 min. 1:1600 Med pH 8 Capillary hemangioma, dermatofibroma<br />

and placenta<br />

Factor XIII A Ab-2 RB-1464 30 min. 1:50-1:100 Low pH 6 hemangioma, dermatofibroma and placenta<br />

Fas Ligand RB-9029 20 min. 1:25-1:50 Low pH 6 Tonsil<br />

Fascin Ab-1 FCN01 MS-1112 30 min. 1:100-1:200 Low pH 6 20 min. 1:100 Low pH 6 Hodgkin’s lymphoma or spleen<br />

Filaggrin Ab-1 FLG01 MS-449 30 min. 1:50-1:100 Low pH 6 Skin<br />

Filamin Ab-1 FLMN01 MS-1211 30 min. 1:100-1:200 Low pH 6 Skin<br />

Flk-1 / KDR / VEGFR2 Ab-1 RB-1526 60 min. 1:50 Low pH 6 Angiosarcoma<br />

Flt-4 RB-9255 30 min. 1:100 Low pH 6 Placenta or breast CA<br />

Follicle Stimulating Hormone (FSH) Ab-3 FSH03 MS-1449 30 min. 1:500-1:1000 Low pH 6 Anterior pituitary<br />

Follicle Stimulating Hormone (FSH) SPM107 MS-9082 30 min. 1:300-1:500 Low pH 6 Anterior pituitary<br />

Fyn (p59 fyn ) Ab-1 1S MS-339 20 min. 1:50 Low pH 6 Lymphoma<br />

Galectin-3 Ab-1 9C4 MS-1756 20 min. 1:80 Low pH 6 Small Bowel<br />

Gastrin Ab-1 RB-1459 30 min. 1:100-1:200 None Stomach<br />

GCDFP-15 (Gross Cystic Disease Fluid Protein-15) 23A3 MS-1170 20 min. 1:30-1:60 Low pH 6 20 min. 1:20 Low pH 6 Skin<br />

Ab-1<br />

GFAP / Glial Fibrillary Acidic Protein Ab-1 GA-5 MS-280 20 min. 1:100 None 20 min. 1:100 None Brain or astrocytoma<br />

GFAP / Glial Fibrillary Acidic Protein Ab-4 RB-087 20 min. 1:100-1:200 None Brain or astrocytoma<br />

GFAP / Glial Fibrillary Acidic Protein Ab-6 ASTRO6 MS-1376 30 min. 1:100-1:200 None Brain or astrocytoma<br />

Glucagon Ab-1 RB-1422 30 min. 1:50-1:100 Low pH 6 Pancreas<br />

Glucose-Regulated Protein 94 (Grp94) / gp96 Ab-1 9G10.F8.2 RT-102 30 min. 1:100-1:200 Low pH 6 Tonsil, Breast CA<br />

GLUT-1 RB-9052 20 min. 1:200 Low pH 6 Breast CA, squamous cell CA, non-small-cell<br />

lung CA and esophageal CA<br />

GLUT-1 (SPM498) SPM498 MS-10637 30 min. 1:200 Low pH 6 Esophagous CA<br />

Glutathione S-Transferase, pi Ab-1 RB-050 60 min. 1:25-1:50 None Bile ducts in liver<br />

Glycophorin A Ab-4 JC159 MS-1843 30 min. 1:200-1:400 None Human erythrocytes in placenta<br />

GnRH Receptor / LH-RH Receptor Ab-3 GNRH03 MS-1139 60 min. 1:100 Med pH 8 Pituitary or normal ovary<br />

Granulocyte (Myeloid cell Marker) Ab-1 BM-2 MS-189 30 min. 1:50-1:100 None Tonsil or lymph node<br />

Granzyme B Ab-1 GZB01 MS-1157 60 min. 1:25-1:50 Low pH 6 20 min. 1:25 Low pH 6 Hodgekin’s lymphoma<br />

Grb2 / sem5 / ASH Signalling Protein Ab-4 2GB04 MS-1457 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

Growth Hormone, Human / hGH Ab-3 GH01 /#2 + GH02 /#7 MS-1328 20 min. 1:2000-1:4000 Low pH 6 Human anterior pituitary<br />

GRP94 RB-10642 20 min. 1:500 Low pH 6 Breast CA<br />

GSK3ß (Ser9) RB-10394 30 min. 1:25 Low pH 6 Breast CA<br />

HDJ-2 / DNAJ Ab-1 KA2A5.6 MS-225 30 min. 1:100-1:200 Low pH 6 Raji cells. Tonsil<br />

Heat Shock Factor 1 (HSF1) Ab-4 4B4 + 10H4 + 10H8 RT-629 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Heat Shock Protein 27 (HSP27) Ab-1 G3.1 MS-101 30 min. 1:100-1:200 Low pH 6 Breast CA<br />

Heat Shock Protein 60 (HSP60) Ab-1 LK1 MS-120 30 min. 1:50 Low pH 6 Breast CA<br />

Heat Shock Protein 70 (HSP70) Ab-2 W27 MS-482 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Heat Shock Protein 90alpha Ab-1 RB-119 20 min. 1:50-1:100 Low pH 6 Breast CA<br />

Helicobacter pylori Ab-1 RB-1875 30 min. 1:500-1:1000 Low pH 6 Helicobacter pylori infected tissue<br />

Helicobacter pylori RB-9070 30 min. 1:500-1:2000 Low pH 6 20 min. 1:1000 Low pH 6 Helicobacter pylori infected tissue<br />

