2018 AEJMC Conference Program

#aejmc18 

Association for Education in Journalism and Mass Communication 

Washington, DC • 101st Annual Conference • August 6-9, 2018

THE REYNOLDS SCHOOL 

AND CENTER FOR ADVANCED MEDIA STUDIES 

UNIVERSITY OF NEVADA, RENO 

SCIENCE COMMUNICATION, 

REIMAGINED 

NEW INITIATIVES 

EL PROGRAMA DE 

MEDIOS BILINGÜES 

THE NEXT GENERATION 

OF PUBLIC RADIO 

The Reynolds School announces 

the Hitchcock Project for Visualizing 

Science, an entrepreneurial 

initiative to prepare students, 

professionals and scientists to 

present science in visual, creative 

forms. The project was established 

through a gift from biochemist 

and philanthropist Mick Hitchcock, 

Ph.D. (pictured above). 

The Reynolds School’s new 

Bilingual Media program features 

curricula in both news and strategic 

communication. Capstone courses 

will be taught in Spanish. Our 

student-run bilingual news service, 

Noticiero Móvil, has received 

two ONA Challenge Fund grants, 

for coverage of elections and 

immigration. 

The radio stations and digital 

outlets of Reno Public Radio are 

now part of the Reynolds School. 

KUNR provides NPR and regional 

news and KNCJ offers classical 

music and jazz for northern Nevada 

and the Sierra. Reno Public Radio 

also features podcasts produced by 

our students and faculty, on the air 

and online. 

WELCOME, PAROMITA PAIN 

Professor Pain joins our school as an assistant professor 

of Global Media Studies. Her research focuses on global 

journalism practices from feminist perspectives. She 

holds a Ph.D. from the University of Texas, Austin. 

NEW FACULTY AND FRONTIERS 

DONALD W. REYNOLDS SCHOOL OF JOURNALISM 

JOURNALISM.UNR.EDU 

JOIN OUR TEAM AS DIRECTOR OF THE 

PROJECT FOR VISUALIZING SCIENCE 

If you’re an experienced science journalist or an 

academic who teaches science communication, this 

is a singular opportunity. The director of the Mick 

Hitchcock, Ph.D., Project for Visualizing Science will help 

to build an innovative program that seeks to reimagine 

how we report on science. This is a non-tenure-track 

position with generous staff and travel support. 

Learn more at journalism.unr.edu/new or 

contact Dean Al Stavitsky at ags@unr.edu. 

/ReynoldsSchool @RSJNevada @RSJNevada

Association for Education in Journalism 

and Mass Communication 

101st Annual Conference 

Washington, D.C. • August 6-9, 2018 

Jennifer Greer, University of Alabama, AEJMC President 

Marie Hardin, Pennsylvania State University, AEJMC President-Elect 

Heloiza Herscovitz, California State University, Long Beach, AEJMC Council of Divisions Chair 

Jennifer H. McGill, AEJMC Executive Director 

Amanda Caldwell, AEJMC Conference Coordinator 

Belinda Pearson, AEJMC Business Manager 

AEJMC was founded November 30, 1912, in Chicago, Illinois, 

as the American Association of Teachers of Journalism. 

Table of Contents 

AEJMC Board of Directors 3 

Conference Information 6 

Sunday Sessions 21 

Monday Sessions 41 

Tuesday Sessions 85 

Wednesday Sessions 135 

Thursday Sessions 185 

Program Index 207 

AEJMC Past Presidents 229 

Award Recipients 231 

Advertiser’s Index 254 

AEJMC 

234 Outlet Pointe Blvd., Suite A 

Columbia, South Carolina 29210-5667 

office: (803) 798-0271 fax: (803) 772-3509 website: www.AEJMC.org

Media Plan Case Competition 

Top two teams win a portion of $ 16,000 in scholarship awards. The case 

file for the 2019 Media Case Competition will be released in the fall of 

2018, allowing ample time for the candidates to complete their entries. 

Entries Due March 29, 2019 

Media Scholars Week 

All-expense-paid Washington, D.C. trip for case competition finalists. 

June 8 - 14, 2019 

Media Fellows Program 

With the Media Fellows Program, the Washington Media Scholars 

Foundation recognizes enthusiastic and qualified students by awarding 

several scholarships each academic year. The foundation has distributed 

over $400,000 in total scholarship awards since its inception. 

These grants support the academic development of undergraduates 

dedicated to pursuing a career related to the public policy 

advertising industry. 

Applications for the Spring 2019 scholarship distribution 

are due by November 16, 2018. 

@MediaScholars 

www.MediaScholars.org 

Facebook.com/MediaScholars 

@Media_Scholars 

A 501(c)(3) organization providing scholarships, networking and educational opportunities 

for undergraduates interested in public policy media strategy, research and management.

2017-18 AEJMC Board of Directors 

3 

Jennifer Greer 

Alabama 

President 

Marie Hardin 

Pennsylvania State 

President-Elect 

David Perlmutter 

Texas Tech 

Vice President 

Paul Voakes 

Colorado-Boulder 

Past President 

Dean Kruckeburg 

North Carolina, Charlotte 

Chair, PF&R Committee 

Marcia W. DiStaso 

Florida 

Chair, Research Committee 

Chris Roush 

North Carolina at Chapel Hill 

Chair, Teaching Committee 

Patricia Moy 

Washington 

Chair, Publications Committee 

Heloiza Herscovitz 

California State, Long Beach 

Chair, Council of Divisions 

Katie Foss 

Middle Tennessee State 

Vice Chair, Council of Divisions 

Marquita Smith 

John Brown 

Chair, Commission on the 

Status of Minorities 

Candi Olson 

Utah State 

Chair, Commission on the 

Status of Women 

Nancy Green 

Southern Newspaper Publishers 

Chair, Council of Affiliates 

Sonya Duhé 

Loyola-New Orleans 

ASJMC President 

Thor Wasbotten 

Kent State 

ASJMC President-Elect

4 

2017-18 ASJMC Executive Committee 

Sonya Forte Duhé 

Loyola 

President 

Thor Wasbotten 

Kent State 

President-Elect 

James Stewart 

Nicholls State 

Vice President 

Maryanne Reed 

West Virginia 

Past President 

Dorothy Bland 

North Texas 

Chair, ACEJMC Representatives 

Mary Jean Land 

Georgia College & State 

Program Representative 

Alan Stavitsky 

Nevada-Reno 

Program Representative 

Gracie Lawson-Borders 

Howard 

BCCA Representative 

Jennifer Greer 

Alabama 

President

AEJMC Publications Editors 

5 

Jami Fullerton 

Oklahoma State 

Journalism & Mass 

Communication Educator 

Linda Steiner 

Maryland 

Journalism & 

Communication Monographs 

Louisa Ha 

Bowling Green State 

Journalism & Mass 

Communication Quarterly 

AEJMC/ASJMC Central Office Staff 

Jennifer H. McGill 

Executive Director 

34 years with AEJMC/ASJMC 

K. Anthony 

Website Content Manager 


Amanda Caldwell 

Conference Coordinator 


Lillian Coleman 

Progects Manager 


Felicia Greenlee Brown 

Desktop Publisher 


Janet Harley 

Office Assistant 


Samantha Higgins 

PR/Marketing Specialist 


Belinda Pearson 

Business Manager 


Pamella W. Price 

Membership Manager 

32 years with AEJMC/ASJMC

6 

Conference Information 

Special Events 

There is one special event during the conference that 

requires a ticket: 

• AEJMC/Kappa Tau Alpha Awards Luncheon: 

11:45 a.m. Tuesday — Congressional Hall A. 

Opening Reception: 

8:30 p.m. Monday, Congressional Hall. 

AEJMC General Session / Career Development 

Conference delegates should make every effort 

to attend the AEJMC General Session / Career 

Development, which begins at 10 a.m. Wednesday 

in Renaissance Ballroom East. Career Development 

session begins at 11:15 a.m. in the same ballroom. 

Registration/Information 

Conference Registration/Information will be at the 

Registration Counter, Ballroom Level and will operate 

during the hours listed below: 

Saturday 

Sunday 

Monday 

Tuesday 

Wednesday 

Thursday 

6 p.m. - 9 p.m. 

8 a.m. - 7 p.m. 

8 a.m. - 5 p.m. 

8 a.m. - 5 p.m. 

8 a.m. - 5 p.m. 

8 a.m. - Noon 

Messages and Special Announcements 

See the bulletin board near the Registration/ 

Information area in the Ballroom Level, for messages, 

conference updates and/or program revisions. 

AEJMC Appreciates the 

Financial Support from: 

Tote Bags 

Platinum Sponsor 

C-SPAN 

Sustaining Sponsor 

Scripps Howard Foundation 

Mobile App 

Sole Sponsor 

School of Communications 

Elon University 

Nametag Lanyards 

Sole Sponsor 

School of Communication 

Loyola University Chicago 

Give-Away Sponsors 

Cathy Hughes School of 

Communications 

Howard University 

Refreshment Breaks 

General Sponsors 

Mayborn School of Journalism 

University of North Texas 

School of Journalism and Mass 

Communication 

Texas State University 

Cover photo: Washington, DC; USA - The Franklin 

Delano Roosevelt Memorial is a presidential memorial in 

Washington D.C., dedicated to the memory of Franklin 

Delano Roosevelt, the 32nd President of the United 

States, and to the era he represents. Dedicated on May 

2, 1997 by President Bill Clinton, the monument, spread 

over 7.5 acres and traces 12 years of the history of the 

United States through a sequence of four outdoor rooms, 

one for each of FDR’s terms of office.. (source: adobestock.com) 

Child Care Support 

Donald P. Bellisario College of 


Pennsylvania State University 

College of Media, Communication 

and Information 

University of Colorado

Ph.D. in Strategic 

Communication* 

The Ph.D. in Strategic Communication 

at the University of Central Florida 

will not only stand on the cutting 

edge in the field of communication, 

but it will also address the current 

and growing needs of today’s 

world in crisis, risk and health 

communication. 

As the field of strategic 

communication expands and 

develops, demand is growing not only 

for academics, but for professionals 

with strategic communication 

expertise. Join us on our mission to 

improve the safety and quality of life 

through strategic communication. 

*Anticipated Fall 2019 

FOR MORE INFORMATION 

Tim Sellnow, Ph.D. 

Director of Graduate Studies 

timothy.sellnow@ucf.edu 

407-823-3143 

communication.ucf.edu 

Introducing New 

Faculty Member 

Patrice Kohl, Ph.D. 

Assistant Professor 

Environmental and Science 

Communication 

Patrice Kohl, Ph.D., a 

communication scholar 

interested in the way 

people think and talk 

about conservation 

problems, has also 

worked as a reporter for 

two Alaskan newspapers. She holds 

a bachelor’s, master’s and doctorate 

from the University of Wisconsin- 

Madison. 

12405 Aquarius Agora Dr. • Orlando, FL 32816-1344 • 407-823-1711 • communication.ucf.edu

WE ARE A COLLEGE 

OF CREATIVE E MINDS 

At Gaylord College, we believe that innovation begins with a single spark of imagination. 

We invite aspiring scholars and professionals seeking to further their careers to apply to our graduate programs to work alongside 

our world-class faculty in our M.A., Ph.D., and unique Master of Professional Writing (M.P.W.) and graduate certificate programs. Our 

program on the University of Oklahoma’s Norman campus offers nationally competitive funding packages for exemplary graduate 

students in an affordable university community conveniently located near major metropolitan areas. 

Ph.D. 

Drawing upon faculty areas of expertise, 

our doctoral program has the following 

emphases: 

News and Information 

Strategic Communication 

Media Arts 

M.A. 

Four areas of emphasis: 


Creative Media Production 

Journalism 

Media Management 

Our M.A. program offers three degree 

completion options: thesis, project 

and comprehensive examination. 

M.P.W. 

Our innovative program focuses 

on novel writing, nonfiction books 

and screenwriting with the aim of 

producing marketable writers. 

M.P.W. students work with published 

authors on our faculty and must 

complete and defend a feature-length 

screenplay or book manuscript. 

For questions about our 

graduate programs, contact: 

Dr. Peter Gade 

Director of Graduate Studies 

pgade@ou.edu 

Larry Laneer 

Graduate Academic Adviser 

llaneer@ou.edu 

AEJMC ad 2018 redo.indd 2 

5/30/18 9:37 AM

GAYLORD COLLEGE HIGHLIGHTS 

Two Gaylord College doctoral students advised by Dr. Doyle Yoon 

receive American Academy of Advertising dissertation proposal awards 

Doctoral candidate 

Rahnuma Ahmed won 

for her dissertation titled 

“Effects of Interface Type, 

Ad Type and Product 

Type on Consumers’ 

Psychological Responses 

in VR Marketing: 

Mediating Roles of 

Presence and Flow.” 

Doctoral candidate 

Seung Hyun Kim won 

for his dissertation titled 

“The Effects of Ad-block 

Wall Level Reactance, 

Explicit Goal Existence, 

Ad-block Wall Message 

Frame on Unconscious 

Native Ad Processing 

and Online News Media 

Brand Evaluation.” 

FACULTY ACTIVITY 

Dr. Glenn Leshner is a 

co-investigator on a grant 

from the NIH/NCI to continue 

his research in tobaccocessation 

messages with 

other prominent health 

communication researchers 

from around the U.S. 

The U.S. State Department 

awarded Dr. Elanie Steyn 

and Dr. Joe Foote a grant 

to continue their work with 

journalists and economic 

empowerment in 

South Asia. 

Dr. Robert Kerr’s book How 

Postmodernism Explains 

Football and Football Explains 

Postmodernism won the 2017 

Outstanding Book Award of 

the National Communication 

Association’s Communication 

and Sport Division. 

Dr. Fred Beard’s latest book 

Comparative Advertising: 

History, Theory and Practice will 

be released this summer. 

NEW APPOINTMENTS AND HIRES 

Debbie Yount 

Paul D. Massad 

Chair of Strategic Planning 

Larry Powell 

Adviser and Instructor, 

Lindsey + Asp, 

a student-run strategic 

communications agency 

Ray Claxton 

Assistant Professor in 

Advertising 

Art Direction and 

Visual Storytelling 

Tom Patten 

Assistant Professor in 

Advertising 

Copywriting and Creative 

Storytelling 

#OUCovers18Unfiltered 

In March, nearly 100 Gaylord College students revived 

our 2016 national election coverage experiential 

learning project #OUCovers16 and joined news 

organizations from across the state of Oklahoma for 

real-time coverage of the two-week historic Oklahoma 

teacher walkout. The collaborative project created the 

largest newsgathering organization in the state, drew 

upon students across our degree programs, and kicked 

off coverage of the 2018 midterm elections. 

AEJMC ad 2018 redo.indd 1 

5/30/18 12:19 PM

2017-18 AEJMC Elected Standing Committee Members 

PROFESSIONAL FREEDOM 

AND RESPONSIBILITY 

PUBLICATIONS 

RESEARCH 

TEACHING 

Dean Kruckeberg* 

North Carolina, Charlotte 

Hong Cheng 

Virginia Commonwealth 

Carolina Acosta-Alzuru 

Georgia 

Carolyn Bronstein 

DePaul 

Denise Bortree 


Hubert Brown 

Syracuse 

Jennifer Burleson Mackay 

Virginia Tech 

Mia Moody-Ramirez 

Baylor 

Wendy N. Wyatt 

St. Thomas 

Patricia Moy* 

Washington 

Debashis “Deb” Aikat 

North Carolina, Chapel Hill 

Pat Curtin 

Oregon 

Daniela Dimitrova 

Iowa State 

Carolyn Lin 

Connecticut 

Wilson H. Lowrey 

Alabama 

Paula M. Poindexter 

Texas at Austin 

Scott Reinardy 

Kansas 

Karen Miller Russell 

Georgia 

Marcia DiStaso* 

Florida 

Jisu Huh 

Minnesota 

Nikki Usher 

George Washington 

Serena Carpenter 

Michigan State 

Amy Jo Coffey 

Florida 

George Sylvie 


Maria E. Len-Rios 

Georgia 

Richard Waters 

San Francisco 

Tim P. Vos 

Missouri-Columbia 

Chris Roush* 

North Carolina, Chapel Hill 

Linda Florence Callahan 

North Carolina A&T 

Raluca Cozma 

Iowa State 

Jennifer Jacobs Henderson 

Trinity 

Marcus Messner 

Virginia Commonwealth 

Mary Rogus 

Ohio 

Carol Schwalbe 

Arizona 

Amanda Sturgill 

Elon 

Karen Turner 

Temple 

*denotes chair of committee 

Make media. Make a difference. 

Earn a Master’s in Public Interest Media and Communication 

at the Florida State University School of Communication 

comm.cci.fsu.edu/PIMC

BYU School of Communications Adding Up 2017 – 2018 

1186 students 

with23full-time faculty members 

1 Teahan award for 

outstanding PRSSA chapter 

33years accredited by ACEJMC 

1 faculty member named 

to the ACEJMC Council 

85years of teaching 

communications at BYU 

7Hearst award 

top 20 finalists 

50percent of BYU students 

have lived outside the United States; 

65percent speak 

a second language 

4 award-winning 

mentored media labs 

6national gold ADDYs and 

back-to-back AAF best of show 

We’re more than 

a bunch of numbers. 

BYU School of Communications 

Inspiring Learning 

360 BRMB · Provo, UT 84602 

801-422-2997 

comms.byu.edu

Visit our booth for up to 40% off and free shipping! 

New and forthcoming volumes in the series 

The History of Communication 

Congratulations to 

Fred Carroll! 

Winner of the AEJMC History 

Division Book Award for 

Race News 

Black Journalists and the 

Fight for Racial Justice in the 

Twentieth Century 

FRED CARROLL 

PAPERBACK $27.95; E-BOOK 

Newspaper Wars 

Civil Rights and White 

Resistance in South Carolina, 

1935–1965 

SID BEDINGFIELD 


Across the Waves 

How the United States and 

France Shaped the 

International Age of Radio 

DEREK W. VAILLANT 


Becoming the Story 

War Correspondents 

since 9/11 

LINDSAY PALMER 


Media, Geopolitics, 

and Power 

A View from the Global South 

HERMAN WASSERMAN 


Wired into Nature 

The Telegraph and the 

North American Frontier 

JAMES SCHWOCH 


Mister Pulitzer and 

the Spider 

Modern News from Realism 

to the Digital 

KEVIN G. BARNHURST 

NEW IN PAPERBACK $24.95; E-BOOK 

 

The Rise and Fall of the 

Associated Negro Press 

Claude Barnett’s 

Pan-African News and 

the Jim Crow Paradox 

GERALD HORNE 


In Search of Belonging 

Latinas, Media, and 

Citizenship 

JILLIAN M. BÁEZ 


Latinos in Chicago and the Midwest 

Available October 2018 

Mascot Nation 

The Controversy over 

Native American 

Representations in Sports 

ANDREW C. BILLINGS AND 

JASON EDWARD BLACK 


www.press.uillinois.edu

Zayed University 

Dubai and Abu Dhabi, United Arab Emirates 

Celebrates its 20 Year Anniversary: 1998 – 2018 

College of Communication and Media Sciences 

Welcomes incoming Dean Dr. Dwight E. Brooks 

Dr. Dwight E. Brooks joins the Zayed University College of Communication 

and Media Sciences as Dean in Fall 2018. Dr. Brooks previously served as the 

Vice Dean at the Lawrence Herbert School of Communication at Hofstra 

University. He also held positions at the School of Journalism at Middle 

Tennessee State University, Jackson State University and the University of Georgia. 

Welcome Dr. Brooks!! 