Heparan Sulfate Proteoglycan / Perlecan Ab-1 A7L6 RT-794 30 min. 1:100-1:200 Bov. Hyalur. Tonsil<br />

Hepatitis B Virus Core Antigen (HBVcAg) Ab-1 RB-1413 30 min. 1:100-1:200 None Hepatitis B virus infected liver<br />

Hepatitis B Virus Surface Antigen (HBVsAg) Ab-1 T9 MS-314 30 min. 1:25-1:50 None 20 min. 1:50 Low pH 6 Hepatitis B virus infected liver<br />

Hepatocyte Ab-1 OCH1E5 MS-1810 30 min. 1:20-1:40 Low pH 6 20 min. 1:50 Med pH 8 Liver CA<br />

Heregulin / NDF / GGF / Neuregulin Ab-1 7D5 MS-272 60 min. 1:25-1:50 Low pH 6 Prostate CA<br />

Herpes Simplex Virus Type 2 (HSV II) Ab-1 RB-1426 30 min. 1:100-1:200 Low pH 6 HSV infected tissues<br />

Histone H1 Ab-1 1415-1 MS-628 30 min. 1:50-1:100 None Tonsil or lymph node<br />

Human Papilloma Virus (HPV) Ab-3 K1H8 MS-1826 30 min. 1:20 Low pH 6 20 min. 1:50 Med pH 8 Infected cells and tissue<br />

Human Sodium Iodide Symporter (hNIS) Ab-1 FP5A MS-1653 20 min. 1:200-1:400 Low pH 6 Thyroid<br />

IgA (alpha-Heavy Chain) Ab-1 GA01 MS-1008 60 min. 1:25 Med pH 8 Tonsil<br />

IgA (alpha-Heavy Chain) Ab-2 RB-1433 60 min. 1:500-1:1000 Low pH 6 Tonsil<br />

IgD (delta-Heavy Chain) Ab-1 RB-1436 30 min. 1:500-1:1000 Low pH 6 Tonsil<br />

IgE (epsilon-Heavy Chain) Ab-1 RB-1435 30 min. 1:500-1:1000 Low pH 6 Tonsil<br />

IgG (gamma-Heavy Chain) Ab-1 RB-1432 30 min. 1:500-1:1000 Low pH 6 Tonsil<br />

IgM (mu-Heavy Chain) Ab-2 RB-1434 30 min. 1:500-1:1000 Low pH 6 Tonsil<br />

Inhibin, alpha Ab-1 R1 MS-1863 30 min. 1:10-1:20 Low pH 6 Testis<br />

Insulin Ab-4 INS04 MS-1377 30 min. 1:25-1:50 None Pancreas<br />

Insulin Ab-5 INS05 MS-1378 30 min. 1:200-1:400 None Pancreas<br />

Insulin Ab-6 (INS04 + INS05) INS04 + INS05 MS-1379 30 min. 1:200-1:400 None Pancreas<br />

Insulin Receptor (Alpha-Subunit) Ab-2 83-7 MS-632 30 min. 1:50-1:100 Pepsin Placenta<br />

Insulin Receptor (Beta-Subunit) Ab-6 CT-3 MS-636 30 min. 1:50 Med pH 8 Placenta or brain<br />

Involucrin Ab-1 SY5 MS-126 20 min. 1:100-1:200 Tryp or Prot Skin<br />

JAK3 Ab-1 A1-14-16 MS-1444 30 min. 1:50 Low pH 6 Tonsil, Pancreas<br />

Kappa Light Chain Ab-1 L1C1 MS-143 20 min. 1:400-800 Low pH 6 Tonsil<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

277


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

Kappa Light Chain Ab-2 RB-333 30 min. 1:200-1:400 Low pH 6 20 min. 1:400 Low pH 6 Tonsil<br />

Kappa-Lambda<br />

Kappa:L1C1, MV-2003 30 min. RTU Low pH 6 Tonsil<br />

Lambda:Poly<br />

Ki-67 RB-9043 20 min. 1:300 Low pH 6 Breast CA and lymph node<br />

Ki-67 (Rabbit Monoclonal) SP6 RM-9106 20 min. 1:200 Low pH 6 20 min. 1:200- Low pH 6 Spleen, tonsil, or breast CA<br />

400<br />

Ki-67 Ab-4 RB-1510 30 min. 1:50-1:100 Low pH 6 20 min. 1:400 Low pH 6 Tonsil or Breast CA<br />

Ku (p70 / p80) Ab-3 162 MS-286 30 min. 1:100-1:200 None Tonsil<br />

Ku (p70) Ab-4 N3H10 MS-329 20 min. 1:200-1:400 Low pH 6 Tonsil<br />

L1 Cell Adhesion Molecule Ab-1 UJ127 MS-770 30 min. 1:100 Low pH 6 Neuroblastoma<br />

Lambda Light Chain Ab-1 HP6054 MS-180 20 min. 1:100-1:200 Low pH 6 Tonsil<br />

Lambda Light Chain Ab-2 RB-334 30 min. 1:100-1:200 Low pH 6 20 min. 1:400 Low pH 6 Tonsil<br />

Lambda Light Chain Ab-4 (Cocktail) LAM03 + HP6054 MS-1158 30 min. 1:50-1:100 Low pH 6 Tonsil<br />

Laminin Ab-1 RB-082 30 min. 1:50-1:100 Protease 20 min. 1:25 Protease Skin, Lung, Kidney or Tonsil<br />

Laminin B1 / Beta1 Ab-1 LT3 RT-796 30 min. 1:100 None Colon or colon CA<br />

Laminin B2 / gamma1 Ab-1 A5 RT-795 30 min. 1:100 Bov. Hyalur. Colon or colon CA<br />

Laminin B2 / gamma1 Ab-2 D18 MS-1356 30 min. 1:50-1:100 Protease Skin<br />

Laminin Receptor Ab-1 MLuC5 MS-259 30 min. 1:25-1:50 Low pH 6 Breast CA<br />

LH (Luteinizing Hormone) Ab-1 LH01 MS-1448 20 min. 1:2000-1:4000 Low pH 6 Anterior pituitary<br />

LH (Luteinizing Hormone) SPM103 MS-9078 20 min. 1:2000 Low pH 6 Anterior pituitary<br />

LRP / MVP (Major Vault Protein) Ab-2 1032 MS-664 20 min. 1:50-1:100 Low pH 6 Breast tumors<br />

Lysozyme / Muramidase Ab-1 RB-372 30 min. 1:100-1:200 None Tonsil, colon, or skin<br />

MAGE-1 Ab-4 MA454 MS-1067 60 min. 1:12.5-1:25 Med pH 8 Germ cells in testis<br />

MAGE-1 Ab-6 6C1 MS-1836 60 min. 1:20 Low pH 6 Hepatocellular CA, normal testis<br />

Mammaglobin 304-1A5 MS-1919 20 min. 1:100 Low pH 6 20 min. 1:100 Med pH 8 Breast carcinoma<br />

MAP 2a,b (Microtubule-Associated Protein) Ab-2 AP20 MS-249 20 min. 1:100-1:200 Low pH 6 Brain<br />

MAP 2a,b,c (Microtubule-Associated Protein) Ab-3 AP18 MS-250 30 min. 1:100-1:200 Low pH 6. Brain<br />

MAP1B / MAP5 (Microtubule-Associated Protein) 3G5 MS-248 20 min. 1:400-1:800 None Brain<br />

Ab-1<br />

MART-1 / Melan-A (Melanoma Marker) Ab-1 M2-7C10 MS-612 30 min. 1:100-1:200 Low pH 6 20 min. 1:200 Low pH 6 Melanoma<br />

MART-1 / Melan-A (Melanoma Marker) Ab-3 M2-7C10 + M2-9E3 MS-716 20 min. 1:50-1:100 Low pH 6 20 min. 1:100 Med pH 8 Melanoma<br />

(Cocktail)<br />

MART-1 / Melan-A (Melanoma Marker) Ab-4 A103 MS-799 20 min. 1:100 Low pH 6. 20 min. 1:100 Low pH 6 Melanoma<br />

Maspin Ab-1 EAW24 MS-1767 20 min. 1:12.5-1:25 Med pH 8 Prostate<br />

Mast Cell Chymase Ab-1 CC1 MS-1217 30 min. 1:2000 Low pH 6 Tonsil<br />

Mast Cell Tryptase Ab-2 AA1 MS-1216 20 min. 1:2000 Low pH 6 Tonsil<br />

MCM2 Ab-1 CRCT2.1 MS-1726 20 min. 1:50 Low pH 6 Tonsil<br />

Melanoma (gp100) Ab-1 HMB45 MS-364 20 min. 1:40-1:80 Low pH 6 20 min. 1:50 Low pH 6 Melanoma<br />

Melanoma Marker, Pan Ab-1 HMB45 (gp100, M2- MS-939 30 min. 1:50-1:100 Low pH 6 Melanoma<br />

7C10 (MART-1 and<br />

M2-9E3 (MART-1)<br />

Mesothelin Ab-1 5B2 MS-1320 60 min. 1:5-1:10 Med pH 8 Mesothelioma<br />

Mesothelioma Ab-1 HBME-1 MS-1494 60 min. 1:25-1:50 Low pH 6 20 min. 1:25 Med pH 8 Mesothelioma<br />

MGMT (O-methylguanine-DNA methyltransferase) MT 3.1 MS-470 60 min. 1:10-1:20 Low pH 6 Colon CA<br />

Ab-1<br />

MHC II (HLA-DR) Ab-1 LN3 MS-133 30 min. 1:50-1:100 None Tonsil or lymph node<br />

Milk Fat Globule 1, Human (HMFG1) Ab-1 EDM45 MS-512 30 min. 1:100-1:200 Low pH 6 Breast, colon, or lung tissues<br />

MiTF Ab-2 D5 MS-772 30 min. 1:25-1:50 Low pH 6 Melanoma<br />

Mitochondria Ab-2 MTC02 MS-1372 30 min. 1:100-1:200 Low pH 6 Liver<br />

MMP-1 (Collagenase-1) Ab-6 RB-1536 30 min. 1:25-1:50 Low pH 6 Placenta Bladder, breast, ovarian CA<br />

MMP-11 (Stromelysin-3) Ab-5 SL3.05 MS-1035 30 min. 1:100-1:200 None Placenta<br />

MMP-13 (Collagenase-3) Ab-1 VIIIA2 MS-825 60 min. 1:25 Low pH 6 Placenta, Bladder, breast, and ovarian CA<br />

MMP-9 (92kDa Collagenase IV) RB-9234 30 min. 1:25-1:50 Low pH 6 Placenta, or Breast CA<br />

Moesin Ab-1 38/87 MS-727 30 min. 1:400-1:800 Low pH 6 Placenta<br />

MSH2 (Mismatch Repair Protein 2) Ab-1 25D12 MS-1498 60 min. 1:10 Low pH 6 20 min. 1:10 Low pH 6 Tonsil<br />