Special Thanks to Former CCMS Deans and AEJMC Members 

Judy Turk Janet Keefer Ken Stark Marilyn Roberts Pam Creedon 

1999-2002 2002-2004 2004-2009 2009-2015 2015-2018 

Accredited by: Middle States Commission on Higher Education, ACEJMC, International 

Advertising Association and the Commission for Academic Accreditation (UAE) 

Please go to www.zu.ac.ae for more information on the College and employment 

opportunities. For more information on vacant positions: 

https://www.zu.ac.ae/main/en/careers/index.aspx

COLUMBIA UNIVERSITY PRESS 

VISIT US AT THE BOOK EXHIBIT FOR 50% OFF ALL TITLES ON DISPLAY 

Journalism Under Fire 

Protecting the Future of Investigative 

Reporting 

STEPHEN GILLERS 

paper - $28.00 $14.00 

Columbia Journalism Review Books 

Becoming the News 

How Ordinary People Respond to the 

Media Spotlight 

RUTH PALMER 

paper - $35.00 $17.50 

Troubling Transparency 

The History and Future of Freedom of 

Information 

DAVID E. POZEN & MICHAEL SCHUDSON 

paper- $30.00 $15.00 

NGOs as Newsmakers 

The Changing Landscape of 

International News 

MATTHEW POWERS 

paper - $30.00 $15.00 

Reuters Institute Global Journalism Series 

Media U 

How the Need to Win Audiences Has 

Shaped Higher Education 

MARK GARRETT COOPER & JOHN MARX 

paper - $30.00 $15.00 

Journalistic Authority 

Legitimating News in the Digital Era 

MATT CARLSON 

paper - $30.00 $15.00 

800.343.4499 • CUP.COLUMBIA.EDU UMBIA • CUPBLOG.ORG • @COLUMBIAUP

© Calvin and Hobbes (used with permission) 

The flood of fake news and propaganda washing away the nation's informational 

common ground -- and with it, our trust in each other -- isn't receding. The best 

defense? Teaching critical thinking about news and information. 

"Quite simply -- the best roadmap I've seen for 

navigating the twists and turns in the ever-evolving 

media landscape. McManus helps us ferret out the bull 

and the bias, including our own." 

-- Judy Muller, former ABC and NPR journalist, and 

professor of Journalism, University of Southern 

California, Annenberg School. 

"A tour de force for anyone trying to sift through the 

muck and understand the news today." 

-- Robert W. McChesney, Gutgsell Professor of 

Communication, University of Illinois 

“The students appreciated your sense of humor, and the 

relevance. The one complaint they had was my 

placement on the schedule; they found all reading after 

it to be very dull.” 

– Prof. Margot Hardenbergh, Fordham University 

© The Unvarnished Press, 2017 

The first edition won the annual 

research prize of the Society of 

Professional Journalists. 

“The students appreciated the organization of the book 

and the clarity of the writing. You’ve done a great job of 

making a complicated topic understandable. As one of 

the best students noted, ‘it’s like a guide to how to be a 

great reporter.’ Thank you so much for this great book.” 

— Prof. Kathy Bradshaw, Bowling Green State 

University 

“This book does an excellent job of showing why news 

literacy matters, why misinformation and distortions are 

are so prevalent in today’s media, and how to know what to 

trust on the Web, in print and on TV.” 

-- Prof. Jeff South, Virginia Commonwealth University 

For a review copy, see www.unvarnishedpress.org

New in Journalism & Media from Peter Lang Publishing! 

Glo Co io i s 

is S. 

0. 5 | 8-1- -3230-8 ( ) | 78-1- -387 8 ( ) 

J C Sc ol o i S s, Vol. 1 

s o co c o c ow so c , Sc ol so c is jo lis i i iv w 

ssoci io o c io Jo lis ss Co c io ( J C) is . 

is o i i i l z io i i , , oj s ic io s i o l ’s l i co - 

ic io c i i s, c oc o l o s. I lso s s o 

o co ic o s c o i io l sc ol s i co ic o . Usi s 

so c s, o ovi co siv vi o co ic io i s c o si i - 

S s, c ic l . I is s l c o U.S. io l co ic io 

sc ol , c oo o co s s i i io l co ic io , 

lo co ic io co i io o i s. 

ic Jo lis i i i l : 

-C s c iv 

W I . W V / G. C V W OI 

ll i ls, ws, Soci l : Is s - 

i o ? vi U 2 i io 

OI 

ics o i i l , Vol. II 

I V 

i s: oi i o i s 

I sio i s o i 

Cov o 

S U / J I 

lic l io sS , o , C s s: is 

s s 

CI 

20 sio s o Yo | vis i io 

CY J GS/ S 

Sc i i ol c o ol sc s l o 

o ic l io s i s i sS Sc s 

S C Y J. U OY 

i i l ws: o i li io o W l 

Y C 

W 's i ic ow: o -Gov l 

O z io s, Jo liss, l i i 

W 

Receive a ₃₀% discount on all titles on display 

Ask us about examination copies for course use 

l 

li

Sunday Sessions 

21 

21 

“Strengthening Our Community: Working Together to Build Scholars, Educators, and Engaged 

Academic Citizens” / Washington, DC — August 6-9, 2018 

8 a.m. to 5 p.m. / S001 Congressional Hall A 

Advertising Division 

Preconference Session 

Advertising Data and Decisions: The Advertising 

Division Pre-Conference Workshop 

Moderator/Presiding 

Hal Vincent, Elon 

and Marcel Jennings, Virginia Commonwealth 

Panel Topics 

Strategy and Planning Across Multiple Types 

of Media 

Algorithms and Humans: Science, Psychology, 

Believability and Behavior 

Data on the Frontline: Political Campaigns Past, 

Present and Future 

Creating with Science: Data, the Creative Process 

and User Design 

The advertising industry is changing with the availability 

and the complexity of measurable metrics and data. 

Analytics are redefining traditional roles of advertising 

agencies and offering students new career paths in many 

organizations. Explore how data, metrics and analytics 

are introducing new players in the business and redefining 

what is and who does advertising. Pre-registration is 

required to attend. 

Moderating/Presiding 

Jiyoung Cha, San Francisco State 

Panelists 

Dana Chinn, Southern California 

Dale Blasingame, Texas State 

This pre-conference workshop will demonstrate how to 

use leading audience analytics tools, what the key performance 

indicators are, and how to analyze and interpret 

audience data to understand audience engagement and 

achieve media organizational goals. Audience analysis 

has become more data-driven than ever before; thus, the 

ultimate goal of this pre-conference workshop is to help 

AEJMC members keep up to date with the latest industry 

practices while equipping themselves with tangible technical 

skills that are essential for teaching and researching 

audience analytics in the data-driven audience analytics 

era. Pre-registration is required. 

9 a.m. to 4 p.m. / S004 Off-site Capitol Tour 

Religion and Media Interest Group 

Preconference Offsite Tour 

Religion in the Capitol (Off-site) Tour 


Rick Moore, Boise State 

Sunday 

8:30 am to 2:30 pm / S002 Penn Quarter 



Business Session 

Board of Directors 


Jennifer Greer, Alabama, AEJMC President 

9 a.m. to 5 p.m. / S003 Congressional Hall B 

Media Management, Economics and Entrepreneurship 

Division 


Audience Analytics: Social Media and Web 

Analytics Tools, Key Performance Indicators, 

and Data Interpretation 

A tour of important religion-related sites in the capitol 

city, including conversations with communication 

professionals who work at those sites and interact with 

the media. Lunch will be provided. Pre-registration is 

required. 

1 to 5 p.m. / S005 Meeting Room 09 

Communication Theory and Methodology 

and Political Communication Interest Groups 


Fundamentals of Eye-Tracking in Communication 

Research 


Melissa Gotlieb, Texas Tech 

Panelists 

Glenn Cummins, Texas Tech 

Eye tracking is becoming an increasingly popular tool in 

communication research for examining visual attention 

to media in a variety of contexts—advertising, health

22 




communication, political communication, entertainment, 

and more. This workshop will provide an overview of eye 

tracking as well as the opportunity for first-hand experience 

with this measurement tool. Topics include an 

overview of how eye tracking typically works, basic lab 

requirements and setup (including ways to justify costs), 

study designs, and operational measures possible through 

this approach. In addition, the workshop will allow users 

to gain some hands-on experience with calibration and 

data collection. Pre-registration is required to attend. 


Electronic News Division 


Hands-On Mobile Journalism Workshop: 

Tips, Demos and Original Content 


Kim Fox, American-Cairo 

Panelists 

Anthony Andornato, Ithaca 


Allissa Richardson, Southern California 

Neal Augenstein, WTOP 

David Scott, Sling Studio 

This workshop will expose attendees to the content creation 

process using a mobile and creating multimedia 

content. Professors and industry professionals will provide 

participants with concrete knowledge and resources 

to take back to the classroom. No prior knowledge 

required! Pre-registration is required. 


Law and Policy Division 


Emerging Issues in Media Law 

Part I (1p to 2:25p) 

Globalization of Teaching Media Law 


Kyu Ho Youm, Oregon 

Panelists 

Michael Epstein, author, Mass Media Law, 

Southwestern Law School 

Mike Farrell, co-author, Media Law and Ethics, 

Kentucky 

Ashley Messenger, author, A Practical Guide to 

Media Law, American 

Amy Reynolds, co-author, The Law of Journalism 

and Mass Communication, Kent State 

Part II (2:15 to 3:30 p) 

Inside the FCC with Commissioner Mignon Clyburn 


Jared Schroeder, Southern Methodist 

Part II (3:30 to 5p) 

Key Developments in Communication Law, 

2017-2018 


Jonathan Peters, Georgia 

Panelists 

Robert Barnes, Supreme Court correspondent, 

The Washington Post 

Chuck Tobin, partner, Ballard Spahr 

Katie Townsend, legal director, Reporters 

Committee for Freedom of the Press 

Tony Mauro, Supreme Court correspondent, 

The National Law Journal 

Part IV (5:00 to 6:00 p) 

LAWP Teaching Award Winners 


Jared Schroeder, Southern Methodist 

Panelists 

Genelle Belmas, Kansas 

Ben Holden, Illinois 

Nina Iacono Brown, Syracuse 

1 to 5 p.m. / S008 Meeting Room 12-13 

Newspaper and Online News Division 

and Graduate Student Interest Group 


PhD Student/Early Career Workshop 


Edson C. Tandoc, Jr., NTU Singapore 

and Aaron Atkins, Ohio 

Panelists 

Valerie Belair-Gagnon, Minnesota 

Jan Lauren Boyles, Iowa State 

Dane Claussen, Newspaper Research Journal 

Mark Coddington, Washington and Lee


23 



Patrick Ferrucci, Colorado 

Teri Fineman, Kansas 

Avery Holton, Utah 

Jasmine McNealy, Florida 

Nikki Usher, George Washington 

This PhD student/early career preconference will provide: 

1) tips on how to increase your productivity as a 

researcher, 2) practical advice on how to get your scholarly 

work published, and 3) advice on surviving the job 

market. Pre-registration is required to attend. 


Public Relations 

and Mass Communication and Society Divisions 


Advocacy: Perspectives from Practice and Research 

on Public Interest Communication 


Giselle A. Auger, Rhode Island, 

Melanie Sarge, Indiana 

and Stephanie Mahin, North Carolina at Chapel Hill 

Panelists 

Barbara Miller, Gaither 

Lucinda Austin, North Carolina at Chapel Hill 

Morgan Collins, Elon 

Erica Ciszek, Texas 

Melissa Dodd, Central Florida 

Brigitta Brunner, Auburn 

Julia Daisy Fraustino, West Virginia 

Ann Christiano, Florida 

Denise Bortree, Director, Arthur W. Page Center, 


Chuck McCutcheon, Bloomberg 

Matthew Wright, Children’s Hospital Association 

Debra Silimeno, Executive Vice President, 

Hager Sharp 

Mike Fulton, Public Affairs and Advocacy, 

Asher Agency 

This half-day session will bring together practitioners and 

researchers to discuss the role and challenges of advocacy. 

Research presented may be published in a special 

issue of the Journal of Public Interest Communication. 

Sponsored by the Arthur W. Page Center for integrity in 

public communication. Pre-registration is required to 

attend. 


Visual Communication 

and Cultural and Critical Studies Divisions 


Getting Started with Drones with Matt Waite 


Matt Waite, Nebraska 

Now that drones are becoming more common in media 

coverage, how can (and should) J-schools become 

involved? What are the basics and first steps, and how 

can we learn from early adopters? Matt Waite, director 

of the Drone Journalism Lab at the University of 

Nebraska and Washington, DC-based experts will cover 

the ethics of drone journalism, emerging trends and best 

practices, and using drones in a breaking news environment. 

In addition, the workshop will cover how drones 

can address visual and critical topics in journalism and 

storytelling. Pre-registration is required to attend. 


Small Programs Interest Groups 


Beyond the Inverted Pyramid: Student and Faculty 

Development 

Part I — 

Embedding Career Development 

within Communication Curriculum 


TBA 

Panelists 

Dawn Francis, Cabrini 

Jill Van Wyke, Drake 

Part II — 

Linked Courses: Science and Journalism 


Carrie Buchanan, John Carroll 

Panelists 

Carrie Buchanan, John Carroll 

Kalen Churcher, Wilkes University 

Sonya DiPalma, North Carolina Asheville 

Joseph Treaster, Miami 

Vern Williams, Southern Connecticut State 

Sunday

26 




Part III — 

Recruiting Faculty: Strategies for Attracting 

Talented Candidates 


Kelly Bruhn, Drake 

Panelists 

Debbie Davis, Texas Tech 

Deborah Silverman, Buffalo State, The State 

University of New York 

Amanda Weed, Ashland 

Katherine Orloff, Hood 

Part IV — 

The Department Chair: Transitioning into 

a Leadership Role 



Panelists 

Pam Parry, Southeast Missouri State 

Carrie Sipes, Shippensburg 

Michael Smith, Lee 

This four-part workshop focuses on ways to enhance 

student learning and faculty development. Panel presentations 

include: Embedding career development within 

mass communication curriculum, Linking science and 

journalism, Recruiting faculty: Strategies for attracting talented 

candidates, and The department chair: Transitioning 

into a leadership role. Pre-registration is required. 

1 to 5 p.m. / S012 Mount Vernon A 

Lillian Lodge Kopenhaver Center for the Advancement 

of Women in Communication at Florida International 

University, Commission on the Status of Women and 

the AEJMC Council of Affiliates 


Women Faculty Moving Forward: Securing 

the Future 


Lillian Lodge Kopenhaver, Florida International 

and Tracy Everbach, North Texas 

Keynote 

Jan Slater, chief marketing officer, College 

of Business; former dean, Illinois 

Panelists 

Dorothy Bland, North Texas 

Carolyn Bronstein, DePaul 

Jinx Broussard, Louisiana State 

Laura Castaneda, Southern California 

Radhika Parameswaran, Indiana 

This annual workshop with accomplished academics will 

help junior women faculty move forward in their careers 

through mentoring, networking and preparing for tenure 

and promotion and administration and leadership positions. 

By prior application only. 


Google News Lab 

and AEJMC Task Force on Bridges to the Profession 


SPJ / Google News Initiative Workshop 


Sam Stewart, Society of Professional Journalists 

(SPJ) Training for Google News Initiative 

Nicholas Whitaker, Google News Lab 

Deb Aikat, North Carolina at Chapel Hill 

Panelists 

Sam Stewart, SPJ Training Program with Google 

News Initiative 

Deb Wenger, Mississippi 

Nick Whitaker, Google News Lab 

Lara Salahi, Endicott College 


AEJMC is collaborating with the Google News Initiative to 

host this SPJ/Google News Initiative Workshop for media 

researchers and educators like you. Pre-registration is 

required to attend. 


International Communication Division 


Global Migrations and Refugee Crisis: Media Case 

Studies from Five Continents 

2 p.m. to 3:25 p.m. — Part I 


Yusuf Kalyango, Jr., Ohio

28 




Panelists 

Erlis Cela, Beder University, Albania 

Benjamin Dooley, Concordia University, Canada 

Dutta Ankuran, Gauhati University, India 

Kizito De-Paito Oketa, Media Development 

Institute, South Sudan 

Discussant 

Mohammed Al-Azdee, University of Bridgeport 

3:30 p.m. to 5 p.m. — Part II 


Yusuf Kalyango, Jr., Ohio 

Panelists 

Pervez Khan, Kohat University of Science & 

Technology, Pakistan 

Roberta Muchangwe, University of Zambia, Zambia 

Xin Zhao, Dalian University of Foreign Languages, 

China 

Elamnira Samah Saleh, Cairo University, Egypt 

This panel brings together scholars and professional 

journalists from five countries (Greece, Italy, Poland, 

Bangladesh, Syria, Pakistan, Tunisia, Egypt, Nigeria, 

Mexico, Germany, and the United States) to reflect on the 

global refugee crises and contemporary migration issues, 

beyond the economic and labor refugee-to-migrations. 

The panel will be split into two 90-minute workshops. 

Each 90-minute session will have speakers that will 

discussion the point of views of recipient nations and 

countries with an exodus of fleeing citizens. Panelists 

will discuss the extent to which global media report on 

refugee and migrant issues such as the pros and cons 

of international resettlements, asylum seeking, migration 

policies, refugee protections/safety, conflicts and 

human rights issues, and several other issues and protocols. 

The pre-conference organizers from the Institute for 

International Journalism at Ohio University and the Study 

of the U.S. Institute [SUSI] on Journalism and Media will 

sponsor the pre-conference. 

3:30 pm to 10 pm / S015 Penn Quarter 




Council of Division Assessment Interviews 


Heloiza Herscovitz, chair, Council of Divisions; 


5 to 6 p.m. / S016 Mount Vernon B 

Lillian Lodge Kopenhaver Center for the Advancement 

of Women in Communication at Florida International 

University, Commission on the Status of Women and 


Preconference Session: 

Kopenhaver Reception 

Moderating/Presiding: 

Lillian Lodge Kopenhaver, Florida International 

All past and present Kopenhaver Center Fellows are welcome 

to join us for this reception and informal networking 

time. Thank you to the Scripps Howard Foundation 

for their sponsorship. 

5:30 to 10 p.m. / S017 Meeting Room 07 

Internships and Careers Interest Group 


ICIG Bootcamp: The Nuts and Bolts of Creating 

a Successful Internship Program 


Karen Theveny, Pennsylvania State Brandywine 

This workshop is geared toward those who are new to 

supervising student internship programs and, also those 

who are looking to revamp their programs based on the 

changing climate of US based internships. ICIG leadership 

will provide a variety of needed resources and best 

practices to help your program facilitate valuable training 

for your students. We will also be looking at recent 

data from employers regarding the necessity of successful 

internships. 

5:30 to 10 p.m. / S018 Meeting Room 04 

Association for Education in Journalism and Mass 

Communication Elected Standing Committe on 

Publications 


Getting Published: The Fallacies and the Realities 

Part I — 5:30 to 6:30 p.m. 

Working with the Editor: Is Your Journal Right 

for Me? 


Anthony Moretti, Robert Morris


29 



Panelists 

Louisa Ha, Bowling Green State 

Nete Kristensen, University of Copenhagen 

Chuck Lubbers, South Dakota 

Ford Risley, Pennsylvania State 

This part addresses issues such as communicating with an 

editor from the beginning of the submission process and 

determining if a particular journal is a fit for your work. 

Part II — 6:40 to 7:40 p.m. 

The Waiting Game: I’ve Submitted My Manuscript. 

Now What? 

or those that require further elaboration can be answered. 

All of us know the importance in getting our research 

published. Professional growth and personal satisfaction 

follow when our manuscript or creative project is accepted 

into a relevant journal or other forum. Important 

considerations come into play during this submission and 

evaluation process. This pre-conference workshop brings 

together AEJMC journal editors to discuss these, and 

other, questions. Pre-registration is required to attend. 

6:30 p.m. / S019 Meeting Room 03 

Sunday 


Bey-Ling Sha, San Diego State 

Panelists 

Dane Claussen, Shanghai International Studies 

University 

Jami A. Fullerton, Oklahoma State 

Justin Walden, North Dakota State 

This part addresses issues such as explores how editors 

assign reviewers to your research and the practical issues 

reviewers consider when they look at your work. 

Part III — 7:50-8:50 p.m. 

Ethics, Shmetics. No, Ethics Really Matters 


Sandy Utt, Memphis 

Panelists 

Wat Hopkins, Virginia Tech 

xtine burrough, Texas at Dallas 

Patrick Plaisance, Colorado State 

This part examines how authors can fall into ethical traps 

during the submission process and how the Committee 

on Publication Ethics and AEJMC are working to create 

uniform research guidelines for the association. 

Part IV — 9:00-10:00 p.m. 

A Roundtable Conversation with the Editors 


Jack Zibluk, Tennessee-Chattanooga 

Panelists 

Anthony Moretti, Robert Morris 


Sandy Utt, Memphis 

This part allows for an open forum in which questions 

that were not addressed in any of the previous sessions 



Movie Showing 

AEJMC Night at the Movies: “The Post” 

Join your colleagues for popcorn and lemonade in the 

city where it happened.

THE S.I. NEWHOUSE SCHOOL OF PUBLIC COMMUNICATIONS 

AT SYRACUSE UNIVERSITY IS PROUD TO WELCOME 

FOUR NEW FACULTY MEMBERS: 

Shelvia Dancy 

Professor of Practice 

Broadcast and Digital Journalism 

Shaina Holmes 


Television, Radio and Film 

Brad Horn 



J. Elliott Lewis 


Broadcast and Digital Journalism 

Educating today’s best students for tomorrow’s media. 

newhouse.syr.edu

Where will you be in 2019? 

If you have a talent for reporting, photojournalism, digital/social media or news design and graphics, consider spending next 

summer with us. The Indianapolis Star and The Arizona Republic, Gannett Co. newspapers, are offering an exciting and 

demanding fellowship program. 

The Deadline 

The Candidates 

College juniors, seniors and graduate students enrolled in a related 

degree program as of Nov. 1, 2018 are eligible. Previous newspaper 

journalism internships and/or experience as a journalist on a college 

newspaper are preferred. You need to be committed to a career in 

news journalism. You must have reliable transportation and arrange 

for your own housing. 

All application materials are due by Nov.1, 2018. 

(We may accept some journalism candidates after the deadline.) 

The Schedule 

The 2019 program will run from June 10 through Aug. 16. 

Next Step 

View the instructions and download the application at 

www.indystar.com/pjf. 

Michelle Ye Hee Lee 

•2014-present — Washington Post, 

reporter 

•2010 — 2014 Arizona Republic, 

reporter 

•2010 — Pulliam Fellow, Arizona 

Republic 

•2009 — Chicago Tribune, intern 

•2008 — Creative Loafing, intern 

•2006 — Pacific Daily News (Guam), 

intern 

Amy Bartner 

•2006 — present, Indianapolis Star, 

currently, engagement and utility content 

manager 

•2006 — Pulliam Fellow 

•Saginaw News, intern 

•Birmingham News, intern 

•Bay City Times, intern 

Allison Prang 

•2017-present — Wall Street Journal, 

reporter 

•2016-17 — American Banker, reporter 

2015-16 — Charleston (S.C.) Post and 

Courier, reporter 

•2014 — Pulliam Fellow, Indianapolis 

Star 

•2013 — Wall Street Journal, 

Washington Bureau, intern 

•2013 — Bloomberg News, intern 

More than 600 young journalists have completed the Pulliam Fellowship program since it started in 1974. 

Among the alumni are four Pulitzer Prize winners and journalists working at The Wall Street Journal, 

The New York Times, the Chicago Tribune, The Dallas Morning News and the St. Petersburg Times. 

Journalism Fellowship 

founded in 1974 

Visit our booth at the Vendor Expo to learn more about this opportunity.

WE WELCOME OUR NEW 

COLLEAGUES FOR FALL 2018 

Brianna Clark, PhD 

Clemson University 

Event Management 

Laura Marshall, PhD 

University of North Carolina 

at Chapel Hill 


Kelly Tran, PhD 

Arizona State University 

Digital Media 

Sarah Vaala, PhD 

University of Pennsylvania 


COLLEAGUES WITH NEW ROLES 

Kristina Bell, ABD 

Director of Media Fellows 

Assistant Professor of Digital Media 

Matt Ritter, PhD 

Assistant Professor of 


Jim Scott, MA 

Assistant Professor of the 

Practice of Communication 

NIDO R. QUBEIN SCHOOL OF COMMUNICATION FACULTY 

Kristina Bell 

MA, UNC-Greensboro | Digital Media Communication; Director of Media Fellows 

Vernon Biaett 

PhD, Arizona State University | Event Management 

Nahed Eltantawy 

PhD, Georgia State | Journalism; Women’s Studies; Chair, Communication 

Kate Fowkes 

PhD, Texas-Austin | Film Studies 

Jim Goodman 

MFA, UNC-Greensboro | Electronic Media and Narrative Production 

Stefan Hall 

PhD, Bowling Green | Game/Interactive Media; Chair, Communication 

Bobby Hayes 

PhD, Walden | Journalism; Sport Studies 

Brian Heagney 

M.Arch, Pratt Institute | Game and Interactive Media Design 

Florian Hemme 

PhD, The University of Texas at Austin | Sport Management 

Judy Isaksen 

PhD, South Florida | Critical, Race and Women’s Studies 

Bradley Lambert 

MFA, American | New Media; Documentary; Director of the Graduate Program 

Brandon Lenoir 

PhD, University of Pittsburgh | Political Communication 

Jennifer Lukow 

PhD, Indiana University | Sport Management; Chair, Event and Sport Management 

Curtis B. Matthews 

PhD, Texas Tech University | Strategic Communication 

Patrick McConnell 

PhD, Georgia | Sport Communication 

Virginia McDermott 

PhD, Illinois | Health Communication; Associate Dean & Interim Dean 

Joe Michaels 

BA, Seton Hall | Director, NBC Today Show; Electronic Media Production 

John Mims 

MBA, Pfeiffer University | Strategic Communication 

Rob Powell 

MA, Kent State | Digital Cinematography 

David Radanovich 

MS, Quinnipiac | Strategic Communication; Core Courses Coordinator 

Matt Ritter 

PhD, Regent University | Strategic Communication 

Jim Scott 

MA, UNC-Greensboro | Audio Production 

Dean C. Smith 

PhD, UNC-Chapel Hill | Media Law and Ethics 

Jim Y. Trammell 

PhD, Iowa | Religion and Media 

Phillips Watson 

MBA, Harvard | Strategic Communication 

One University Parkway, High Point, NC 27268 | highpoint.edu/communication 

AT HIGH POINT UNIVERSITY, EVERY STUDENT RECEIVES AN EXTRAORDINARY EDUCATION IN AN INSPIRING ENVIRONMENT WITH CARING PEOPLE. ®

Thank you to our national colleagues and the Advertising Division of AEJMC for 

recognizing what we already know—that Mike Devlin is an exceptional teacher, 

mentor and innovative scholar. The Early Career Award rewards subject mastery, 

classroom management, creation of a positive learning environment and dedication to 

teaching. Our students say things such as “He makes me believe I can be a great advertising 

creative.” We say, we’re very honored to have you on our faculty, Dr. Devlin. 

MikesAd529.indd 1 

5/30/18 3:59 PM

CONGRATULATIONS TO DEAN GRACIE LAWSON-BORDERS ON HER ELECTION AS VICE PRESIDENT OF ASJMC 

CATHY HUGHES SCHOOL OF COMMUNICATIONS SCHOLARS 2017-18 

BARBARA BEALOR HINES RESEARCH AND PROFESSIONAL DEVELOPMENT AWARD 

Congratulations to doctoral students in the Department of Communication, Culture & Media 

Studies (CCMS) awarded research and travel support from the Barbara Bealor Hines Research 

and Professional Development Fund. The fund was established by alumni, friends and family 

to honor the career of Barbara Bealor Hines, HU professor emerita and 2009 AEJMC president. 

Ramal Johnson- Film & History Conference, 

Milwaukee, WI 

Morgan Smalls - National Communication 

Association Conference, Dallas, TX 

MEET FACULTY, GRADUATE STUDENTS AND CCMS ALUMNI PARTICIPATING IN THE CONFERENCE: 

FACULTY: Carolyn Byerly, Jae Eun Chung, Jannette Dates (Emerita), Barbara Hines (Emerita), Natalie Hopkinson, Gracie 

Lawson-Borders, Yong Jin Park, Indira Somani, Carolyn Stroman, Sonja Williams 

GRADUATE STUDENTS: Jasmin Goodman, Brittany-Rae Gregory, Sharifa Sion-Roberts, Morgan Smalls 

CCMS ALUMNI: L. Simone Byrd (Alabama State), Richard Craig (George Mason), Jerry Crawford (Kansas), Bellarmine 

Ezumah (Murray State), Brandale Mills (Norfolk State) 

FOR INFORMATION ABOUT THE FUND CONTACT DR. CAROLYN BYERLY, CHAIR, CCMS AT CBYERLY@HOWARD.EDU OR ONLINE AT WWW.COMMUNICATIONS.HOWARD.EDU.

A.Q. MILLER 

SCHOOL OF 

JOURNALISM 

& MASS 

COMMUNICATIONS 

W E A R E P R O U D T O W E L C O M E O U R N E W D I R E C T O R 

DR. NIKHIL MORO 

Professor Nikhil Moro 

(Ph.D., Ohio State; autumn 

2006) comes to us from 

Norfolk State University, 

where, as chairman, he 

led the Department of 

Mass Communications 

and Journalism to seek 

and receive national 

reaccreditation, gain a stateof-the-art 

digital production 

studio, move into a new 

building, and commit to a 

new strategic plan and a 

new name. 

Moro brings to us a 

proven commitment 

to rigor, relevance and 

accessibility of journalism 

and its education. Before 

his appointment at K-State 

and his leadership at Norfolk 

State, Moro founded 

and directed a research 

collective in South Asian 

Media, Culture & Arts at the 

University of North Texas 

and led collaborations with 

four universities in India. He 

wrote or edited for several 

newspapers, including The 

Networker, Columbus, and 

The Times of India, Mumbai. 

Moro teaches digital media 

law and international 

communication. His 

papers have appeared in 

Image courtesy Kylie Kinley 

First Amendment Studies, 

Journal of Media Law 

& Ethics, and Journal of 

Internet Law, among other 

reputable periodicals. His 

papers have featured at the 

Association for Education 

in Journalism and Mass 

Communication, among 

other leading conferences. 

ONLINE MASTER’S 

PROGRAM BEGINS 

SPRING 2019 

Dr. Moro will lead our 

revitalized graduate 

program that will be 

available online, physically, 

and hybrid in spring 2019. 

Students will tailor a flexible 

program of study and 

work closely with faculty 

members in areas such as 

strategic communication, 

health and science 

communication, community 

media, and digital news. 

K-State offers custom 

degree plans, multi-program 

engagements, small 

class sizes, cutting-edge 

research opportunities, and 

numerous scholarships at 

university and department 

levels. Graduate teaching 

assistantships come with a 

$12,000 annual stipend and 

tuition waiver. 

We invite you to distinguish 

yourself with a Master 

of Science in Mass 

Communications degree 

from K-State’s A.Q. Miller 

School of Journalism and 

Mass Communications.

Welcome to our new faculty: 

Charles H. Sandage 

Department of Advertising 

Department of Journalism 

Dr. Leona Yi-Fan Su, 


Dr. Yee Man Margaret Ng, 


Dr. Nikki Usher, 

Associate Professor 

Congratulations to the additions to our leadership team: 

Stephanie Craft, 

Head, Department of Journalism 

Michelle Nelson, 

Associate Dean for Research 

and Creative Endeavor 

Mike Yao, 

Interim Head, 

Charles H. Sandage 

Department of Advertising 

Join our team! New searches in place. 

Details at https://media.illinois.edu/careers 

Charles H. Sandage Department of Advertising: 

• Assistant Professor of Advertising and Technology 

• Lecturer in Advertising 

Department of Journalism: 

• Assistant Professor in Augmented Reality/Virtual Reality 

• Instructor in Digital and Video Storytelling 

University of Illinois at Urbana-Champaign 

learn more at media.illinois.edu

Department of Communications 

California State University, Fullerton 

One of the nation’s largest comprehensive 

mass communications programs 

An extraordinarily diverse student body of 2,000 students 

specializing in concentrations in journalism, public relations, 

advertising, and entertainment and tourism communications 

70+ full- and part-time faculty members who are leaders in the 

profession and academy 

New Tenure Track Faculty 

2017 and 2018 

Located in the second-largest media market in the country 

with a program focused on high-impact programs, including 

required internships and capstone courses focusing on 

professional practice 

More degrees in Communications awarded to Latino students 

than at any other university in the country 

Awarding winning student media, including a student-run 

newspaper and website, the Daily Titan; a student magazine 

and website, Tusk Magazine; broadcast news shows OC News 

and the Spanish-language Al Dia; and a student radio station 

A student PR/Ad agency, PRactical ADvantage 

Communications, which has become a national model 

An M.A. in Communications with three concentrations: 

Professional Communications, Communications in Tourism and 

Entertainment, Mass Communications Research and Theory 

Chelsea Reynolds 

University of Minnesota 

Teaching journalism and digital 

media and researching media 

representations of sexuality, 

gender, race and sexual health. 

Julio Bermejo 

University of Maryland 

Teaching public relations and 

researching military public affairs, 

intergroup communication and 

social movements. 

Ricardo Valencia 

University of Oregon 

Teaching public relations and 

researching transnational public 

relations, global media, politics, 

and race/ethnicity. 

Accredited since 1971 by the Accrediting Council on 

Education in Journalism and Mass Communication (ACEJMC), 

most recently in 2015, and certified since 2002 by the Public 

Relations Society of America’s Certification in Education in 

Public Relations (CEPR), mostly recently in 2015.

Creating 

change 

with 

ambitious 

ideas. 

Change takes a spark... 

an inspiring idea with the burning 

desire to make it real. 

Change takes courage... 

to take a risk and do something new 

and better, and a little scary. 

Change takes storytelling... 

we use the traditional art and craft 

of building a narrative, and infuse it 

with an understanding of tomorrow’s 

media and today’s audiences. 

Change takes diversity... 

we are inclusive. Because challenges 

to conventional thinking reminds 

us that new ideas come from new 

perspectives. 

Change takes results... 

the final assessment is whether each 

student is prepared for a good career 

in the always-changing world of 

media and culture. 

Change is good. 

Share an idea and 

create change with us! 

www.robertson.vcu.edu 

Dr. Mariam Alkazemi creates 

change with positive enthusiasm 

and by bringing people together. So 

it’s no surprise that her scholarship 

is interdisciplinary. Bridging gaps, 

whether cultural or professional, is 

important to her research. It makes 

the world a more understanding 

place. A change for the better! 

Alix Bryan creates change through 

innovative storytelling. She is an 

award-winning reporter with a 

specialty for integrating traditional 

journalism with new media platforms. 

She has an instinct for the best ways to 

showcase powerful stories that inform 

the community. Change is forging new 

frontiers and learning more skills. 

Jessica Collins creates change 

by motivating students to believe 

in themselves in ways they haven’t 

before. This creates a spark and a 

newfound confidence. She shows 

her inspired and emboldened students 

how to use consumer insights 

and brand strategies to tell familiar 

stories in new ways. 

Judi Crenshaw creates change all 

over the place. In the classroom, she 

brings 28+ years of boots-on-theground 

professional PR experience 

directly to students. She shows them 

how to leverage digital content and 

social media skills. In the community, 

she is President of PRSA Richmond, 

one of the largest regional chapters. 

MEET OUR 

N E W E S T 

COLLEAGUES 

Dr. Kaitlin Hanger creates change 

by pulling creativity out of students. 

Her teaching focuses on design principles. 

Her process is to encourage 

innovation and to trust intuition. 

Kaitlin also brings vast professional 

experiences into the classroom. 

Change happens when new ideas 

meet design, trust, and experience. 

Dr. Cheng Hong creates change 

by mixing together advertising, PR, 

social psychology, and marketing. 

She researches brand activism — 

from consumer boycotts to brand 

evangelism. Sociopolitical issues are 

controversial in most communications; 

Cheng investigates how brands 

and consumers react to them. 

Dr. Nicole O’Donnell creates 

change by exploring how new 

technology can enhance message 

design for health and environmental 

communications. She works in 

partnership with non-profits like 

Room One, Backyard Harvest, and 

the Inland Northwest Healthy Youth 

Collaborative. 

AEJMC_Ad2018_2.indd 1 

5/30/18 12:56 PM

Monday Sessions 

41 

41 



7 to 9:30 a.m. / M001 Penn Quarter 




Finance Committee Meeting 


Marie Hardin, Pennsylvania State, 

AEJMC President-Elect 


Summer Harlow, Houston 

Panelists 

Yusuf Kalyango, Jr, Ohio 

Pei Zheng, Ithaca 

Lea Hellmuller, Houston 

Ammina Kothari, Rochester Institute of Technology 

Juan-Carlos Molleda, Oregon 

Discussant 

Uche Onyebadi, Texas Christian 

Monday 

8:15 to 9:45 a.m. / M002 Congressional Hall A 


Refereed Paper Session 

Broadcast Newsrooms and Technology, 

or a Lack Thereof 



Technical Frames, Flexibility and Online Pressures 

in TV Newsrooms 

Victor García-Perdomo, Universidad de La Sabana 

When Everything Else Fails: Radio Journalism During 

Hurricane Maria in Puerto Rico 

Yadira Nieves, Bruno Takahashi 

and Manuel Chavez, Michigan State 

How Do Lebanese Television Channels Engage with 

Twitter? An Exploratory Study into Its Uses 

Claudia Kozman, Lebanese American University 

and Raluca Cozma, Kansas State 

Prosodic Elements for Content Delivery in Broadcast 

Journalism: A Quantitative Study of Vocal Pitch 

Shawn Nissen, Quint Randle, 

and Jenny Lynnes, Brigham Young 

and Jared Johnson, Oklahoma State 

Discussant 

Laura Smith, South Carolina 

8:15 to 9:45 a.m. / M003 Mount Vernon B 



PF&R Panel Session 

What We Know Now that We Wish We Would 

Have Known Then: Advice from Tenured 

International Faculty for those Entering the U.S. 