MUC-1 RB-9222 30 min. 1:50-1:100 None Breast CA<br />

MUC-1 SPM492 MS-10340 30 min. 1:50 None Breast CA<br />

MUC-1 Ab-5 MH1 HM-1630 30 min. 1:100-1:200 None Breast CA<br />

Mucin 2 (MUC2) Ab-2 M53 MS-1037 30 min 1:50-1:100 Low pH 6 20 min. 1:100 Low pH 6 Small intestine<br />

Mucin 5AC (MUC5AC) / Gastric Mucin Ab-1 45M1 MS-145 30 min. 1:100-1:200 None 20 min. 1:400 Low pH 6 Stomach<br />

Mucin 5AC (MUC5AC) / Gastric Mucin Ab-2 1-13M1 MS-551 30 min. 1:100-1:200 None Stomach<br />

Mucin 6 (MUC-6) Ab-1 CLH5 MS-1153 20 min. 1:25-50 Low pH 6 Stomach<br />

Myelin Basic Protein Ab-1 RB-1460 30 min. 1:100-1:200 None Brain<br />

Myeloperoxidase (MPO) Ab-1 RB-373 30 min. 1:100-1:200 Low pH 6 20 min. 1:800 Low pH 6 Tonsil or spleen<br />

Myogenin Ab-1 F5D MS-1113 20 min. 1:50 Low pH 6 Rhabdomyosarcoma or Wilm’s tumors<br />

Myogenin Ab-2 F12B MS-1182 20 min. 1:50-1:100 Low pH 6 Rhabdomyosarcoma or Wilm’s tumors<br />

Myoglobin RB-9068 20 min. 1:1000-1:2000 None Skeletal muscle<br />

Myosin, Skeletal Muscle Ab-2 MYSN02 MS-1236 30 min. 1:500-1:1000 None Skeletal muscle<br />

Myosin, Smooth Muscle Heavy Chain Ab-1 SMMS-1 MS-1177 60 min. 1:25 Low pH 6 20 min. 1:50- Med pH 8 Uterus<br />

1:100<br />

Myosin, Smooth Muscle Heavy Chain Ab-3 SM-M10 MS-1348 30 min. 1:50-1:100 Low pH 6 +<br />

Uterus<br />

Tryp<br />

Neurofilament (200kDa & 68kDa) Ab-1 2F11 MS-359 30 min. 1:50-1:100 None Brain<br />

Neuron Specific Enolase / NSE Ab-1 E27 MS-335 20 min. 1:1600-1:3200 Low pH 6 Pancreas<br />

NF kappa B / p65 (Rel A) Ab-1 RB-1638 20 min. 1:50-1:100 Low pH 6 Placenta<br />

278 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

NF kappa B / p65 (Rel A) RB-9034 20 min. 1:100 Low pH 6 Prostate gland and placenta<br />

Nitric Oxide Synthase, endothelial (eNOS) RB-9279 60 min. 1:50 Low pH 6 Capillary endothelium, regenerating<br />

endothelium<br />

Nitric Oxide Synthase, inducible (iNOS) RB-9242 20 min. 1:100 Low pH 6 Lung<br />

Nucleophosmin (NPM) Ab-1 NA24 MS-1849 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

NY-BR-1 NY-BR-1#2 MS-1932 20 min. 1:100 Med pH 8 20 min. 1:100 Med pH 8 Breast carcinoma<br />

Oct-2 RB-9297 30 min. 1:50 Low pH 6 Tonsil<br />

Osteopontin RB-9097 30 min 1:50 Low pH 6 Gastric CA or Osteosarcoma<br />

p130 / Rb2 Ab-2 130P215 MS-866 20 min. 1:100 Low pH 6 Tonsil<br />

p130 Cas Ab-1 CAS-14 MS-855 30 min 1:100-1:200 Low pH 6 Tonsil or breast CA<br />

p15 INK4b Ab-6 15P06 MS-1053 60 min. 1:25-1:50 Low pH 6 Colon CA<br />

p18 INK4c Ab-3 18P118 MS-858 30 min. 1:50 Low pH 6 Tonsil, Skeletal muscle, heart, pancreas<br />

p21 WAF1 (Anti-Mouse) Ab-9 RB-032 60 min. 1:20 Low pH 6 Colon<br />

p21 WAF1 Ab-11 CP74 MS-891 30 min. 1:50 Low pH 6 Colon CA<br />

p21 WAF1 Ab-3 DCS-60.2 MS-230 60 min. 1:25-1:50 Low pH 6 Colon CA<br />

p21 WAF1 Ab-5 HZ52 MS-387 30 min. 1:50-1:100 Low pH 6 Colon CA<br />

P27 Kip1 RB-9019 20 min. 1:100 Low pH 6 Colon CA<br />

p300 / CBP (CREB-Binding Protein) Ab-1 NM11 MS-586 20 min. 1:50-1:100 Low pH 6 Tonsil<br />

p504S/ AMACR 13H4 RM-9130 20 min 1:100 Low pH 6 20 min. 1:100 Low pH 6 Prostate carcinoma<br />

p53 Y5 RM-2103 20 min. 1:100 Med pH 8 20 min. 1:200 Med pH 8 Colon or Breast Carcinoma<br />

p53 ( SP5) SP5 RM-9105 20 min. 1:100 Low pH 6 20 min. 1:200 Low pH 6 Colon CA<br />

p53 Ab-1 PAb 240 MS-104 30 min. 1:50-1:100 Med pH 8 Colon CA<br />

p53 Ab-5 DO-7 MS-186 30 min. 1:100-1:200 Low pH 6 20 min. 1:200 Low pH 6 Colon CA<br />

p53 Ab-6 DO-1 MS-187 30 min. 1:100-1:200 Low pH 6 Colon CA<br />

p53 Ab-8 DO-7 + BP53-12 MS-738 30 min. 1:100-1:200 Low pH 6 Colon CA<br />

p57 Kip2 Ab-3 KP39 MS-897 20 min. 1:50-1:100 Low pH 6 Colon CA or placenta<br />

p57 Kip2 Ab-6 57P06 MS-1062 30 min. 1:400-1:800 Low pH 6 20 min. 1:200 Low pH 6 Colon CA or placenta<br />

p57 Kip2 Ab-7 RB-1637 30 min 1:50-1:100 Low pH 6 Colon CA or placenta<br />

p63 Ab-1 4A4 MS-1081 20 min 1:200-1:400 None Squamous cell CA or Skin<br />

p63 Ab-2 63P02 MS-1082 20 min. 1:100-1:200 None Squamous cell CA or Skin<br />

p63 Ab-4 4A4 + Y4A3 (63P02) MS-1084 20 min. 1:100-1:200 None Squamous cell CA or Skin<br />

Parathyroid Hormone Receptor (PTH-Receptor) 3D1.1 MS-1270 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Type 1 Ab-1<br />

PARP (Poly ADP-Ribose Polymerase) Ab-2 RB-1516 30 min. 1:80-1:160 Low pH 6 Tonsil<br />

Pax-5 RB-9406 60 min. 1:50 Low pH 6 Tonsil<br />

Pax-5 SP34 RM-9133 20 min. 1:50 Med pH 8 20 min. 1:100 Med pH 8 Tonsil<br />

Paxillin Ab-1 5H11 MS-404 30 min. 1:100-1:200 Med pH 8 Colon CA<br />

PCNA (Proliferating Cell Nuclear Antigen) RB-9055 30 min. 1:800 Low pH 6 Tonsil, Lymph node, and small intestine<br />

PCNA Ab-1 PC10 MS-106 20 min. 1:400-1:800 None Tonsil, lymph node,or small intestine<br />

PDGFR, alpha RB-9027 60 min. 1:40-1:80 Low pH 6 Ovarian CA<br />

Pds1 Ab-1 DCS-280 MS-1511 20 min. 1:100-1:200 Low pH 6 Tonsil<br />

Perforin Ab-2 5B10 MS-1834 20 min. 1:10-1:20 Med pH 8 Lymphoma<br />

Placental Alk. Phosphatase (PLAP) Ab-1 8B6.18 MS-208 20 min. 1:200 Protease Placenta<br />

Placental Alk. Phosphatase (PLAP) Ab-4 8A9 MS-734 30 min. 1:40-1:80 Med pH 8 Placenta or seminoma<br />

Placental Alk. Phosphatase (PLAP) SP15 RM-9115 30 min. 1:50 None 20 min. 1:200 Med pH 8 Placenta or seminoma<br />

Placental Lactogen (hPL) RB-9067 30 min. 1:250 None Placenta<br />

Plasma Cell Ab-1 LIV3G11 MS-488 20 min. 1:1000 Low pH 6 Tonsil or lymph node<br />

Pneumocystis jiroveci (P. Carinii) Ab-1 3F6 MS-1427 30 min. 1:10-1:20 Trypsin Pneumocystis Carinii infected human lung<br />

Progesterone Receptor RB-9017 20 min. 1:50-1:100 Low pH 6 Breast CA<br />

Progesterone Receptor (SP2) SP2 RM-9102 30 min. 1:100-1:400 Low pH 6 20 min. 1:400 Low pH 6 Breast CA<br />

Progesterone Receptor Ab-14 PgR636 MS-1882 30 min. 1:10-1:20 Low pH 6 Breast CA<br />

Progesterone Receptor Ab-2 hPRa 2 MS-192 30 min. 1:50-1:100 Low pH 6 Breast CA<br />

Progesterone Receptor Ab-8 hPRa 2+hPRa 3 MS-298 60 min. 1:50-1:100 Low pH 6 20 min. 1:100 Low pH 6 Breast CA<br />

Progesterone Receptor Ab-9 1A6 MS-390 60 min. 1:10-1:20 Low pH 6 Breast CA<br />

Prohibitin (Mitochondrial Marker) Ab-1 II-14-10 MS-261 30 min. 1:50-1:100 Low pH 6 Heart<br />

Prolactin Ab-2 PRL02 MS-1362 30 min. 1:100-1:200 Low pH 6 Pituitary gland<br />

Prolactin Receptor Ab-1 B6.2 MS-1338 30 min. 1:100-1:200 Pepsin Breast CA<br />

Prolactin SPM108 MS-9083 30 min. 1:400-1:800 Low pH 6 Pituitary gland<br />

Prostate Specific Acid Phosphatase (PSAP) Ab-1 PASE/4LJ MS-321 20 min. 1:3000 None 20 min. 1:3000 Med pH 8 Normal prostate or prostate CA<br />

Prostate Specific Antigen (PSA) Ab-6 ER-PR8 + PA05 MS-1406 30 min. 1:100-1:200 Low pH 6 Prostate or prostate CA<br />

Prostate Specific Antigen(PSA) EP1588Y RM-2104 20 min. 1:100 Low pH 6 20 min. 1:200 Low pH 6 Normal prostate or prostate carcinoma<br />