Academy 

8:15 to 9:45 a.m. / M004 Meeting Room 03 

Media Ethics Division 

Research Panel Session 

Media Response to Fake News, Ethically 

Listening, and Virtues 


Rhema Zlaten, Colorado State 

Fake News and the Fourth Estate: The Role of Editorial 

Messaging in Repairing the Journalistic Paradigm 

Deborah Dwyer, North Carolina-Chapel Hill 

Ethically Listening to Different Perspectives: News 

Fixers’ Thoughts on the Dangers They Face in the Field* 

Lindsay Palmer, Wisconsin-Madison 

Facebook and the Virtue of Friendship 

Jeffrey Maciejewski, Creighton 

Discussant 

Kimberly Lauffer, Ball State 

* Professional Relevance Award, Special Call Media 

Ethics Division 



Division 


Managing Media in the 21st Century: State-Run 

News, Journalists, and B2B Expenditures 


Ginger Blackstone, Harding

42 




The Economics of State-Run News Media Policy: 

A Case Study of Vietnam 

Huyen Nguyen, Ohio 

and Trung Bui, Vietnam National 

The Impact of Organizational Climate on Trauma 

Suffering in Journalism 

Kenna Griffin, Oklahoma City 

Does Geographical Location Matter in Business-to- 

Business Advertising Expenditure Decisions? Evidence 

from Manufacturing Firms 

Nur Uysal, and Juan Mundel, DePaul 

Discussant 

Cindy Price Schultz, Wyoming 


Minorities and Communication Division 


Crime News and Cross-Language Content 


Hazel James Cole, West Georgia 

_______ Lives Matter: The Impact of Exemplar Race and 

Story Frame on Perceived Issue Severity* 

Robert Jones, Missouri 

An Examination of Non-White Crime Portrayals 

in Local Broadcast News 

Jeniece Jamison, Memphis 

and Stephanie Madden, Pennsylvania State 

Racist Media Representations of Police Shootings: 

The Problem of Primary Definition 

Alfred Cotton, Cincinnati 

Ethnicity and Language: A Cross-Language Semantic 

Network Analysis of Tweets 

Jacqueline Oquendo, Ke Jiang, 

and Lance Porter, Louisiana State 

Discussant 

Gabriel Tate, Arkansas State 

* First Place, Student Paper Competition 

8:15 to 9:45 a.m. / M007 Congressional Hall C 

Public Relations Division 

High Density Refereed Paper Session 

Teaching Public Relations 


Katie Place, Quinnipiac 

Teaching Papers 

Visionary Public Relations Coursework: Assessing 

Economic Impact of Service Learning 

in Public Relations Courses 

Chris McCollough, Columbus State 

Discussant: Melissa Janoske, Memphis 

Does Your PR Course Syllabus Excite, Intrigue, 

and Motivate Students to Learn? 

Gee Ekachai, Young Kim 

and Lauren Olson, Marquette 

Discussant: Brigitta Brunner, Auburn 

Is Advertising and Public Relations Pedagogy 

on the “Write” Track?: Comparing Industry Needs 

and Educational Objectives 

Amanda Weed, Ohio 

Discussant: Heidi Hatfield Edwards, Florida 

Institute of Technology 

Online Pedagogy: Navigating Perceptions and Practices 

to Develop Learning Communities 

Carolyn Kim, Biola and Karen Freberg, Louisville 

Discussant: Diana Sisson, Auburn 

Perceptions of Guest Speakers in Strategic 

Communications Courses: An Exploratory Investigation 

Hong Ji, Parul Jain and Catherine Axinn, Ohio 

Discussant: Charles Lubbers, South Dakota 

Great Ideas for Teaching PR (GIFTs) 

Building a Social Learning Flock 

Amanda Weed, Ohio; Karen Freberg, Louisville, 

Emily S. Kinsky, West Texas A&M; 

and Amber L. Hutchins, Kennesaw State 

Analysis of a CDC Campaign 

Laura Willis, Quinnipiac 

Teaching Trolling: Management & Strategy 

Leslie Rasmussen, Xavier 

Sparking Creativity Through Purpose-Driven Storytelling 

Chris Cooney, Washington State 

Looking In to See Out: An Introspective Approach 

to Teaching Ethics in PR 

Regina Luttrell, Syracuse 

and Jamie Ward, Eastern Michigan 

Discussant 

Brigitta Brunner, Auburn 

8:15 to 9:45 a.m. / M008 Congressional Hall B 

Visual Communication Division 


Photojournalism Today: Ethics and Framing


43 




Julianne H. Newton, Oregon 

Capturing the Crisis: A Content Analysis of News 

Photographs of the Syrian Refugee Crisis 

Tamar Gregorian 

and Elizabeth Radley, Southern Mississippi 

The Visual Framing of Immigrants and Refugees 

in U.S. News: Content and Effects 

Scott Parrott, Alabama; Jennifer Hoewe, Purdue; 

Minghui Fan and Keith Huffman, Alabama 

“This Is Still Their Lives:” Photojournalists’ Ethical 

Approach to Capturing and Publishing Graphic/ 

Shocking Images 

Kaitlin Bane and Nicole Dahmen, Oregon 

To Tone or Not to Tone: A Hierarchy of Influences 

Examination of Photojournalistic Image Manipulation 

Patrick Ferrucci and Ross Taylor, Colorado-Boulder 

8:15 to 9:45 a.m. / M010 Meeting Rooms 12-13 

Small Programs Interest Group 

and Community College Journalism Association 

Teaching Panel Session 

Fighting Fair: Teaching Critical Thinking 

and Media Fairness in a Climate of Rage and Rants 


Liz Atwood, Hood College 

Panelists 

Doug Mendenhall, Abilene Christian 

Marquita Smith, John Brown 


Toni Albertson, Mount San Antonio College 

Monday 




RMIG Top Paper Session 


Brian J. Bowe, Western Washington 

Media as Religion: Practices of Mediation 

in a Catholic Community in South India* 

Subin Paul, Iowa 

and Deepika Rose Alex, Jawaharlal Nehru University 

The God Card: Strategic Employment of Religious 

Language in U.S. Presidential Discourse** 

Ceri Hughes, Wisconsin-Madison 

True Believers, Poseurs, and Becoming “Woke”: Portrayals 

of Religion in Netflix’s Orange Is the New Black*** 

Erika Engstrom, Nevada-Las Vegas 

and Joseph Valenzano, Dayton 

What Would Jesus Do in Cyberspace?**** 

David Scott, Utah Valley 

* Top Student Paper Award Winner 

** Second Place Student Paper Award Winner 

*** Top Faculty Paper Award Winner 

**** Second Place Faculty Paper Award Winner 


Accrediting Council on Education in Journalism 

and Mass Communications 

Panel Session 

Accrediting Council Information Session 


Peter Bhatia, Detroit Free Press, council president; 

Pat Thompson, new ACEJMC executive director 

and Amy Webb, founder and CEO, The Future 

Today Institute 

Introduction of Thompson and presentation and Q&A on 

ACEJMC’s newly proposed voluntary Digital Certification 

for accredited schools; plus, updates and general 

information topics. 


Google News Lab University Network 

Roundtable Session 

Networking Breakfast 


Nicholas Whitaker, Manager, Training 

and Development, Google News Lab 

By invitation only.

44 




8:15 to 9:45 a.m. / M013 Meeting Rooms 10-11 

University of Hawai’i/Carol Burnett Fund for 

Responsible Journalism/Media Ethics 


Roundtable on Indigenous Values, Practices 

and News Media 


Ann Auman, Hawai’i 

Panelists 

Cristina Azocar, San Francisco State 

Victoria LaPoe, Ohio 

Rebecca Tallent, Idaho 

Stephen Ward, British Columbia 

10 to 11:30 a.m. / M014 Mount Vernon A 

Advertising and Public Relations Divisions 


What’s New in Strategic Communication? 

Advancing Innovation in Public Relations 

and Advertising Education 


Allen Richards, Florida International 

Panelists 

Kathy Fitzpatrick, American 

Jami Fullerton, Oklahoma State 

Alice Kendrick, Southern Methodist 

Paula Weissman, American 

10 to 11:30 a.m. / M015 Grand Ballroom South 

Communicating Science, Health, Environment and 

Risk Division and Community Journalism Interest 

Group 

Scholar-to-Scholar Refereed Poster Paper Session 


Risk Division 

Group I — Practices and Perspectives on Strategic 

Health Messaging 

1. A Communication Inequalities Approach to 

Disparities in Physical Activities: The Case of the 

VERB Campaign 

Macarena Pena-y-Lillo, Universidad Diego 

Portales 

and Chul-joo Lee, Seoul National University 

2. Shall We? Let’s Move! 

Aqsa Bashir, Florida 

3. Adopting an Affirmative Consent Definition 

in Sexual Assault Prevention Programming 

on College Campuses 

Rebecca Ortiz, Syracuse 

4. The Effects of Social Norms and Role Model 

Messages on College Women’s Intentions to Refuse 

Unwanted Alcohol 

Nicole O’Donnell, Virginia Commonwealth 

5. Resisting Stigma and Evaluating Realism in Directto-Consumer 

Advertising for Psychiatric Drugs 

Tara Walker, Colorado-Boulder 

6. How Perceived Similarity Moderates Sympathy 

and Pride Appeal Organ Donation Messages 

Sining Kong and Yu Hao Lee, Florida 

Group II — Exploring the Impacts of SHER News 

Coverage 

7. Understanding the Role of Gatekeeping 

in New England Journalists’ Priorities 

for Reporting on Aquaculture 

Kevin Duffy, Laura Rickard, 

and Paul Grosswiler, Maine 

8. Journalists, Policy, and the Role of Evidence 

in the News 

Nicole Gesualdo and Matthew Weber, Rutgers 

9. Perceived Scientific Agreement as a Gateway Belief 

Leading to Pro-Environmental Behaviors: The Role 

of Balanced Reporting and Conflicting Comments 

on Facebook 

Tsung-Jen Shih, National Chenghi University 

10. A Systematic Review of Research on News Media 

Coverage of the Environment 

Bruno Takahashi, Anthony Van Witsen, 

Apoorva Joshi, Ran Duan, 

and Wenzhu Li, Michigan State 

Group III — Health and Social Media 

11. A Content Analysis of e-Cigarette Brand Messages 

on Social Media 

Jordan Alpert, Huan Chen 

and Alyssa Jaisle, Florida 

12. Counter Self-Objectification Induced Appearance 

Anxiety: Testing Persuasion Resistance 

Strategies on Objectifying Social Media Content 

Xizhu Xiao, Washington State 

13. Folk Theorizing the Quality and Credibility 

of Health Apps 

Shaheen Kanthawala, Eunsin Joo, 

Anastasia Kononova, Wei Peng 

and Shelia Cotten, Michigan State


45 



14. Time to Work Out! Examining the Behavior Change 

Techniques and Relevant Theoretical Mechanisms 

that Predict the Popularity of Fitness Mobile Apps 

with Chinese-Language User Interfaces 

Guanxiong Huang, 

and Enze Zhou, City University of Hong Kong 

Group IV – SHER Information Processing 

15. Bringing People Closer: The Pro-Social Effects 

of Immersive Media on Users’ Attitudes and Behavior 

Priska Breves, University of Wuerzburg 

16. Facebook Use, Emotions, and Pro-environmental 

Behaviors: The Mediating Role of Hope and Worry 

Tsung-Jen Shih 

and Wen-wei Chen, National Chenghi University 

17. Autonomy, Competence and Relatedness 

in Online Health Information Seeking 

Seow Ting Lee, Colorado-Boulder 

18. Exploring the Antecedents of Online Information 

Seeking and Sharing in a Public Health Crisis 

Bitt Beach Moon, Indiana; 

Chang Won Choi, Innocean Worldwide; 

and Sung-Un Yang, Indiana 

19. Risk Perception, Efficacy Belief, and Safety Climate: 

Use of Risk Perception Attitude Framework to 

Examine Information Seeking for Workplace Health 

and Safety Among Flight Attendants 

Timothy Fung, Hong Kong Baptist 

20. Framing Obesity: Effects of Obesity Labeling 

and Prevalence Statistics on Public Perceptions 

Jiawei Liu, ByungGu Lee, Douglas McLeod 

and Hyesun Choung, Wisconsin-Madison 

Group V – Global Perspectives on SHER Issues 

21. A Cross-Cultural Comparison of Positive 

and Negative Vaccine Attitude Predictors 

in Singapore and the United States 

Wei Yi Kong, Christopher Cummings 

and David Berube, North Carolina State 

22. Applying the Planned Risk Information Seeking 

Model to Examine Public Engagement 

with Genetically Modified Foods in China 

Nainan Wen, Nanjing University 

23. Vulnerable Live Patients, Powerful Dead Patients: 

A Textual Analysis of Doctor-Patient 

Relationships in Popular Chinese Medical Dramas 

Li Chen, West Texas A&M 

24. The Politics of Environmentalism and Resistance 

to Media Advocacy of Pro-Environmental Civic 

Engagement in South Korea 

Hyunjung Kim 

25. The Impact of Source Credibility and Risk Attitude 

on Individuals’ Risk Perception toward GM Foods: 

Comparing Young Millennials in the U.S. and China 

Ruoyu Sun and Juan Meng, Georgia 

26. Seatbelts Don’t Save Lives: Discovering 

and Targeting the Attitudes and Behaviors 

of Young Arab Male Drivers 

Susan Dun 

and Amal Ali, Northwestern University in Qatar 

Group VI – The Power of Social Networks in Health 

Communication 

27. Third-person Effects of Conflicting Information 

about Childhood Vaccinations: Role of Health 

Locus of Control and Issue Importance in Predicting 

Individuals’ Support for Immunization Requirements 

Robert McKeever, Joon Kyoung Kim, 

Jo-Yun Queenie Li, 

and Taylor Jing Wen, South Carolina 

28. The Crucial Role of Friends in Health 

Communication 

Klaus Schoenbach 

and Marium Saeed, Northwestern, Qatar 

29. Man Shall Not Live by Bread Alone: Emotional 

Support and Health Outcomes of Low-Income 

Adults 

Kang Namkoong, Samantha Stanley, 

and Jiyoun Kim, Maryland 

Group VII – A Focus on Environmental Communication 

30. Attribution and Attributional Processes 

of Organizations’ Environmental Messages 

Sumin Shin, Wisconsin-Whitewater 

and Eyun-Jung Ki, Alabama 

31. Campus Sustainability: An Integrated Model 

of College Students’ Recycling Behavior 

on Campus 

Moonhee Cho, Tennessee 

32. Processing Victim Portrayals: How Multiple 

Emotions and Victim Perceptions Influence 

Collective Action for Environmental Justice 

Hang Lu, Cornell 

33. Green Dress Reactance: Examining the Identity 

Threat and Resistance to Persuasion 

Yanni Ma, Washington State 

34. Encouraging Safe Wildlife Viewing in National 

Parks: Effects of a Risk Communication Campaign 

on Visitors’ Behavior 

Katie Abrams, Colorado State 

Group VIII – Advances in SHER Theory and 

Methodologies 

35. Engagement in Cancer Screening: Theoretical 

Exploration Using A Meta-Analytical Structural 

Equation Modeling Approach 

Guangchao Feng, Shenzhen University; 

Zhiliang Lin, Jinan University; 

Wanhua Ou, 

and Xianglin Su, Shenzhen University 

Monday

46 




36. Health Behavior Intention: A Concept Explication 

Ciera Dockter, Missouri 

37. Hope in the Depths of Despair: Theorizing about 

Hope in the Fear Appeal Context 

Hanyoung Kim, Yen-I Lee, 

and Jeong-Yeob Han, Georgia 

38. The Role of Risk, Efficacy, and Worry in College 

Students’ Health Insurance Information Seeking: 

Applying the Risk Perception Attitude (RPA) 

Framework 

Hyeseung Koh, Texas at Austin; 

Sara Champlin, North Texas; 

and Amanda Mabry-Flynn, Illinois at Urbana- 

Champaign 

39. “To Fly Under Borrowed Colours”: Mediated 

Communication and Scientific Ethos 

Cheryl Jorgensen-Earp, Lynchburg College 

and Darwin Jorgensen, Roanoke College 

40. Perceived Barriers and Facilitators in Primary Care 

of Diagnosing Mental Illness in the Geriatric 

Population: A Systematic Review 

Nia Mason, Stephanie Whitenack, 

and Diane Francis, Louisiana State 

41. Exploring Differences in Crisis literacy and Efficacy 

on Behavioral Responses During Infectious Disease 

Outbreaks 

Lucinda Austin, North Carolina at Chapel Hill; 

Brooke Liu, Maryland; 

Seoyeon Kim, and Yan Jin, Georgia 

Group IX – Science and Engagement 

42. Engagement in Science: Exploring the View 

and Engagement Practice of Scientists from Different 

Organizations 

Shupei Yuan, Northern Illinois; 

John Besley, Michigan State; 

and Anthony Dudo, Texas at Austin 

43. Strategic Communication as Planned Behavior: 

What Shapes Scientists’ Willingness to Choose 

Specific Tactics 

John Besley, Michigan State; 

Kathryn O’Hara, Carleton University; 


44. Scientific Societies’ Support for Public Engagement: 

An Interview Study 

Shupei Yuan, Northern Illinois 


45. Mapping Perceived Barriers to Science 

Communication: Inter-issue and Inter-group 

Comparisons 

Lee Ahern, Pennsylvania State; 

Sushma Kumble, Towson; Jeff Conlin 

and Jinping Wang, Pennsylvania State 

Group X – Novel Approaches in Climate Change 

Communication 

46. Environmental Framing on Twitter: Impact 

of Trump’s Paris Agreement Withdrawal 

Announcement on Climate Change and Ocean 

Acidification Dialogue 

Sojung Kim and Sandra Cooke, George Mason 

47. Examining the Effect of Climate Change Images on 

People’s Estimation of Egocentric Psychological 

Distance 

Ran Duan, Bruno Takahashi, 

and Adam Zwickle, Michigan State 

48. Unveiling Psychological Mechanisms of Climate 

Change and Health Message Processing: 

A Mediation Approach 

Sojung Kim, Di Pei, John Kotcher, 

and Edward Maibach, George Mason 

49. The Effects of Format and Language on Information 

Retention of Climate Change News Narratives in 

Digital Presentations 

Christina Childs DeWalt, Florida Atlantic 

50. Shifting Perceptions of Global Warming in 2011 

and 2017 

Shaelyn Patzer, Selena Nelson 

and Marc Trotochaud, George Mason 

51. Latitudes, Attitudes, And Climate Change Agency 

Troy Elias, Mark Blaine, Deborah Morrison, 

and Brandon Harris, Oregon 

Community Journalism Interest Group 

Theme — Norms and Routines in Local News 

52. The Galapagos Syndrome of Korean Local 

Television News: How Regulatory 

Restrictions Alter the Norms and Routines 

of Local Television News Work 

Sung Yoon Ri and Keren Henderson, Syracuse 

Discussant 

Richard Johnson, Creighton 

10 to 11:30 a.m. / M016 Congressional Hall B 

Communication Technology 

and Visual Communication Divisions 


Best of Digital Competition 


Su Jung Kim, Southern California 

and Kevin Ripka, Iowa


47 



Winning Entries 

Category I — Individual/Team/Single Class Website 

First Place: http://www.reenactmag.com/ 

Adam Peruta and Melissa Chessher, Syracuse 

The Political World Within: Conceptualizing Political 

Transportation 

Bryan McLaughlin, John Velez, 

and Joshua Dunn, Texas Tech 

Second Place: https://proudandtorn.com/ 

Bettina Fabos, Leslie Waters, Kristina Poznan, 

Dana Potter, Collin Cahill, Jacob Espenscheid, 

and Isaac Campbell, Northern Iowa 

Third Place: https://relationshipbehaviors.wordpress.com/ 

Marquitta Crichlow, Michigan State 

Discussant 

Jason Peifer, Indiana 

* Second Place Student Paper 

10 to 11:30 a.m. / M018 Congressional Hall A 

Monday 

Category III: Website from Multiple Class/Institution 

First Place: http://mag.syr.edu/syracuse-blocks/ 

City Blocks Staff, Melissa Chessher 

and Jeff Passetti, Syracuse 

Second Place: http://www.brokenplate.net/ 

Joel Beeson and David Smith, Morgan State 

and Jackie Jones and Ron Taylor, West Virginia 

Third Place: http://theywearblue.com/ 

Renée Stevens, Bruce Strong, Steve Davis, 

Ashley Kang, Bryan Cereijo, Kathleen Flynn, 

Jasmine Gomez, Max Jakubowski, Justin Mattingly, 

Samantha Mendoza, Frankie Prijatel, 

Michael Santiago, Sara Wong, 

and Lucy Naland, Syracuse 

Recognition and presentation of winners of 2017 Best of 

Digital Competition. 

10 to 11:30 a.m. / M017 Meeting Room 02 

Communication Theory and Methodology Division 


Narratives: From Fiction to Fact 


Annisa Meirita Rochadiat, Wayne State 

An Enterprise for Magic, Dragons, and Impalas: 

Evaluating and Comparing Multiple Fandoms Through 

A Semiotic Approach* 

Sara Erlichman, Pennsylvania State 

Stepping into the Story Worlds: Modeling the Effects 

of Narratives in Immersive Mediated Environments 

Zexin Ma, Maryland 

The “Affective News” Extended Model (ANEM): A 

Multi-Topic Study of Narrative Persuasion from Political 

Messages 

Silvia Knobloch-Westerwick, Melissa Robinson, 

Rebecca Frazer and Emily Schutz, Ohio State 

Law and Policy and Electronic News Divisions 


FCC v. Pacifica Foundation at 40: Is Its Legacy 

an Enduring One? 


Joseph Russomanno, Arizona State 

Panelists: 

Clay Calvery, Florida 

Angela Campbell, Georgetown 

Harry Cole, Health, Heald & Hildreath 

Robert Corn-Revere, Davis Wright Tremaine 

Ian Punnett, Kansas State 

William R. Davie, Louisiana-Lafayette 


Magazine Media Division 



(Re)defining Magazine Media: Expanded Horizon 

or New Frontier? 


Catherine M. Staub, Drake 

Panelists: 


Kevin Lerner, editor, Journal of Magazine Media, 

Marist 

John Hanc, New York Institute of Technology 

Miglena Sternadori, Texas Tech 

Tim Holmes, Cardiff 

Sharon Bloyd-Peshkin, Columbia-Chicago

48 




10 to 11:30 a.m. / M020 Congressional Hall C 

Mass Communication and Society Division 


Entertainment Media, Audience Engagement, 

Portrayals, and Effects 


William “Kelly” Kaufhold, Texas State 

From Reality to Drama: The Role of Entertainment TV 

Storytelling in Empowering U.S. Hispanic Parents 

Caty Borum Chattoo, American; 

Lauren Feldman, Rutgers; 

and Amy Henderson Riley, American 

Depictions of Asperger’s Syndrome on Prime-Time 

Television: An Intergroup Contact and Social Cognitive 

Theory Approach 

Stephanie Whitenack, David Hamilton 

and Meghan Sanders, Louisiana State 

Content Analysis of Music Alcohol-Abusing Women 

and Controls Associate with “Going Out” versus 

“Staying Home” 

Anastasia Nikoulina, Thomas James, Joshua Sites, 

Edgar Jamison-Koenig, Glenna Read, 

and Robert Potter, Indiana 

Music Use and Genre Choice as Coping Strategies 

for Emotions 

Jewell Davis and Li-jing Chang, Jackson State 

Colorism and Love for Fair Skin: Exploring Digitization’s 

Effect on India’s Arranged Marriage Matrimonial Ads* 

Dhiman Chattopadhyay 

and Sriya Chattopadhyay, Bowling Green State 

Discussant 

Brett A. Borton, South Carolina-Beaufort 

* Second Place, Student Competition 

“They’re Turning the Frogs Gay!” Credibility and 

Attributes of Parasocial Relationships with Alex Jones 

T. Phillip Madison, Emily Covington, 

Kaitlyn Wright, 

and Timothy Gaspard, Louisiana - Lafayette 

Dual Influences of Media Figures on Young 

Undergraduates’ Life Values: The Role of Wishful 

Identification 

Caixie Tu and Stella Chia, City University 

of Hong Kong 

Discussing Vulcans, Hermione, Khaleesi, and the 

Winchesters: An Evaluation of Parasocial Interactions 

in Online Fandom Forums 

Sara Erlichman, Pennsylvania State 

Post-Network Television: Motivations, Behaviors, 

and Satisfaction in the Age of Netflix 

Alec Tefertiller, Kansas State 

and Kim Sheehan, Oregon 

Younger Millennials’ Media Use: A Qualitative 

Gratifications and Media Repertoires Approach 

Danielle Myers LaGree, Kansas State 

and Margaret Duffy, Missouri 

Discussant 

Jack Karlis, Georgia College 

10 to 1 p.m. / M021 National Endowment of the Arts 


Division 

Off-site Tour 

Arts and Entertainment Insights: A Visit to the 

National Endowment of the Arts 


Anthony Palomba, St. John’s 

The National Endowment for the Arts is an independent 

federal agency that funds, promotes, and strengthens the 

creative capacity of our communities by providing all 

Americans with diverse opportunities for arts participation. 

It also conducts its own research surrounding arts 

engagement and consumption. The tour group will meet 

in the hotel lobby and depart promptly at 10:00am. It is 

just under a half hour walk. However, it is also possible 

to walk to Gallery Place in Chinatown and take the M to 

L’Enfant Plaza station and walk a few minutes to NEA. 


Minorities and Communication 

Division and Entertainment Studies Interest Groups 


Teaching Diversity to Mass Communication 

Students in the Trump Era 


Clarence W. Thomas, Virginia Commonwealth 

Panelists 

Greg Adamo, Morgan State 


Hong Cheng, Virginia Commonwealth 

Naeemah Clark, Elon 

Heloiza Herscovitz, California State, Long Beach 

Carolyn Ringer Lepre, Marist


49 




Commission on the Status of Women 

and AEJMC Council of Affiliates 


Under Attack: Threats, Challenges and Gender Bias 

Facing International Female Journalists 


Kim Fox, American University-Cairo 

Panelists 

Threats and Outcomes: What Happens to Women 

Journalists Confronted By Violence? 

Carolyn M. Byerly, Howard 

Resistance and Resilience: How Female Reporters 

and Editors Along the US-Mexico Border Respond 

to Violence Against Journalists 

Celeste Gonzalez de Bustamante, Arizona 

Without A Net: Dangers in Reporting as a Freelancer 

Kimberly Adams, senior reporter, Marketplace 

Challenges and Threats: Women Reporters 

on the Frontlines 

Hannah Allam, national reporter, Buzzfeed 

and Suzanne Franks, City University London 

10 a.m. to 11:30 p.m. / M024 Meeting Room 14 



Use of Site-Supervisor Intern Evaluation Data 

in Program Assessment and Curriculum Development 

Panelists: 

Michelle Ferrier, founder, TrollBusters, Ohio 

Linda Steiner, Maryland 

Chelsea Reynolds, California State-Fullerton 

Jennifer M. Grygiel, Syracuse 

Rhonda Gibson, North Carolina at Chapel Hill 

10 to 11:30 a.m. / M026 Mount Vernon B 

Sports Communication Interest Group 

Refereed Research Paper Session 

New Media, TV and the Olympics 


Rich Johnson, Creighton 

Five Rings, Five Screens?: A Global Examination of 

Social TV Influence on Social Presence and National 

Identity During the 2018 Winter Olympic Games* 

Natalie Brown-Devlin, Texas; 

Michael B. Devlin, Texas State; 

Andrew Billings and Kenon Brown, Alabama 

Controversy, Collisions, and Cries: Contrasting Chinese 

and U.S. Short Track Speed Skating Television Coverage 

in the 2018 Winter Olympics 

Qingru Xu, Ryan Broussard, Sitong Guo, 

and J. C. Abdallah, Alabama 

Comparing Age and Nationality: NBC’s Online Portrayal 

of Female Olympic Figure Skaters 

Elise Anguizola Assaf, Chapman 

Discussant 

Steve Bien-Aime, Northern Kentucky 

Monday 


Karen Theveny, Pennsylvania State, Brandywine 

Panelists 

Grace F. Levine, Quinnipiac 

Charles Lubbers, South Dakota 

Maureen Croteau, Connecticut 

10 to 11:30 a.m. / M025 Meeting Rooms 12-13 

Participatory Journalism and Lesbian, Gay, Bisexual, 

Transgender & Queer Interest Groups 


Taming the Trolls: Preparing Students to Deal with 

Harassment and Abuse Online 


Mark Coddington, Washington and Lee 

* First Place, Faculty Paper Competition 



Communication Task Force on Building Connections 


Task Force Committee Meeting 


Jan Slater, Ohio

50 




10 to 11:30 a.m. / M028 Meeting Rooms 10-11 

Northwestern University in Qatar 

Panel Session 

Media Use in the Middle East: Digital Media 

Consumption and Political Attitudes in Six Arab 

Countries, 2013-2018 


Everette E. Dennis, Dean and CEO, Northwestern 

University in Qatar 

Panelists 

Justin D. Martin, Northwestern University in Qatar 

Dima Khatib, AJ+ 

Shibley Telhami, Maryland 

S. Shageaa Naqvi, Northwestern University in Qatar 

11:45 a.m. to 1:15 p.m. / M029 Mount Vernon A 



Talk to Me: Strategies for Engaging Male, Female, 

and Multicultural Audiences 



An Examination of the Effects of Multicultural Advertising 

Strategies on Consumer Decision-Making Processes 

Carolyn Lin, Connecticut 

and Linda Dam, California State, Dominguez Hills 

Explaining the Success of Femvertising: A Structural 

Modeling Approach 


and Alan Abitbol, Dayton 

Got Muscle? A Longitudinal Study of Masculinity 

in Fragrance Ads in Esquire and GQ 

Laura Beth Daws 

and Justin Pettigrew, Kennesaw State 

Using Anger and Efficacy as A Strategy to Prevent 

Alcohol-Related Sexual Assault: Dissuading Female College 

Students from Excessive Drinking within 

Social Settings 

Jie (Doreen) Shen, Illinois at Urbana-Champaign 

Discussant 

Karie Hollerbach, Southeast Missouri State 

11:45 a.m. to 1:15 p.m. / M030 Meeting Room 05 

Cultural and Critical Studies Division 

and Entertainment Studies Interest Groups 


Voices of Late Night: Shaping Public Knowledge 

and Discourse through a Transition in Politics, 

Comedy, and Outrage 


Stacie Meihaus Jankowski, Northern Kentucky 

Panelists 

Spring-Serenity Duvall, Salem College 

Rosemary Pennington, Miami University 

Jessica Birthisel, Bridgewater State 

Stacie Meihaus Jankowski, Northern Kentucky 

Lori Henson, Indiana State 

11:45 a.m. to 1:15 p.m. / M031 Meeting Rooms 8-9 


Luncheon Teaching Panel 

Getting Mobile Media Into Your Classes Now 


Tony DeMars, Texas A&M-Commerce 

Panelists 

Brant Houston, Illinois 

Gary Kebbel, Nebraska 

David Scott, Sling Studio 


Magazine Media and Media Ethics Divisions 


Whistleblowers, Encryption, and Mass 

Surveillance: Protecting Sources and Press 

Freedom in a Digital Age 


Vanessa Gregory, Mississippi 

Panelists 


Stephenson Waters, Florida 

Patrick Lee Plaisance, Pennsylvania State 

Andy Kroll, senior reporter for Mother Jones, 

Washington D.C.

The College of Communication 

and Information at Kent State 

University is the only college 

in the nation that houses 

media, communication, design, 

technology and information 

programs together in one 

academic unit. 

In 2019, we will hire a 

cluster of faculty to work at 

the intersections of Digital 

Sciences, our newest school, 

and our existing programs in 

our School of Information in 

human-computer interaction/ 

user experience design, data 

science or health informatics. 

Additional interdisciplinary 

positions in the school 

of Journalism and Mass 

Communication include a focus 

on digital media production, 

animation and virtual reality. 

Interested? Email us: cci@kent.edu 

00099S99909U00009S09999129999999999999993000000000000000000000000000044242-00011111||||330-672-2950

52 




11:45 a.m. to 1:15 p.m. / M033 Congressional Hall C 


High Density Refereed Research Paper Session 

Trends in Fake News 


Edson Tandoc, Nanyang Technological 

Fake News and Its Sourcing Patterns 

Soo Young Shin, Michigan State 

Fake News Cues: Examining Content, Source, and 

Typology Cues in Identifying Mis- and Disinformation 

Avery Holton, Utah and Amber Hinsley, Saint Louis 

Fake News: A Concept Explication and Taxonomy of 

Online News 

Maria D. Molina 

and S. Shyam Sundar, Pennsylvania State 

Fact-checking and Facebook Users’ Engagement: 

Debunking Fake News and Verifying Trump’s Claims 

Paul Mena, Florida 

Fake News is Not Controlled in a Controlled 

Environment: An Analysis of China’s Online News 

Lei Guo, Boston University 

Discussant 

Jane Singer, City University of London 

To Share or Not to Share? Credibility, Emotion and False 

News on Twitter 

Haoran Chu, Janet Yang, 

and Jun Zhuang, University at Buffalo 

Conceptualizing Fake News from the Perspective 

of Its Producers 

Craig Robertson 

and Rachel Mourao, Michigan State 

Journalism’s Relationship to Democracy: Roles, 

Attitudes, and Practices* 

David Wolfgang, Colorado State; 

Tim Vos and Kimberly Kelling, Missouri 

Don’t Quote Me: Effects of Named, Quoted 

and Partisan News Sources 

Megan Duncan, Kathleen Culver, 

and Douglas McLeod, Wisconsin-Madison; 

and Christopher Kremmer, University of New 

South Wales, Australia 

Strangers to the Game? Interlopers, Intralopers, 

and Shifting News Production 


and Valerie Belair-Gagnon, Minnesota 

Discussant 


11:45 a.m. to 1:15 p.m. / M034 Congressional Hall B 

Public Relations and Communicating Science, Health, 

Environment and Risk Divisions 


Natural Disasters and Publics: Strategic Crisis 

Communication in the Wake of Hurricanes 

Harvey and Irma 


Jen Vardeman-Winter, Houston 

Panelists 

Krista Rouse, The Weather Company 

Gina M. Eosco, social scientist, Cherokee Nation 

Scott McBride, Coast Guard Public Affairs Officer 

Lucinda Austin, North Carolina at Chapel Hill 

Brian Houston, Missouri 

Kim Golombisky, South Florida 

Jen Vardeman-Winter, Houston 

Discussants 

Erica Ciszek, Texas at Austin 

and So Jung Kim, Southern California 


Participatory Journalism Interest Group 


Conversation and Community to Strengthen 

Journalism and Empower Audiences 


Jeremy Littau, Lehigh 

Can Journalists Make a Difference? How Journalists’ 

Involvement in Comment Sections Affects Perceived 

Journalistic Quality 

Nina Springer and Ina Innermann, LMU Munich 

Citizen Engagement with Live Blogs: Passive 

Consumption Rather than Participation 

Mirjana Pantic, Pace University 

Co-Constructing Journalistic Knowledge with the 

Audience: A Case Study of Sustained Reciprocity* 

Neta Kligler-Vilenchik 

and Ori Tenenboim, Texas at Austin 

“I Love Weather More Than Anybody”: A Digital 

Ethnography of The Weather Channel’s Online Fan 

Community 

Jeremy Shermak 

and Kelsey Whipple, Texas at Austin 

* Second Place Top Faculty Paper

ENDURING 

NATIONAL DISTINCTION 

COLLEGE MEDIA ASSOCIATION/ 

ASSOCIATED COLLEGIATE PRESS 

The Kent Stater / KentWired.com 

First Place / Pinnacle Award: 2017 

Finalist: 2015, 2014, 2013 

TV2 News at 6 

First Place / Pinnacle Award: 2015, 2014 

Finalist: 2017, 2013 

SOCIETY OF PROFESSIONAL JOURNALISTS 

NATIONAL MARK OF EXCELLENCE 

Best Magazine (The Burr) 

Winner: 2017 | Finalist: 2014 

General News, Breaking News, Sports Photography 

Winner: 2016, 2014 | Finalist: 2017, 2013 

PRSSA BATEMAN CASE STUDY COMPETITION 

2nd Place: 2018, 2013 

Honorable Mention: 2017, 2016, 2014 

Six Kent State alumni are part of two 2018 

Pulitzer Prize winning teams, including 

Terry DeMio, ’86, lead writer for 

Cincinnati Enquirer’s “Seven Days of Heroin” 

(Winner, Local News Reporting) 

Pulitzer Prize winner and Kent State 

Professional-in-Residence Connie Schultz, ’79, 

was named the National Society of 

Newspaper Columnists’ 2018 Lifetime 

Achievement Award winner 

Mandy Jenkins, ’04, is a John S. Knight Journalism 

Fellow at Stanford University for 2018-19 

HEARST JOURNALISM AWARDS 

Top 10 in photojournalism since 2013 

Top 20 in intercollegiate competition, 2016, 2017

54 




Discussant 

Lona D. Cobb, Winston-Salem State 

* Top Paper Award 



and Mass Communication and Society Division 


Demystifying the Academic Job Market 


Gregory Perreault, Appalachian State 

Panelists 

Brian J. Bowe, Western Washington 

Michael Longinow, Biola 


Weiwu Zhang, Texas Tech 




PF&R Hot Topics Panel Session 

The Problem from Hell: Covering School Shootings 

in America 


John Jenks, Old Dominion 

Panelists 

Randy Roguski, Metro editor, Sun-Sentinel 

St. John Barned-Smith, reporter, Houston Chronicle 

Kelly McBride, Poynter ethicist 

Evie Blad, managing editor, Education Week 

11:45 a.m. to 1:15 p.m. / M038 Mount Vernon B 


and History Division 


So You Want to Write a Book?: A Survival Guide 

to Writing a Proposal, Finding a Publisher, 

Negotiating a Contract, Finishing the Book, and 

Living Happily Ever After 


Chris Lamb, Indiana University-Indianapolis 

Panelists 

Andrew Billings, Alabama 

W. Joseph Campbell, American 

Kathy Roberts Forde, Massachusetts-Amherst 

Rob Taylor, University of Nebraska Press 



Communication Task Force on Bridges to the Profession 

Task Force Panel Session 

Strengthening Our Community: Closing the Gap 

between Professors and Professionals 


Paul Voakes, 2016-17 AEJMC President; Colorado- 

Boulder 

Strengthening our Community: Working Together to 

Build Scholars, Educators, and Engaged Academic 

Citizens 

Jennifer D. Greer, 2017-2018 AEJMC President, 

Alabama 

Forging Professional Partnerships, A Nationwide Look 

Sonya Forte Duhé, Loyola New Orleans, 2017- 

2018 ASJMC President 

Recognizing Professional Relevance in Academic 

Research 

Jake Batsell, Southern Methodist 

Building Bridges between AEJMC and Professional 

Organizations 

Battinto Batts, Scripps Howard Foundation 

Providing Academics Information and Insights into the 

Workplace 

Nancy L. Green, Southern Newspaper Publishers 

Association 

Inspiring Journalists and Media Leaders 

Vidisha Priyanka, The Poynter Institute 

Engaging Professionals to Share Insights That Inform 

Academics of Themes and Trends 

Paul Parsons, Elon 

Strategies to Close the Gap between Journalists and 

Journalism Educators 

Gina Gayle, Syracuse 

Reimagining New Modes of Inquiry and Establishing a 

Knowledge Base for Our Field 

Deb Aikat, North Carolina, Chapel Hill 

31 Years of the C-SPAN Video Library 

Howard Mortman, C-SPAN 

Google News tools for Trust and Verification, Immersive 

Storytelling, Data Journalism and Data Visualization 

Nicholas Whitaker, Google News Lab

Thfioughfiafinewfijoinfifieducafiionfipfiogfiamfi 

befiweenfiKenfifiSfiafiefiUnivefifiifiy’fifiCollegefi 

offiCommunicafiionfiandfiInfofimafiionfiandfi 

fihefiISITfiInfieficulfiufialfiSchoolfiinfiPafiifi,fi 

Ffiance,fififiudenfififiwillfifipendfifiheifififififififi 

yeafifiinfifihefipfiogfiamfionfiKenfifiSfiafie’fifi 

campufifiinfibeaufiifulfinofifiheafifiefinfi 

Ohio,fififiudyingfiinfionefioffifihefifiopfi 

vifiualfidefiignfipfiogfiamfifiinfifihefiUnifiedfi 

Sfiafiefi.fiTheifififiecondfiyeafi,fifocufiedfi 

onfiinfieficulfiufialfidigifialfifififiafiegy,fiififiafifi 

ISIT’fifiPafiifificampufi.fiSfiudenfififiwillfifihenfi 

complefiefianfiinfiefinfihipfianywhefiefiinfifihefi 

wofild.fiAllficoufifiefifiafiefifiaughfifiinfiEnglifih. 