Prostate Specific Membrane Antigen (PSMA) SP29 RM-9131 20 min. 1:50 Med pH 8 20 min. 1:100 Med pH 8 Prostate carcinoma<br />

Protein Gene Product 9.5 RB-9202 30 min. 1:100-1:200 Low pH 6 Pancreas and small intestine<br />

Protein Gene Product 9.5 (PGP9.5) Ab-1 10A1 MS-1760 60 min. 1:10 Low pH 6 Small intestine<br />

pS2 / pNR-2 Estrogen-Regulated Protein Ab-2 GE2 MS-199 20 min. 1:50–1:100 Med pH 8 Normal stomach or breast CA<br />

RAD51 Ab-1 51RAD01 MS-988 30 min. 1:50-1:100 Low pH 6 Testis<br />

Raf-1 (Phospho-specific) Ab-2 pS338[DPR/2/2A/3A] RT-1732 30 min. 1:50-1:100 Low pH 6 Tonsil<br />

Renal Cell Carcinoma Marker (gp200) Ab-1 PN-15 MS-409 30 min. 1:50-1:100 Protease Normal kidney or renal cell CA<br />

Ret Oncoprotein Ab-1 3F8 MS-1120 90 min. 1:15-1:30 Low pH 6 Small intestine<br />

Retinoblastoma (Rb) Ab-1 1F8 MS-107 30 min. 1:100-1:200 Med pH 8 Colon and breast CA<br />

Rhodopsin (Opsin) Ab-1 RET-P1 MS-1233 20 min. 1:50-200 Low pH 6 Brain or retina<br />

S100 RB-9018 30 min. 1:300 None 20 min. 1:1000 Med pH 8 Melanoma or Schwannoma<br />

S100 A4 RB-9411 20 min. 1:200-1:400 Low pH 6 Melanoma<br />

S100 A4 Ab-8 RB-1804 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

279


Recommended Protocol Index<br />

UltraVision LP<br />

UltraVision Quanto<br />

Antibody Name Clone Cat. No. LP Incub. LP Dil. LP PT Q incub. Q Dil. Q PT Control Tissue<br />

S100 A6 Ab-9 RB-1805 30 min. 1:100-1:200 Low pH 6 Tonsil<br />

S100 Protein Ab-1 4C4.9 MS-296 20 min. 1:100 None 20 min. 1:100 None Melanoma or Schwannoma<br />

S100 Protein Ab-2 RB-044 30 min. 1:100-1:200 None Melanoma or Schwannoma<br />

Secretory Component Ab-2 COMPO2 MS-1367 60 min. 1:50 Low pH 6 Small intestine, colon CA or stomach<br />

Serotonin Ab-1 5HT-H209 MS-1431 60 min. 1:20-1:40 Protease Appendix<br />

sm (Smith Antigen) Ab-1 Y12 MS-450 30 min. 1:50-1:100 None Tonsil, testis<br />

Somatostatin Ab-1 RB-038 30 min. 1:50-1:100 Low pH 6 Pancreas<br />

Surfactant Protein B (Mature) Ab-2 SPB02 MS-1300 30 min. 1:100-1:200 Low pH 6 Lung adenocarcinoma<br />

Surfactant Protein B (Precursor) Ab-1 SPB01 MS-704 30 min. 1:50-1:100 Low pH 6 Lung adenocarcinoma<br />

Survivin RB-9245 30 min. 1:50 Low pH 6 Normal pancreas (alpha cells) or prostate CA<br />

Survivin Ab-6 RB-1629 20 min. 1:250-1:500 Low pH 6 Stomach<br />

Syk Signalling Protein Ab-1 4D10.1 MS-322 30 min. 1:100-1:200 Low pH 6 Lymphoma<br />

Synaptophysin (Neuroendocrine Marker) SP11 RM-9111 20 min. 1:50-1:100 Low pH 6 20 min. 1:200 Low pH 6 Pancreas or Pheochromocytoma<br />

Synaptophysin Ab-2 SYP02 MS-1150 30 min. 1:40-1:80 Low pH 6 Pancreas, rheochromocytoma, or thyroid<br />

Synaptophysin Ab-4 RB-1461 30 min. 1:100-1:200 Low pH 6 Pancreas or Pheochromocytoma or GI tumor<br />

Synuclein Ab-2 syn211 MS-1572 30 min. 1:400 Low pH 6 Brain<br />

Synuclein alpha RB-9026 20 min. 1:800 None Posterior cingulated gyrus<br />

TAG-72 / CA 72-4 Ab-1 B72.3 MS-138 30 min. 1:500-1:1000 Low pH 6 Breast, lung, or colon CA<br />

Tartrate Resistant Acid Phosphatase (TRAP) Ab-1 26E5 MS-1768 30 min. 1:20 Low pH 6 Lung (macrophages)<br />

TAU Ab-3 RB-1429 30 min. 1:100-1:200 None Alzheimer’s disease brain tissue<br />

TdT / Terminal Deoxyribonucleotidyl Transferase Ab-1 SEN28 MS-1105 60 min. 1:20-1:30 Low pH 6 20 min. 1:20 Med pH 8 Thymus<br />

Tenascin Ab-1 T2H5 MS-128 20 min. 1:25-1:50 Med pH 8 Tonsil or Squamous cell CA<br />

Thomsen-Friedenreich Antigen Ab-1 A78-G/A7 MS-455 30 min. 1:25-1:50 Low pH 6 Human colorectal CA tissues<br />