Thififioppofifiunifiyfiififiidealfifofifififiudenfififi 

whofiafipifiefifiofipufifiuefiglobalficafieefififi 

inficommunicafiion,fiincludingfibufifinofifi 

limifiedfifiofiadvefifiifiing,fiwebfidefiign,fi 

mafikefiing,fipublicfifielafiionfi,fifififiafiegicfi 

communicafiionfiandfidigifialfiinfofimafiion. 

Thofiefiadmififiedfifiofifihefipfiogfiamfi 

mufififibefibilingualfi(Englifihfiandfiafifi 

leafififionefiofihefifilanguage),fiandfifihefi 

pfiogfiamfipfiovidefifioppofifiunifiiefifi 

fiofileafinfiaddifiionalfilanguagefi.fiAfi 

bachelofi’fifidegfieefiinfiafifielevanfifi 

fieldfiifififiecommended,fibufifianfi 

undefigfiaduafiefidegfieefiinfidefiignfi 

ififinofififiequified. 

/E/RN M/RE: WWW.KENT.EDU/////////// 

00004S04004U04V04S4044431444444444444444444445190000000000000044242-00011 330-672-2950

56 




Ways to Bridge the Gap between the Media Industry 

and Academia 

Jennifer Benz, The Associated Press-NORC Center 

for Public Affairs Research at the University of 

Chicago 

Understanding the Power of Media Platforms to Serve 

the Audience 

Tom Rosenstiel, The American Press Institute 

This interactive session will engage conference attendees 

in an open forum to manifest strategies for “Closing the 

Gap: Media, Research and the Profession.” Our goal for 

this session is a fast-paced, informed and participatory 

discussion. Panelists will offer brief remarks, then address 

issues suggested by attendees. 



Communication Elected Standing Committee on 

Teaching 


Best Teaching Practices: Diversity 


Amanda Sturgill, Elon 

First Place 

Immersion Reporting: Civil Conversations 

Jan Larson, Wisconsin – Eau Claire 

Second Place 

Busting Biases by Publishing Cultural Competence 

Guides 

Joe Grimm, Michigan State 

Third Place 

Developing Cultural Intelligence by Leveraging Social 

Media for Experiential Service Learning 

Jennifer Sadler, Mississippi 

Honorable Mention 

“Diversity Style Guide” for Media Ethics 

Sheila Peuchaud, Nevada, Reno 


Chinese Communication Association 


Communication Patterns and Media Behavior 

in Chinese Society 

Moderator/Presiding 

Yong Volz, Missouri 

Panelists 

Explaining the Negatives: How Ideology Affects 

Deviance in News Coverage 

Minghui Fan, Shuhua Zhou 

and Yiyang Zhang, Alabama 

How Chinese and Americans Think About Journalists 

and the Media– A Comparative Look at Perceived Roles 

and Values 

Lars Willnat, Syracuse, Shuo Tang, Indiana, 

Hongzhong Zhang, Beijing Normal; 

and Jian Shi, Syracuse 

Examining Chinese Scientists’ Media Behaviors: 

Institutional Support and Media Experience Predict 

Involvement 

Hepeng Jia, Cornell, Lin Shi, Tsinghua; 

Dapeng Wang, China Research Institute for Science 

Popularization, 

and Zhi’an Zhang, Sun Yat-Sen University 

Working on My Identity: Social Media and Identity 

Work of Organizational Newcomers in China 

Lei Vincent Huang, Hong Kong Baptist University 

Chinese Male Players’ Motivation to Use Video Games 

and their Influence on Gender Prejudice 

Yue Wu and Xu Zhang, University of Chinese 

Academy of Social Sciences 

Discussants 

Bu Zhong, Pennsylvania State, 

and Yong Volz, Missouri 


Foundation for Individual Rights In Education (F.I.R.E) 


Teaching Free Speech Principles in 2018 


Ronald K.L. Collins, Washington School of Law 

Panelists 

David L. Hudson, Jr., Vanderbilt Law School 

Will Creeley, Senior vice president of Legal 

and Public Advocacy, FIRE 

Stephen Solomon, New York University 

Joseph Russomanno, Arizona State 

Join us to discuss a unique approach to teaching free 

speech principles by way of a new eBook with video 

& audio resources titled First Things First–A Modern 

Coursebook on Free Speech Fundamentals by Ronald 

Collins, David Hudson & Will Creeley.

IN 

INTERDISCIPLINARY PH.D. 

4t40ent4State’s4College4of4 

Communication4and44nformation44 

our4doctoral4students4are4uniquely4 

positioned4to4pursue4lines4of4 

inquiry4at4the4intersections4of4mass4 

communication44digital4sciences4 

and4information440hey4can4engage4 

in4research4in4the4emerging4areas4of4 

media, technology and society or 

human information behavior. 

OfifififippfifififififififififiwfifiPfi.D.fififififififififififififi 

fifififififipfifififififififigfifikfifififififififififififififfififififi 

fifififififififififififififififififififififififififififififififififififi 

DfigfififififififififififififififiIfiffifififififififififiJfifififififififififi 

fifififiMfifififififififififififififififififififififiVfifififififi 

fifififififififififififififiDfififigfi. 

Tfifififififififigfi’fifiGfifibfififififififififififiTfifififififiFfifififi 

fifififiwfififififififififififififififififififififififififippfififififififiyfi 

fififififigfigfififififififififififififififipfifififififififififififiwfifififififi 

fifififififififigfififippfififififfififififififififififififififififififififi 

fifififfififififififipfifififififififififififi. 

////N ////: WWW.K/N/.//U/////////////////////// 

00004S04004U04V04S4044431444444444444444444445190000000000000044242-00011111||||330-672-2950

58 




11:45 a.m. to 1:15 p.m. / M043 Congressional Hall A 

Media Innovation Lab, School of Journalism 

and Mass Communication at Texas State University 

Panel Session 

PhDigital Bootcamp: Preparing Future Faculty 

to Lead Innovative Curriculum 


Cindy Royal, Texas State 

Panelists 

Alyssa Fisher, Bowling Green State 

Marina Hendricks, South Dakota State 

Christoph Mergerson, Rutgers 

Meredith Metzler, Wisconsin 

Qun Wang, Rutgers 

The PhDigital Bootcamp recruited doctoral students and 

early career faculty to participate in 10 weeks of online 

modules and a week at Texas State University. The program, 

funded by Knight Foundation, covered product 

management, social media analytics, web development, 

data analysis and visualization and emerging technologies 

of drones and 360 video, addressing these items as 

they relate to both teaching and scholarship. This panel 

will assess program outcomes and discuss the need for 

integration of these topics into doctoral education. 

3 to 3:30 p.m. / M044 Grand Ballroom North 



Refreshment Break 

This break is sponsored by Texas State University. It is 

out of order and should have been listed at 3 to 3:30 p.m. 

1:30 to 3 p.m. / M045 Congressional Hall B 


Communication 


Council of Divisions Business Meeting I 


Heloiza Herscovitz, Council of Divisions Chair, 


1:30 to 3 p.m. / M046 Mount Vernon A 

Advertising and Media Management, Economics and 

Entrepreneurship Divisions 


Media Branding Ecosystems 


Ronen Shay, Wentworth Institute of Technology 

Panelists 

Emotional Engagement: A Quality Indicator 

for Media and Brands? 

Sylvia Chan-Olmsted, Florida 

and Lisa-Charlotte Wolter, Florida/Hamburg 

Media School 

The Persistence of Media Channel Credibility? 

The Role of Media Channel Credibility 

in the Business of Online News Industry 

Su Jung Kim, Southern California 

Networked Brand Building: When Brands Are Too 

Big for Just One Organization to Build 

Ulrike Rohn, Tallinn 

The Internet Audience and the Online Media 

Ecosystem: Implications for Legacy Media Brands 

Harsh Taneja, Illinois at Urbana-Champaign 

Discussant 

Sabine Baumann, Jade 

1:30 to 3 p.m. / M047 Meeting Room 02 



Media Trust and Credibility 


G. Scott Burgess, Wayne State 

Credibility Labels and Perception of Partisan News 

Brands* 

Megan Duncan, Wisconsin-Madison 

It’s Not “Fake” It’s “Alternative”: Experimentally Parsing 

the Effects of Misinformation 

Robert McKeever, Joon Kyoung Kim, 

Susan Rathbun-Grubb 

and Mark Tatge, South Carolina 

Building and Bridging Political Divides 

Reconceptualizing Political Disagreement and Its 

Consequences for Political Tolerance 

David Coppini, Denver


59 



The Messenger is Part of the Message: The Role of 

Expectancy Violations in Media Theory 

Robin Blom, Ball State 

Discussant 

Brett Sherrick, Purdue 


Magazine Media and Visual Communication Divisions 


Teaching Marathon 

* Third Place Student Paper 


Cultural and Critical Studies 

and Communication Technology Divisions 


Internet Behaving Badly: Evaluating Trolls, 

Harassment, and Online Antagonisms in the 

Social Media Landscape 


Jessica Maddox, Georgia 

Panelists 

Sarah Grizzle, Georgia 

Guy Harrison, Youngstown State 

Jessica Maddox, Georgia 




(Social) Media and Politics 


Ginger Blackstone, Harding 

Reactance to Fact Checking: Facebook Users’ Evaluations 

of and Intentions to Share Fake News 

Shawna White, Texas State 

and Nicole Lee, North Carolina State 

Poles Apart: Influence of Ideology, Partisan Social Media 

Use, Discussion and Polarization on Belief Gaps 

Tom Johnson, Heloisa Aruth Sturm, 

Lourdes Cueva Chacón, 

and Jordon Brown, Texas at Austin 

Media Use and Political Participation: A Comparative 

Study of U.S., Kenya, and Nigeria 

Oluseyi Adegbola and Sherice Gearhart, Texas Tech 

Discussant 

Ashley Gimbal, Arizona State 


Carolyn Yaschur, Augustana 

Panelists 

Hackathon Style of Teaching 

Robert Hernandez, Southern California 

Putting Your Minds Together: A New Approach 

to Idea Mapping* 


Using a Student-Engagement Platform 

to Its Full Potential 


Evaluating Collaboration 

Sharon Bloyd-Peshkin, Columbia - Chicago 

Teaching tip title: Documenting Isabel Wilkerson’s 

Seven Phases of the Interview: A Technique to 

Strengthen Interviewing Skills for Feature Writers 

Jacqueline Marino, Kent State 

Reading Dissection and Discussion 

Matt Veto, Lehigh 

Pop Revisions 

Vanessa Gregory, Mississippi 

Teach Innovation without a Net... Resources 

or a Guide 

Robert Hernandez, Southern California 

Artful Storytelling 

Carol Schwalbe, Arizona 

The Werewolves of Bias 

Bob Britten, West Virginia 

Designing Social Media Literacy 

Nicole Dahmen, Oregon 

From Doctor Who to Gilmore Girls: Using Students’ 

Fandoms to Teach Good PowerPoint Design 


Did You Get All of That? Using Camtasia to Create 

Personal Software Demos that Your Students Can 

Easily Follow 

Jay Adams, Virginia Commonwealth 

Nightlab: Bringing Classroom Theory to the Field 

Julian Kilker, Nevada, Las Vegas 

Finding a Portfolio in the Weekly Work 

of a Photojournalism Class* 

James Kelly, Indiana 

Teaching tip title: How to Become a Master 

Photo Editor 

Lei “Tommy” Xie, Fairfield 

* Co-winners, Inaugural “Birgit Wassmuth Excellence in 

Education” Visual Communication Teaching Award 

Monday

60 




1:30 to 3 p.m. / M051 Congressional Hall A 



Social Media, Fake News, and Media Literacy 


Ruoxu Wang, Memphis 

What the Fake?! How Social Media Users Define, Spot, 

and Respond to Fake News 

Edson Tandoc and Darren Lim, Nanyang 

Undesirable Issue Indeed, but No Censorship Please! 

The Third Person Effect in Fake News on Social Media 

Fan Yang, University at Albany, SUNY 

and Michael Horning, Virginia Tech 

Parents, Children, and Social Media: A Study of Value 

Congruence 

Lee Farquhar, Butler; Betsy Emmons, Samford 

and Nia Johnson, Samford 

Creating Agents of Change through Civic Media 

Production, Critical Media Literacy and Experiential 

Learning 

Cindy Vincent and Jennifer Jeffrey, Salem State 

Don’t Believe the Next Tweet: Designing and Testing 

News Media Literacy Interventions for Social Media 

Melissa Tully, Iowa; Emily Vraga, 

and Leticia Bode, Georgetown 

Discussant 

Julia Waddell, West Chester 

Examining Who Political Journalists @mention on 

Twitter 

Brooke Auxier and Kalyani Chadha, Maryland 

Discussant 


* Top Faculty Paper 

1:30 to 4:45 p.m. / M053 National Zoo 


Off-site Tour 

National Zoo Tour 


Christopher Wilson, Brigham Young 

Discussion of comms team’s award-winning approach to 

social media (e.g., #pandastory, Endangered Song) 

Bonus: Zoo tours. Keepers from the Animal Care Sciences 

team will either give demos or animal talks at select animal 

habitats (Lion/Tiger; Amazonia; American Trails or 

Think Tank) for our group. – This one’s for you Richard! 

Distance from hotel: 3 miles. Travel options: Uber/Lyft 

= 17 min. | Metro = 29 mins (3 stops (5 min.) + 25-minute 

walk) Limited to 50 participants. Pre-registration is 

required. 




Twitter’s Role in News 


Matthew J. Haught, Memphis 

All the News That Tweets: Newspapers’ Use of Twitter 

Posts as News Sources from 2009 to 2016* 

Kyle Heim, Shippensburg 

Tweeting Local Sports: Best Practices of a Successful 

Sports Reporter 

Matthew Reavy and Kimberly Pavlick, Scranton 

Sentiment Contagion in the 2016 U.S Presidential 

Election Media Tweet Networks 

Claire Youngnyo Joa, Louisiana State Shreveport 

and Gi Woong Yun, Nevada, Reno 

1:30 to 3 p.m. / M054 Meeting Rooms 12-13 

Scholastic Journalism Division 



Being an Effective Advocate for Legislations 


Mark Goodman, Kent State 

Panelists 

Rebecca Snyder, Maryland-Delaware-DC Press 

Association 

David Cullier, Arizona 

Frank LoMonte, Florida 

Megan Rhyne, Virginia Coalition for Open 

Government 

Jane Kirtley, Minnesota

Congratulates 

the 2018 recipient of the 

Dorothy Bowles Public Service Award 

DONALD K. WRIGHT 

Boston University 

“Dr. Wright’s career has embodied the description of the 

Dorothy Bowles Award for Outstanding Service. His body 

of service at all levels and over time has made him one 

of the leading academics in the field of Public Relations, 

if not the leader in the field. But perhaps most importantly, 

he continues to leverage that service toward the 

betterment of his students, as he has done for 45 years.” 

(Nomination letter) 

The Dorothy Bowles Public Service Award recognizes an AEJMC member who has a sustained 

a significant public-service record that has helped build bridges between academics and professionals in mass 

communication either nationally or locally, and, been actively engaged within the association.

Grady Sports Media student Emily Giambalvo 

interviews an athlete during the 2018 Winter 

Olympic Games in Pyeongchang, South Korea 

Educating students to pursue integrity in storytelling 

THAT’S OUR COMMITMENT 

At Grady College, we are commited to teaching our students the art, 

science and integrity of stories, brands and messaging. We offer 

undergraduate majors in advertising, journalism, public relations and 

entertainment and media studies to prepare students to communicate on 

the global stage. 

To help us further our mission, we welcome the following new faculty in 

Fall 2018: 

Amanda Bright 

Academic 

Professional, 

Journalism 

Grady.uga.edu 

Alexander 

Pfeuffer 

Asst. Professor 

of Advertising 

Glenna Read 

Asst. Professor 

of Advertising 

Sabriya Rice 

Knight Chair 

Health & Medical 

Journalism

Photo: Mark E. Johnson 

A few of the nearly 70 faculty members of Grady 

College, prior to UGA Commencement in May 2018. 

Empowering faculty to impact the lives of our students 


Faculty talent and leadership are the hallmarks of Grady College’s 

transformative community. Our faculty are recognized for their impactful 

leadership by the university community, their innovative research by the 

academic community, their dogged dedication by the student community 

and their profound impact by the professional community. 

We are part of the University of Georgia, a Research I institution, and are 

continually seeking additional team members to continue the Grady legacy. 

Apply now for faculty openings in Fall 2019: 

• Asst. Professor of Journalism (two tenure-track openings) 

• Assoc./Asst. Professor of Journalism (tenure-track opening) 

• Lecturer in Broadcast Journalism 

• Asst. Professor of Public Relations (tenure-track opening) 

• Assoc./Asst. Professor of Advertising (tenure-track opening) 

Grady.uga.edu/employment

Ph.D. student Bryan Trude directs a virtual reality 

study testing the effectiveness of different ways to 

communicate the importance of flu vaccinations. 

Researching communication effectiveness for healthier lives 


Research labs at the cutting edge of 

communication and technology 

At Grady College, students pursuing master’s and Ph.D. degrees engage in 

research and discovery to enhance communication. From communicating 

with virtual reality and eye tracking measurement studies, to social 

media monitoring and listening, our students are leaders in pursuing 

effective messages and stories. 

Grady College’s graduate offerings include: 

• Ph.D. in Mass Communication 

• MFA in Narrative Non-Fiction and Screen Writing (low residency) 

• Certificate in Media Analytics 

• MA in Mass Communication with concentrations in: 

Games & Virtual 

Environments Lab 

(GAVEL) 

SEE Suite 

Social Media 

Listening 

u Advertising 

u Emerging Media (completely online in 2019) 

u Health & Medical Journalism 

u Journalism 

u Public Relations 

Digital Media 

Attention & Cognition 

Lab (DMAC) 

Grady.uga.edu/graduate_studies 

706-542-7833 

anne.hurne@uga.edu

The Media Analytics certificate is designed to be 

completed in conjunction with an M.A. or a 

Ph.D. degree. 

Preparing students to meet demands in rapidly growing industries 


Research labs at the cutting edge of 

communication and technology 

At Grady College, our graduate certificate in Media Analytics meets a 

growing demand for students who are ready to work in fields of audience 

research, programming, marketing and promotions research, sales 

research or public relations and advertising client research. 

Grady’s Media Analytics alumni have found positions with: 

• CBS Station Group, New York 

• CNN, Digital Research and Analytics 

• ESPN 

• Experian 

• Harmonic, China 

Games &• Nielsen Virtual 

Environments Lab 

• TechEdge 

(GAVEL) 

• Raycom Media 

SEE Suite 

Social Media 

Listening 

• Time Inc. 