Thrombospondin (TSP) Ab-4 A6.1 MS-421 20 min. 1:25-1:50 Low pH 6 Platelets in placenta, megakaryocytes in<br />

bone marrow<br />

Thymidine Phosphorylase / PD-ECGF Ab-1 P-GF.44C MS-499 30 min. 1:100-1:200 None Breast CA<br />

Thyroglobulin Ab-6 TGB04 (2H11 )+ MS-1380 20 min. 1:500-1:1000 None 20 min. 1:500 Med pH 8 Thyroid<br />

TGB05 (6E1)<br />

Thyroid Cancer Marker 373E1 MS-1914 30 min. 1:50-1:100 Low pH 6 Papillary Thyroid CA<br />

Thyroid Stimulating Hormone (TSH) Ab-3 TSH01 + TSH02 MS-1453 20 min. 1:200-1:400 Low pH 6 Anterior pituitary<br />

TIMP-1 Ab-2 102D1 MS-608 30 min. 1:100-1:200 Low pH 6 Bladder, breast, and ovarian CA<br />

TIMP-2 Ab-5 3A4 MS-1485 20 min. 1:200 Low pH 6 Pancreatic or colon CA<br />

Topoisomerase II alpha Ab-4 Ki-S1 MS-1819 20 min. 1:200-400 Low pH 6 20 min. 1:400 Low pH 6 Tonsil<br />

Toxoplasma Gondii Ab-1 RB-282 30 min. 1:25-1:50 Med pH 8 20 min. 1:50 Med pH 8 Infected brain tissue<br />

Toxoplasma Gondii RB-9423 30 min. 1:50-1:100 Low pH 6 Infected brain tissue<br />

Transglutaminase II Ab-1 CUB 7402 MS-224 30 min. 1:100-1:200 Low pH 6 Placenta<br />

Transglutaminase II Ab-2 TG100 MS-279 30 min. 1:100-1:200 Low pH 6 Breast CA<br />

Transglutaminase II Ab-3 CUB 7402 + TG100 MS-300 30 min. 1:100-1:200 Low pH 6 Breast CA<br />

Transglutaminase II Ab-4 RB-060 30 min. 1:100-1:200 Low pH 6 Breast CA<br />

Tropomyosin Ab-1 CH1 MS-1256 30 min. 1:100-1:200 Low pH 6 Skeletal or Cardiac muscle<br />

Troponin T, Cardiac Isoform Ab-1 13-11 MS-295 30 min. 1:100-1:200 Low pH 6 Cardiac muscle<br />

TTF-1 (Thyroid Transcription Factor-1) Ab-1 8G7G3/1 MS-699 20 min. 1:50-100 Low pH 6 20 min. 1:50 Med pH 8 Normal thyroid or lung<br />

Tubulin-Alpha Ab-2 DM1A MS-581 20 min. 1:400 None Skin or lung<br />

Tubulin-Alpha RB-9281 20 min. 1:200 None Skin or lung<br />

Tubulin-Beta Ab-6 TBN06 MS-1226 30 min. 1:100-1:200 None Skin or lung<br />

Tubulin-Beta RB-9249 30 min. 1:200 None Skin or lung<br />

Tyrosinase Ab-1 T311 MS-800 30 min. 1:50-1:100 Med pH 8 20 min. 1:50 Med pH 8 Melanoma<br />

Ubiquitin RB-9203 20 min. 1:200 Low pH 6 Human brain from patient with Alzheimer’s<br />

disease<br />

Vascular Endothelial Growth Factor (VEGF) Ab-1 RB-222 30 min. 1:100-1:200 Med pH 8 Angiosarcoma<br />

Vascular Endothelial Growth Factor (VEGF) Ab-7 VG1 MS-1467 30 min. 1:100-1:200 Med pH 8 Angiosarcoma<br />

Vascular Endothelial Growth Factor (VEGF) RB-9031 30 min. 1:100 Med pH 8 20 min. 1:200 Low pH 6 Angiosarcoma<br />

Villin Ab-1 CWWB1 MS-1499 30 min. 1:50-1:100 Low pH 6 20 min. 1:50 Low pH 6 Small intestine and kidney<br />

Vimentin Ab-2 V9 MS-129 20 min. 1:50-100 Low pH 6 20 min. 1:50 Low pH 6 Sarcomas<br />

Vimentin SP20 RM-9120 30 min. 1:200-1:400 None Sarcoma and Melanoma<br />

Vimentin-gp100<br />

Vim:SP20,<br />

MV-2004 30 min. RTU Low pH 6 Melanoma<br />

gp100:HMB45<br />

Vinculin Ab-1 VLN01 MS-1209 20 min. 1:50 Low pH 6 Skin<br />

Wilm’s Tumor Protein (WT1) Ab-5 6F-H2 MS-1837 60 min. 1:10 Med pH 8 Wilm’s tumor<br />

Wilm’s Tumor Protein (WT1) RB-9267 30 min. 1:100-200 Low pH 6 Wilm’s tumor<br />

XPA Ab-1 12F5 MS-650 30 min. 1:50-1:100 Low pH 6 Human tonsil<br />

XPF Ab-1 219 MS-1381 30 min. 1:50-1:100 Low pH 6 Human tonsil<br />

XRCC1 Ab-1 33-2-5 MS-434 30 min. 1:100-1:200 Low pH 6 Normal testis<br />

XRCC1 Ab-3 144 MS-1393 30 min. 1:100-400 Low pH 6 Normal testis<br />

ZAP-70 Ab-1(clone 2F3.2) 2F3.2 MS-1911 60 min. 1:100-1:200 Low pH 6 Tonsil<br />

280 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Notes<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

281


Notes<br />

282 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Notes<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

283


Notes<br />

284 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Notes<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

285


Notes<br />

286 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Notes<br />

Phone: 1-800-522-7270 | 1-269-544-5600 • Fax: 1-877-815-2608 • www.thermoscientific.com/labvision<br />

287


Ordering Information<br />

Bulk Antibody Orders<br />

Bulk antibody preparations are available for the<br />

majority of our products. If we carry a PABX format<br />

(without BSA and Azide) of a specific product then<br />

we can provide bulk volumes and pricing. If you<br />

would like a quote for a bulk antibody preparation<br />

please contact lab.sales@thermofisher.com with<br />

the following information.<br />

Please note: For international requests we will work<br />

through the distributor in your region. General distribution<br />

or reselling requests must be approved by our<br />

management team prior to quoting.<br />

Please Provide the Following Information<br />

for a Bulk Antibody Quote<br />

Part Number and Name of the Antibody<br />

Qty. Required in Milligrams (mg)<br />

Please provide the specific antibody part number. Only the number<br />

between the dashes is required. For example, for the antibody<br />

“MS-341-PABX” only “341” and the name is required.<br />

Please provide the number of milligrams (mgs) you require for your<br />

application. Discounts begin at 2mg of antibody. Based on the quantity you<br />

request we will determine pricing and product lead time. Please note that<br />

for very large quantities we may need to generate and purify more antibody.<br />

In some instances this can take up to several months. Partial shipments are<br />

possible, please contact us for lead times.<br />

Specific Packaging Requirements<br />

Estimated Order Date and Delivery Requirements<br />

How would you like your product packaged? For most products we<br />

provide them in PABX format (without BSA and Azide) at 1mg/mL. The<br />

product must be stored frozen. You may choose to receive all of the<br />

product in a single vial or we can aliquot it into multiple vials of a size<br />

that you determine.<br />

This allows us to anticipate any production requirements and deliver<br />

your bulk product as soon as possible. Please note that for large orders<br />

extended lead times may be required.<br />

Please e-mail the information above and any additional questions<br />

to lab.sales@thermofisher.com.<br />

288 • Thermo Scientific <strong>Immunohistochemistry</strong> Products •


Ordering Information<br />

PLACING ORDERS<br />

For placing orders in the United States please contact our Customer Care team with the information below:<br />

Ordering Over the Phone<br />

Toll Free: (800) 522-7270<br />

Press Option 1<br />

Faxing Orders<br />

(877) 815-2608<br />

For customers outside the Unites States please contact your local distributor. For distributor contact<br />

information in your area please visit our web site at www.thermoscientific.com/labvision or call our<br />

Customer Care team at (269) 544-5600.<br />

CONFIRMING ORDERS<br />

To avoid duplication of your shipment, please make sure that written confirmation orders are clearly<br />

marked as such.<br />

PRICES<br />

Prices are subject to change without prior notice.<br />

SHIPPING<br />

Products are shipped F.O.B. Destination. Shipping charges are prepaid and added to your invoice.<br />

FAST DELIVERY<br />

All US domestic orders received by 12:00 pm Eastern Standard Time, Monday through Thursday, will<br />

be shipped the same day for next day delivery. Orders received after 12:00 pm EST on Thursday will be<br />

shipped the following Monday unless otherwise requested.<br />

PAYMENT / CREDIT TERMS<br />

Acceptable methods of payment are credit cards or check. Checks must be made payable to<br />

Richard-Allan Scientific drawn on a U.S. Bank only. Wire transfer may also be arranged (contact Customer<br />

Service for details). Terms are net 30 days upon credit approval.<br />

TECHNICAL SUPPORT<br />

Our applications specialists are available to assist you if you encounter a problem or have a product<br />

related question. For support in the United States please call (800) 522-7270 and press option 2 then 7<br />

or contact us by e-mail at lab.reagents@thermofisher.com. International customers please contact<br />

your local distributor.<br />

RETURNS<br />

If it is necessary to return a product to us, please call for a return authorization number prior to returning<br />

the product. No credit or exchange will be permitted without prior authorization and a completed decontamination<br />

form. Our product liability is limited to purchase price or replacements. Only unopened and<br />

untampered products will be accepted. For all returns that are not related to product performance, a 25%<br />

restocking fee may be assessed.<br />

WARRANTIES AND LIMITATIONS<br />

Thermo Fisher Scientific, AP Fremont and Richard-Allan Scientific make no warranties as to the suitability<br />

of the product for a user’s specific application. The usefulness of the product must be determined by<br />

the end-user. Our products are intended for in-vitro diagnostics and research use. Some products are<br />

classified as analyze specific reagents, in which no performance claims are made about those products.<br />

Products are not suitable for drug use or therapeutic procedures. Please see individual product sheets for<br />

intended use information. No products are to be construed as a recommendation for use in violation of<br />

any patents. Our warranty is limited to the actual purchase price of the product. Thermo Fisher Scientific,<br />

AP Fremont and Richard-Allan Scientific are not liable for any property damage, personal injury, time or<br />

effort or economic loss caused by our product.


<strong>Immunohistochemistry</strong><br />

46360 Fremont Blvd. Fremont, CA 1-800-522-7270 www.thermoscientific.com/labvision<br />

94538 1-269-544-5600 lab.reagents@thermofisher.com<br />

LV10017 R1/12<br />

BN0119129

Hooray! Your file is uploaded and ready to be published.

Saved successfully!

Ooh no, something went wrong!