• Turner Entertainment Networks 

• Viacom 

Grady.uga.edu/media-analytics-certificate 

706-542-7833 

Digital Media 

Attention & Cognition 

Lab (DMAC)

66 




1:30 to 3 p.m. / M055 Mount Vernon B 




History of Black Media 



Panelists 

Sonja Williams, Howard 


Karen Turner, Temple 

Indira Somani, Howard 

Miya Williams, Northwestern 

Natalie Hopkinson, Howard 

1:30 to 3 p.m. / M056 Grand Ballroom South 

Political Communication 

and Graduate Student Interest Groups 

Scholar-to-Scholar Refereed Research Paper Poster 

Session 

Political Communication Interest Group 

Group I — Campaigns and Debates 

1. Manifestations of Authoritarianism in 2016 U.S. 

Primaries: Factors Triggering Innate and Latent 

Authoritarian Tendencies 

Nicholas Browning, Indiana 

2. Debatable Sphere: Major Party Hegemony, Minor 

Party Marginalization in the UK Leaders’ Debate* 

Ceri Hughes, Wisconsin-Madison 

3. Winning Through Words? A Computational 

Linguistic Study of Presidential Candidates’ 

Language Styles on Social Media in the Age 

of Populism 

Weiai (Wayne) Xu, Massachusetts 

and Jayeon (Janey) Lee, Lehigh 

4. Spoofing Presidential Hopefuls: The Roles 

of Affective Disposition, Emotions, and Intertextuality 

in Prompting the Social Transmission of Debate 

Parody 


and Kristen Landreville, Wyoming 

Discussant 

Esther Thorson, Michigan State 

Group II — Issues in the News 

5. Muslims’ Responses to Terrorism News: Perceived 

Journalistic Quality, Discrimination, and Attitudes 

toward the Majority Population 

Desiree Schmuck, Jörg Matthes, 

Christian von Sikorski, 

Mona Rahmanian, 

and Beril Bulat, University of Vienna 

6. Evolution and Issue Ownership of the Issue 

of Digital Privacy 

Ashik Shafi, Wiley College 

7. Banned: How Discriminatory Policy Heightens 

U.S. Muslims’ Identity Centrality and In-Group 

Preferences 

Annisa Meirita Rochadiat, 

and Elizabeth Stoycheff, Wayne State 

8. To Label or Not to Label? Hostile Perceptions 

of Fact-Checks and Their Sources in the United States 

Jianing Li, Jordan Foley, Omar Dumdum, 

and Michael Wagner, Wisconsin-Madison 

9. The Will of the People? Effects of Subjective 

References to Public Opinion by Politicians 

Christina Peter, University of Vienna 

Discussant 

Raluca Cozma, Kansas State 

Group III — Framing and Agenda Setting 

10. Examining How Moral Emotions Mediate the Effects 

of Partisan Media Consumption on Pro-Immigration 

Policy Support 

Rachel Neo, Hawaii, Manoa 

11. A Knight in Sheep’s Clothing: Media Framing 

of the Alt-Right 

Burton Speakman, Kennesaw State 

12. Press and U.S. Policy toward Iran: Studying 

the New York Times, Washington Post and Nuclear 

Negotiations 

Mehdi Semati and Bill Cassidy, Northern Illinois 

and Mehrnaz Khanjani, Iowa 

13. Donald Trump in Visual Dimension: Content 

Analysis of Cross-National Intermedia Agenda Setting 

Tarasevich Sofiya, Liudmila Khalitova, 

Osama Albishri, Spiro Kiousis, 

and Barbara Myslik, Florida 

14. Discursively Empowered and Distrustful: The Impact 

of the Taxpayer Framing on Political Trust 

Volha Kananovich, Iowa 

Discussant 

Janis Page, George Washington 

* Second Place Student Paper


67 



Group IV — News and Engagement 

15. Should the Media Be More or Less Powerful 

in Politics? Individual and Contextual Explanations 

for Politicians and Journalists 

Sebastian Scherr, University of Leuven 

and Philip Baugut, University of Munich (LMU) 

16. Likeminded and Cross-Cutting Talk, Network 

Characteristics, and Political Participation Onlineand 

Offline: A Panel Study 

Jörg Matthes, University of Vienna; 

Franziska Marquart, University of Amsterdam; 

and Christian von Sikorski, Vienna 

17. Please Mind the Platform Gap: How Online News 

Source Impacts Civic and Political Engagement 

Nuri Kim, Andrew Duffy, Edson Tandoc, 

Rich Ling 

and Alice Huang, Nanyang Technological 

18. Partisanship and the Reaction to Sexual Harassment 

Allegations: An Experimental Examination of 

Political Image Repair 

Jonathan Graffeo, Ethan Stokes, 

Kenon Brown and Stephen Rush, Alabama 

19. “Lyin’ Ted,” “Crooked Hillary,” and the “Dishonest” 

Media: Trump’s Use of Twitter to Attack and 

Amplify his Press Coverage 

Ayellet Pelled 

and Josephine Lukito, Wisconsin-Madison; 

Junghwan Yang, Illinois at Urbana-Champaign; 

Fred Boehm 

and Dhavan Shah, Wisconsin-Madison 

Discussant 

Katherine Haenschen, Virginia Tech 

20. Chinese Players’ Participation in Online Games 

and its Influence on Online Social Capital and 

Political Participation 

Yue Wu, Chinese Academy of Social Sciences 

21. “In Spite Of” and “Alongside”: Disillusion and 

Success in Advocacy Communication for the Roma 

Adina Schneeweis, Oakland 

22. The Agenda Opinion Dynamics: Public Opinion and 

Government Attention in Post Handover Hong Kong 

Chuanli Xia 

and Fei Shen, City University of Hong Kong 

Discussant 

Tim Macafee, Concordia University 

24. Understanding User Behaviors Regarding Smart 

Speakers: A Multidisciplinary Perspective 

Chun Shao, Arizona State 

25. No Country for Selfies: Privacy Concerns on 

Facebook and Instagram 

Daniel Haun, South Carolina 

26. Tailoring Genetic Testing Communication for 

Mental Health Patients’ Stability and Controllability 

Attributions 

Amanda Kastrinos, Florida 

27. Insecure and Girls: Innovative or the Same? 

Tessa Adams, Iowa 

28. Understanding the Influence of Employee 

Communication Behavior: How Job Board Reviews 

Impact Millennial Perceptions of Organizational 

Reputation, Relational Trust and Intent to Apply 

Katy Robinson, Patrick Thelen, 

and Cen April Yue, Florida 

29. The Effects of Presence on Responses to Argument 

Quality in a Virtual Environment 

Qiankun Zhong 

and James Cummings, Boston University 

Discussant 

Ruth Moon, Washington 

30. Media Representation of Female Candidates 

in Ugandan Parliamentary Elections: 

A Content Analysis of Three Newspapers 

Juma Kasadha, City University of Hong Kong 

and Rehema Kantono, Islamic University 

31. Using an Expanded Theory of Planned Behavior to 

Predict WeRun Users’ Intention to Engage in Sports 

in China 

Yingying Ma, Hong Kong Baptist 

32. Ad-Brand Schema Incongruity Effects on 

Engagement with Facebook Posts 

Drake Glatter, Louisiana at Lafayette 

33. TMZ and Mass Media: A Love/Hate Relationship 

Angelica Kalika, Colorado-Boulder 

34. Time Enough at Last: Pornography Viewership 

Motivations and Obstacles 

Farnosh Mazandarani, North Carolina 


35. The NCAA and Crisis Communication: Examining 

Controversial Issues in Collegiate Sports 

Matthew Stilwell 

and Branden Birmingham, South Carolina 

Monday 

Graduate Student Interest Group 

23. Habrá que Callar la Tragedia del Yasuní: A Muted 

Group Theory Perspective of Media Coverage of 

Indigenous Communities Inhabiting the Ecuadorian 

Amazon 

Maria D. Molina, Pennsylvania State 

Discussant 

Miriam Hernandez, City University of Hong Kong

68 




1:30 to 3 p.m. / M057 Congressional Hall C 



Gender Issues in Sports Media 


Patrick McConnell, High Point 

“Elevator Eyes” in Sports Broadcasting: Differences 

in Attention Allocation to Male and Female Sports 

Reporters 

Glenn Cummins, Texas Tech; 

Monica Ortiz, Syracuse 

and Andrea Rankin, Texas Tech 

Female Hockey Players’ Strategic Use of Social Media: 

From the Perspective of Self-Presentation Theory 

Halli Krzyzaniak and Soojung Kim, North Dakota 

Public Perceptions of Transgressive Female Athletes: 

Roles of Racial Identity and Visual Framing 

Lance Kinney and Amanda Flamerich, Alabama 

Animating Women’s Sports: Social Media, Gender, and 

Evolving Techniques for Constructing the Legitimate and 

Authentic Athlete 

Erin Whiteside and Jason Stamm, Tennessee 

Discussant 

Sada Reed, Arizona State 





AEJMC Presidential Task Force on Careers 


David D. Perlmutter, Texas Tech 

Panelists 

Hong Cheng, co-chair, Virginia Commonwealth 

Angela Powers, co-chair, Iowa State 



Sylvia Chan-Olmsted, Florida 

Frauke Hachtmann, Nebraska at Lincoln 

Terri Hernandez, Mississippi State 


Marcel Jennings, Virginia Commonwealth 

Yusuf Kalyango, Ohio 

Chen Lou, Nanyang Technological 

Sara Netzley, Bradley 

Amy Schmitz Weiss, San Diego State 

First meeting to start discussion on topic of “What can 

AEJMC do systematically and sustainably to support 

career advancement of its members?” Goal: Offer a comprehensive 

report at the 2019 conference in Toronto. 

1:30 to 3 p.m. / M059 Meeting Rooms 10-11 

Chinese Communication Association 

and Chinese Journalism Education Advisory Committee 


Hard Power, Soft Power, and Nations 


Shuhua Zhou, Missouri 

Panelists 

Comparing China’s National Identity in Globalized 

Media Space in a New Era 

Ke Guo, dean, Shanghai International Studies 

University 

and Peiqin Chen, associate professor, Shanghai 

International Studies University 

News Games: Research on Concepts, Meanings, 

Functions, and Interactive Narrative 

Xiangmin Zeng, deputy, Television School, 

Communication University of China 

China’s Social Transformation Anxiety 

and Internet Ethics 

Yunze Zhao, deputy, School of journalism, 

Renmin University of China 

Mainstream Discourse Construction Strategy 

and Its Enlightenment 

Lifeng Yan, deputy, School of Journalism and 

Communication, Xiamen University 

Constructive News: Ideas and Paths for the 

Transformation of Traditional Mainstream Media 

Yanan Zheng, dean, School of Journalism and 

Communication, Heilongjiang University 

Innovating the Strategy of Cultivation for Journalism 

Communication Talents in the Media Age 

Ning Tang, dean, school of media, film and 

television, Jiangsu Normal University 

Research for Documentary film Marketization in 

Chinese 40 Years Reform and Opening 

Zhi Li, professor, Television School, 

Communication, University of China 

The Origin, Influence and Norms of the “clickbait” 

Phenomenon in the online Communication 

Lingbo Tu, associate professor, Television 

School, Communication University of China 

The Idea Innovation of City Television Station 

Xiaohong Gao, dean, faculty of journalism and 

Communication, Communication University 

of China


69 



Media Culture in Qing Dynasty 

Lihong Cheng, Deputy, School of Journalism 

and Communication, Liaoning University 

The Strategy of Political Communication Innovation 

in the Context of Media Convergence 

Weidong Liu, professor, School of Journalism 

and Communication, Tianjin Normal 

Fact-checking of China-related News Reports 

in the Era of Big Data 

Shuang Leng, faculty, Television School, 

Communication, University of China 

The Authenticity of Public News Production 

in the Information Age 

Xingang Chen, associate professor, Television 

School, Communication, University of China 

Media Consumption and Global View of Urban 

Youth in China 

Jingwen Wang, associate professor, Television 

School, Communication, University of China 

Join us during the conference as we “Spotlight” five current 

issues of interest to AEJMC members. All attendees 

are invited to Spotlight presentations that will be located 

in the back-left corner of the Exhibit Hall. Members 

with expertise in five topics will share ideas and tips on 

the issues, as well as provide links to online resources. 

A Q&A will follow, with time for one-on-one questions. 

3:15 to 4:45 p.m. / M062 Mount Vernon B 

History Division 


Connecting Industry and Ivory Tower: Advertising, 

Journalism and P.R. Executives Tell Professors How 

to Matter 


Doug Cumming, Washington and Lee 

Monday 

2 to 5 p.m. / M060 Capitol Hill 

Communicating Science, Health, Environment, and Risk 

Division 

Off-site Tour 

Talking Science Communication with Congress: 

An AEJMC Field Trip to Capitol Hill 


Chris Clarke, George Mason 

ComSHER is holding an off-site tour that offers a unique 

opportunity for participants to learn about how science 

communication operates in the halls of Congress – in 

particular, science communication goals, best practices, 

opportunities, and challenges as they relate to sciencerelated 

policy. The tour group will meet in the hotel 

lobby and depart promptly at 1:30 pm. We will either 

take a tax/Uber/Lyft or Metro to the Hill. 

2 to 3 p.m. / M061 Grand Ballroom North 



Research Session 

Spotlight — “Only in Washington: Tips for 

Navigating the Library of Congress” 



Panelists 

Mizell Stewart III, Gannett and USA Today Network 

Anuj Vedak, CHIEF 

Chuck Alston, MSLGroup 

Wendy Melillo, American 

Jodie Warren, MDB Communications 

Elite Truong, Washington Post 

3:15 to 4:45 p.m. / M063 Meeting Room 05 

International Communication 



Culture in the Classroom: Focusing on Culture 

and International Education Programs in Today’s 

America 


Kelly Chernin, Florida 

Panelists 

Kelly Chernin, Florida 

Jiangxue Han, Appalachian State 

Kurt Braddock, Pennsylvania State 

Linda Hon, Florida 

Discussant 

Johanna Cleary, Florida

70 




3:15 to 4:45 p.m. / M064 Mount Vernon A 

Law and Policy and Media Management, Economics 

and Entrepreneurship Divisions 


Net Neutrality: The Digital Intersection of Access, 

Speed, Expression, Policy, and Commerce 


Christopher Terry, Minnesota 

Panelists 

Erica Salkin, Whitworth 

Tim Brennan, Maryland Baltimore County 

Laurie Thomas-Lee, Nebraska-Lincoln 

3:15 to 4:45 p.m. / M065 Congressional Hall C 



Has There Been Any Progress? Stereotypical 

and Counter-stereotypical Racial/Ethnic 

Representations Over Time 


Cathy Jackson, Norfolk State 

How Race, Gender, and American Politics Influenced 

User Discourse Surrounding the Jemele Hill Controversy 

Guy Harrison, Youngstown State; 

Ann Pegoraro, Laurentian University; 

Miles Romney, Brigham Young 

and Kevin Hull, South Carolina 

Discussant: Rockell Brown Burton, Texas Southern 

Old Stereotypes Made New: A Textual Analysis on the 

Tragic Mulatto Stereotype in Contemporary Hollywood 

Brandale Mills, Norfolk State 

Discussant: Rockell Brown Burton, Texas Southern 

Stuck in the Myth of Model Minority: Representation 

of Self in Asian Indian Ethnic Newspapers 

Somava Pande, Washington State 

Discussant: Ahmed Orabi, Illinois at Urbana-Champaign 

The Effects of Latino Cultural Identity and Media Use on 

Political Engagement and Vote Choice in Election 2016* 

Maria Len-Rios, Georgia 

and Patricia Moy, Washington 

Discussant: Federico Subervi, University of Leeds, UK 

Civil Rights and Sports: Jackie Robinson’s Continuing 

Crusade as a Newspaper Columnist 

Raymond McCaffrey, Arkansas 

Discussant: Kathleen Fearn-Banks, Washington 

Racialized Reporting: Newspaper Coverage of Hurricane 

Harvey vs. Hurricane Maria** 

Stefanie Davis, Pennsylvania State 

Discussant: Federico Subervi, University of Leeds, UK 

Immigrant Frames and Responses to Mass Media 

Identity Positioning 

Debra Kelley, Minnesota 

Discussant: Ralph Akinfeleye, University of Lagos 

A Conceptual Model on Black Consumer-Brand Identity 

Congruenceand Personal Care Purchase Intentions 

Yewande Addie, Brett Ball, 

and Kelsy-Ann Adams, Florida 

Discussant: Melody Fisher, Mississippi State 

Black Masculine Scripts in Hip-Hop Media 

Christin Smith, Morgan State 

Discussant: Robbie Morganfield, Grambling State 

Media Framing of the Movement for Black Lives: Tone 

and Changes Over Time 

Michelle Perkins, Houston 

Discussant: Robbie Morganfield, Grambling State 

“Sharing Hope and Healing”: A Culturally Tailored 

Social Media Campaign Serving Native Americans 

Rebecca Britt, Alabama; Brian Britt, 

Jenn Anderson, Nancy Fahrenwald; 

and Shana Harming, South Dakota State 

Discussant: Eddith Dashiell, Ohio 

* Third Place Paper, Latino/Latin American 

Communication Research Award 

** Third Place, Student Paper Competition 

3:15 to 4:45 p.m. / M066 Meeting Rooms 8-9 

Newspaper and Online News 

and Media Ethics Divisions 


Data Journalism in the Trump Era: Accessing Data 

and Uncovering Stories 


Stan Ketterer, Oklahoma State


71 



Panelists 

David Fallis, Deputy editor for investigative 

reporting, Washington Post 

Adam A. Marshall, Knight Foundation litigation 

attorney, Reporters Committee for Freedom 

of the Press 

Griffin Palmer, Data journalist, New York Times 

Katy Bartzen Culver, Wisconsin-Madison 


Commission on the Status of Minorities 


Teaching Race & Diversity in the Trump Era 

of Race, Rage and Resentment: Challenges 

and Pedagogical Opportunities 


Cathy Jackson, Norfolk State 

Panelists 

James Rada, Ithaca 


Sharon Bramlett-Solomon, Arizona State 

Sue Robinson, Wisconsin-Madison 


Community Journalism 

and Religion and Media Interest Groups 


Faith in the Beltway: Creating and Maintaining 

Community Bonds through Religious-Themed 

News Organizations 


Joel Campbell, Brigham Young 

Panelists 

Hannah Monicken, senior writer, Washington 

Jewish Week 

Mark Zimmerman, editor, Catholic Standard 

Vicki Brown, Missouri 

Tom Strode, correspondent, Baptist Press 




Participatory Journalism Past and Present 

Monday 



and Lesbian, Gay, Bisexual, Transgender and 

Queer Interest Group 

Teaching Roundtable Session 

Trigger Warnings, Trolls and Mansplainers: Testing 

Our Tolerance 


Candi Carter Olson, Utah State 

and Tracy Everbach, North Texas 

Roundtable Topics 

From Trigger Warnings to Testing Tolerance: Creating 

Classrooms that Support and Encourage Student 

Engagement with Controversial Topics, Version 3.0 

Mansplainers, Misogynists and Trolls: How to Handle 

THAT Guy 

Two roundtables running simultaneously (participants 

will be able to visit both roundtables in one session). 


Mi Jahng, Wayne State 

Citizen Journalism Scholarship Revisited: A Meta- 

Analytic Approach 

Young Eun Moon, Meredith Morgoch, 

and Seungahn Nah, Oregon 

Engaged Journalism in Rural Communities 

Andrea Wenzel and Sam Ford, Temple 

Open-Source Media Project: Community Attitudes 

After Five-Year Organizational Evolution 

Bonnie Bressers 

and Samuel Mwangi, Kansas State 

David Bondy Valdovinos Kaye, Queensland 

University of Technology, 

and Steven Smethers, Kansas State 

To Share Is to Receive: News as Social Currency 


Edson Tandoc, Alice Huang, Andrew Duffy, 

Rich Ling, and Nuri Kim, Nanyang 

Technological University Singapore 

Discussant 

You Li, Eastern Michigan

72 






and Mass Communication and Society Division 


Reconciling a (New)s Agenda: The Relationship 

Between Reporting, Research, and Politics in the 

Trump Era 


Dean Cummings, Georgia State 

and Timothy Macafee, Concordia 

Panelists 

Ellen Crooke, VP of News Tegna Corp 

Lance Ing, Photojournalist/Editor/Producer 

NBCUniversal Media 

Bethany Swain, former White House News 

Photographer; Maryland 

Brendan Keefe, chief investigator, Atlanta’s QXIA 

Mike Walter, CGTN 





Book ‘Em? Exploring Alternatives to Textbooks 

in the Digital Age 


Liz Atwood, Hood 

Panelists 

Michael A. Longinow, Biola 

Ralph Hanson, Nebraska at Kearney 

Brian Steffen, Simpson 

John Bekken, Albright 

Toni Albertson, Mt. San Antonio College 



Communication Graduate Education Task Force Panel 


AEJMC 101: Making AEJMC Work for You in DC 

and Beyond 


Tim Vos, AEJMC Vice President-Elect, Missouri 

Topics and Speakers 

Navigating the Conference: Sessions, 

Resources, Opportunities 

Marie Hardin, AEJMC President Elect, 


Getting Involved: Divisions and Interest Groups 

Katie Foss, vice chair, Council of Divisions, 


Navigating the Job Hub 

Felicia Greenlee Brown, desktop publisher, 

AEJMC/ASJMC 

Digital Resources and the Website: Stay 

Information, Stay Connected! 

Samantha Higgins, public relations specialist, 


This session, a companion to AEJMC 102 at 1:45 p.m. 

on August 8, is designed especially for graduate students, 

new members, and returning members. Want to know 

how the organization works, about the role of its divisions 

and interest groups, and more about the Job Hub? 

This session will offer an overview of the program and 

conference structure, so you can make the most of it. 

After a short orientation session, we’ll open it up for your 

questions and give you a chance to meet key officers and 

new colleagues across AEJMC. 

3:15 to 4:45 p.m. / M074 Congressional Hall A 



Research 


Breaking into Academic Book Publishing: Tips 

from Publishers and Tankard Book Award-Winning 

Authors 



2018 Tankard Book Award Finalists 

(books with a 2017 copyright; listed alpha by book title) 

“Race News Black Journalists and The Fight for Racial 

Justice in The Twentieth Century” 

Fred Carroll, Kennesaw State 

[University of Illinois Press] 

“The News Untold Community Journalism and The 

Failure to Confront Poverty in Appalachia” 

Michael Clay Carey, Samford 

[West Virginia University Press]


73 



“Public Relations and the Corporate Persona the Rise 

of the Affinitive Organization” 

Burton St. John, III, Old Dominion 

[Routledge] 

Celebrate the best books of the year and learn how to 

write one too! We will reveal the esteemed book award 

winner. Panelists will also share book writing, publishing, 

and marketing tips. If you plan to write a book, this session 

is worth your time. 


Association of Schools of Journalism 


5 to 6:30 p.m. / M077 Meeting Room 15 



Covering Breaking News: From Hurricanes 

to White Supremacists 


Ioana Coman, Texas Tech 

Panelists 

Harrison Hove, Florida 

Mira Lowe, Florida 

Maria Fontenot, Tennessee 

Kris Boyle, Brigham Young 

Monday 

Roundtable Panel Session 

Coffee and Current Issues 


Thor Wasbotten, Kent State 

and James Stewart, Nicholls State 

Join ASJMC leaders and academic administrators to discuss 

how ASJMC can best serve you in the upcoming 

year. Topics may include how to best select and incorporate 

technology into your program, mentoring faculty 

through the RTP process, and questions about accreditation. 

Coffee will be provided. 

5 to 6:30 p.m. / M076 Mount Vernon B 


and Minorities and Communication Divisions 


The Barrow Minority Scholarship Award Winners: 

Where Are They Now? 


Matt Barnidge, Alabama 

Panelists 

Tony Atwater, Norfolk State 

Troy Elias, Oregon 

Federico Subervi, Leeds 

Sharon Bramlett-Solomon, Arizona State 

Diane Francis, Kentucky 

5 to 6:30 p.m. / M078 Congressional Hall C 



Thinking About the News: Conceptualization 

and Practice 


Jatin Srivastava, Ohio 

Otherization of Africa: How American Media Framed 

People Living with HIV/AIDS in Africa from 1987 to 

2007 

Victoria Knight, Ivanka Pjesivac 

and Michael Cacciatore, Georgia 

Perceptions and Reality of Press Freedom Following the 

Arab Spring: An Analysis of Egypt, Iraq, and Tunisia 

William Edwards and Kyle Saunders, Ohio 

Detached Watchdog Versus Adversarial Reporting: 

A Comparative Study of Journalistic Role Performance 

in 18 Countries 

Mireya Máruqez-Ramírez, Universidad 

Iberoamericana Ciudad de Mexico; 

Claudia Mellado, Pontificia Universidad Católica 

de Valparaíso; 

María Luisa Humanes, Universidad Rey Juan Carlos; 

Adriana Amado, Universidad de Castilla-La 

Mancha; 

Daniel Beck, University of Fribourg; 

Jacques Mick, Universidade Federal de Santa 

Catarina; 

Cornelia Mothes, Dresden University of 

Technology; 

Dasniel Olivera, Universidad de La Habana; 

Nikos Panagiotou, Aristotle University; 

Svetlana Pasti, University of Tampere; 

Henry Silke, Dublin City University;

74 




Colin Sparks, Hong Kong Baptist University; 

Agnieszka Stepinska, Adam Mickiewicz University 

in Poznan; 

Gabriella Szabo, Centre for Social Sciences, 

Hungarian Academy of Sciences; 

Edson Tandoc, Nanyang Technological University 

Singapore; 

Moniza Waheed, Universiti Putra; 

Haiyan Wang, Sun Yat-sen University 

Discussant 

Delwar Hossain, South Alabama 

U.S. News Media’s Framing of the “North Korean Crisis” 

Under the Trump Administration: The New Ideological 

Foreign Affairs Paradigm* 

Brett Labbe, Indiana South Bend; 

and SangHee Park, Wisconsin-Whitewater 

Perceived Agenda-Setting Effects in International 

Context: Media’s Impacts on Americans’ Perception 

Toward China 

Linsen Su, Beijing Jiaotong University, China 

and Xigen Li, City University of Hong Kong 

The Qatar-Gulf Crisis and Narratives of Emotionality 

in Nepal’s English-language Press 

Subin Paul, Iowa 

Discussant 

Sally Ann Cruikshank, Middle Tennessee State 

Journalism Ethics and the BRICS Journalist 

Jyotika Ramaprasad, Miami 

Is “Global Journalism” Truly Global? Conceptual 

and Empirical Examinations of the Global, Cosmopolitan 

and Parochial Conceptualization of Journalism 

Miki Tanikawa, Akita International University 

Assessing the Role of International Broadcasters as 

Information Subsidies in the International Agendabuilding 

Process 

Liudmila Khalitova and Sofiya Tarasevich, Florida 

Discussant 

Manuel Chavez, Michigan State 

Populist Journalism Challenging Media and Political 

Fields: Transnational Analysis of Right-wing Metajournalistic 

Discourses 

Lea Hellmueller, Houston 

and Matthias Revers, University of Leeds 

Political News Use and Democratic Support: A Study 

of Kazakhstan’s TV impact 

Karlyga Myssayeva, Saule Barlybayeva, 

and Sayagul Alimbekova, al-Farabi Kazakh National 

University 

“They Only Threaten You or Cut Off Your Job”: How 

Rwandan Journalists Learn Self-censorship 

Ruth Moon, Washington 

Discussant 

Zeny Sarabia-Panol, Middle Tennessee State 

* Asian Journal of Communication Best Paper Award 

5 to 6:30 p.m. / M079 Grand Ballroom South 

Mass Communication and Society 

and Newspaper and Online News Divisions 

Scholar-to-Scholar Refereed Paper Poster Session 


Topic I – Journalism: Challenges and Innovations 

1. Big Data and Journalism Transformations: Evaluating 

Automation as a New Entrant to the Journalistic 

Field 

Shangyuan Wu, Edson Tandoc, 

and Charles Salmon, Nanyang Technological 

University 

2. Field and Ecological Explanations of Data 

Journalism Innovation: A Focus on the Role 

of Ancillary Organizations 

Wilson Lowrey, Lindsey Sherrill, 

and Ryan Broussard, Alabama 

3. PTSD and Depression in Journalists Who 

Covered Harvey 

Gretchen Dworznik, Kent State 

4. Conceptualization of the Public Health Model 

of Reporting through Application: The Case of the 

Cincinnati Enquirer’s Heroin Beat 

Erin Willis, Colorado-Boulder 

and Chad Painter, Dayton 

5. Finding A Voice: Newspaper Editors and The Effect 

of Sexual Assault and Rape News* 

Susan Tebben, Ohio 

Discussant 


* Third Place, Student Competition 

Topic II - Role of Media in Civics and Politics 

6. Effects of Scandals and Presidential Debates 

in the U.S. 2016 Presidential Elections 

Esther Thorson 

and Weiyue Chen, Michigan State; 

and Leticia Bode, Georgetown


75 



7. Individual Differences in Second-Level Agenda 

Setting 

Renita Coleman, Texas at Austin 

and Denis Wu, Boston University 

8. Examining the Rage Donation Trend: Applying 

the Anger Activism Model to Explore 

Communication and Donation Behaviors 


Holly Overton, South Carolina; 

Denise Bortree, Pennsylvania State; 

and Brooke McKeever, South Carolina 

9. Local to Global via Social Media: Using Social 

Media for News Could Make You Global-Minded 

Aditi Rao, Connecticut 

Discussant 


Topic III – Social Media: News and Engagement 

10. What’s Racist about Deporting Criminal Illegal 

“Felons”? Examining the Link Between Emotion 

and Cognition in Tweets about Immigration 

Saif Shahin, American; 

Laura Seroka, Bowling Green State; 

and Md Rezwan Islam, Bowling Green State 

11. Social (Media) Construction of Public Opinion 

in the Press 

Shannon McGregor, Utah 

12. Social Media as an Emerging Institution: 

Expectations and Norms Online at the 

U.S. State House 

Meredith Metzler, Wisconsin-Madison 

13. Hot or Cold: #climatechange Societal Sentiment 

on Pinterest 

Jeanine Guidry, Virginia Commonwealth; 


and Linsey Grove, South Florida 

14. Expanding Visibility on Twitter: Author 

and Message Characteristics and Retweeting 

Chang Sup Park, Bloomsburg University 

and Barbara Kaye, Tennessee at Knoxville 

Discussant 

Brian Britt, Alabama 

Topic IV – Message and Source Attributes in Strategic 

Communication 

15. Crisis Management on Social Media: Inoculation 

Strategy and Organizational Interactivity 

Pratiti Diddi 

and Lewen Wei, Pennsylvania State 

16. Effects of Self-Construal and Environmental 

Consciousness on Green Corporate Social 

Responsibility Perceptions* 

Nandini Bhalla, South Carolina 

17. Underlying Effects of Endorser Identity and Bodily 

Addressing in Public Service Announcements 

Lewen Wei, Arienne Ferchaud 

and Bingjie Liu, Pennsylvania State 

18. Explaining the “Racial Contradiction:” 

An Experimental Examination of the Impact 

of Sports Media Use and Response Strategy 

on Racial Bias Towards Athlete Transgressors 

Kenon Brown, Alabama; 

Joshua Dickhaus, Bradley; 

Ray Harrison, Jefferson State Community 

College; 

and Stephen Rush, Alabama 

Discussant 

Nan Yu, Central Florida 

* Second Place, Moeller Student Competition 

Topic V – Digital Media: Effects on Audiences and 

Media Practices 

19. Digital Inequalities or Personality Differences? 

A Longitudinal Analysis of Social Media Usage 

Divides in China 

Yiyan Zhang and Lei Guo, Boston University 

and Homero Gil de Zúñiga, Vienna 

20. The Effects of Flow in Mobile Gaming: Involvement, 

Spending Practices, and Attitude 


and Samuel M. Tham, Michigan State 

21. Do Press Releases about Digital Game Research 

Influence Presumed Effects? How Comparisons 

to Real World Violence and Methodological Details 

Affect the Anticipated Influence of Violent Video 

Games 

T. Franklin Waddell, Florida 

22. Stuck on Social Media: Predicting Young Adults’ 

Intentions to Limit Social Media Use 

Nicholas Boehm, Colorado State 

23. Is the Grass Greener on the Other Side of the 

Geofence? Privacy Implications of Unauthorized 

Commercial Smartphone Messages 

Kearston Wesner, Quinnipiac 

Discussant 

Vincent Cicchirillo, DePaul 

Topic VI – News Consumption, Coverage, and Effects 

24. Switchers & Seniors: Evaluating Technology versus 

Cohort-Based Changes in TV News Consumption, 

1984 -2008 

Patrick Parsons 

and Krishna Jayakar, Pennsylvania State 

Monday

76 




25. D.C. Media Coverage of the District’s Death 

with Dignity Act 

Kimberly Lauffer, Ball State University; 

Sean Baker, Central Michigan 

and Natalee Seely, Ball State 

26. Fake News Correction: How USDA Corrects Fake 

News about Organic Foods on Social Media 

Keonyoung Park, Jun Zhang, 

Laura Canuelas-Torres, 

and Zheng Li, Syracuse 

27. Effects of Race, Attractiveness, and Mental Health 

Attribution in Mass Shooting News 

Tao Deng, Syed Ali Hussain, Samuel M. Tham, 

and Saleem Alhabash, Michigan State 

Discussant 

Chang Sup Park, Bloomsburg 


Group I — International News 

28. Control and Resistance: The Influences of Political, 

Economic, and Technological Factors on Chinese 

Investigative Reporting* 

Lei Guo, Missouri 

29. Blame the ABC: News Framing and the Future 

of Public Service Broadcasting in Australia 

Lauren Bridges, Pennsylvania 

30. Context Matters: Journalists’ Ideals, Narration, 

and Practices in the United States and Malaysia 

Moniza Waheed, Universiti Putra Malaysia 

and Lea Hellmueller, Houston 

Discussant 

Lona Cobb, Winston-Salem State 

* Top Student Paper, Newspaper and Online News 

Division 

Group II — Community and Social Justice 

31. A Community that has Lost its Way: Framing the 

Sherman Park Unrest in Milwaukee, Wisconsin* 

Rachel Italiano, Marquette 

32. Protests, Media Coverage, and a Hierarchy 

of Social Struggle 

Danielle Kilgo, Indiana, 

and Summer Harlow, Houston 

33. “Not One of Us”: Social Identity and American 

Metajournalistic Discourse Surrounding 

Glenn Greenwald 

Courtney Johnson, Washington 

34. Peace Journalism: A War/Peace Framing Visual 

Analysis of the Charlottesville Protests 

Dara Phillips and Stephen Perry, Regent 

35. Mediating Empathy: The Role of News Consumption 

in Mitigating Attitudes about Race and Immigration 

Kelly Kaufhold, Texas State 

Discussant 

Vivian Martin, Central Connecticut State 

* Second Place Top Student Paper, Newspaper Online 

News Division 

Group III — News Values and Credibility 

36. Learning News Credibility Cues in Politicized News 

Megan Duncan, Wisconsin-Madison 

37. The Politicizing of ESPN: A Content Analysis of Its 

Perceived Partisanship 

Adrianne Grubic, Texas 

38. Healing and recovery as a news value 

Michael McCluskey, Tennessee-Chattanooga 

Discussant 

Bill Cassidy, Northern Illinois 

Group IV — News and Its Effects 

39. The Meaning of Numbers: Effect of Social Cues 

Perceived as Bandwagon Heuristic in Online News 

Jiyoun Kim, Maryland 

40. What to Think About: The Applicability of Agenda- 

Settings in a Social Media Context 

Holly Cowart, Georgia Southern 

41. Re-examining News Overload: Effects of Content 

Characteristics and News Topics on Selective 

Scanning and Avoidance** 

Angela Lee, 


and Victoria Chen, National Chung Cheng 

University 

42. “Tell Me Something Good”: Testing the Longitudinal 

Effects of Constructive News Using the Google 

Assistant 

Karen McIntyre, Virginia Commonwealth 

Discussant 

Cory Armstrong, Alabama 

** Third Place Top Faculty Paper (Tie), Newspaper and 

Online News Division 

43. Knowledge Begets Knowledge: Impacts of Civic 

and Political Knowledge on Knowledge Gain from 

Online News 

D. Jasun Carr, Idaho State 

and Mitchell Bard, Iona 

44. Hostile Media Perception and Intention 

to Participate in Public Discussion of Mental 

Health Issues: An Examination of the Role of 

Involvement 

Xueying Zhang, Kent State; 

Kim Baker and Kim Bissell, Alabama; 

Sarah Pember, Wisconsin-LaCrosse; 

and Yiyi Yang, Alabama


77 



45. Measuring Quality Dialogue: Unproductive, Uncivil 

Discourse Dominates News Commenting Forums 

Arthur Santana, San Diego State 

46. Sh*thole and the President: News Use of Trump’s 

Profanity 

Michael McCluskey, Tennessee-Chattanooga 

57. Data Journalism and Black-boxed Data Sets 

Wilson Lowrey, Ryan Broussard, 

and Lindsey Sherrill, Alabama 

Discussant 

Norman Lewis, Florida 

Discussant 


Group V — News and the Newsroom 

47. Solidarity in the Newsroom? Media Concentration 

and Union Organizing: Case Study from the 

Sunshine State 

Jennifer Proffitt, Florida State 

48. The Local-Mobile Paradox: Missed Innovation 

Opportunities and The Future of Local News 

Meg Heckman and John Wihbey, Northeastern 

49. Does a More Diverse Newspaper Staff Reflect Its 

Community? Analyzing The Dallas Morning News’ 

Content 

Tracy Everbach, North Texas; 

Jake Batsell, Southern Methodist; 

Sara Champlin 

and Gwendelyn Nisbett, North Texas 

50. Reliance on Government Sources at American 

Newspapers in the Digital Era 

Beth Knobel, Fordham 

51. No Quick Fix: How Journalists Assess the Impact 

and Define the Boundaries of Solutions Journalism 

Elia Powers, Towson and Alex Curry, Texas 

Discussant 

John Russial, Oregon 

Group VI — Mobile and Online News 

52. Readers’ Perceptions of Newsworthiness and Bias 

as Factors in Commenting on Digital News Content 

Greg Munno, Syracuse 

53. Geolocated News: How Place, Space and Context 

Matters for Mobile News Users 


54. Breaking Babel: Understanding the Dark Side 

of Digital News*** 

David Berman, Pennsylvania 

55. “All the President’s tweets”: A Large-scale Study 

of Uses of Social Media Content in Online News 

Mohammad Yousuf, Oklahoma; 

Naeemul Hassan, Mississippi 

and Md Main Uddin Rony, Mississippi 

56. Message or Medium? Effect of Virtual Reality on 

News Stories 

Noah Buntain, Shengjie Yao, 

and Dongqing Xu, Syracuse 

*** Third Place Top Student Paper 

Group VII — Advertising and Journalism 

58. Overloaded: The Impact of Visual Density 

on Advertising Recognition within Sponsored 

News Articles 

Ryan Kor and Bartosz Wojdynski, Georgia 

59. Understanding the Role Performance of Native 

Advertising on News Websites 

You Li, Eastern Michigan 

60. Exploring a Branding Alignment Typology: 

Influences on individual, Organizational, 

and Institutional Forms of Journalistic Branding** 

Logan Molyneux, Temple; Seth Lewis, Oregon 

and Avery Holton, Utah 

Discussant 

Sandra Utt, Memphis 

**Third Place Top Faculty Paper (Tie), Newspaper and 

Online News Division 

Group VIII — Journalism Curriculum 

61. The Journalism and Mass Communication Capstone 

Course: Bringing It All Together? 

Brian J. Bowe, Western Washington; 

Robin Blom, Ball State; 

and Lucinda Davenport, Michigan State 

62. Perceptual Learning in Mass Communication 

Research: Immediate and Delayed Effects of 

Perceptual-Learning Methods on AP Style 

Knowledge 

Justin Martin, Shageaa Naqvi, 

and George Anghelcev, Northwestern in Qatar 

Discussant 

Jan Lauren Boyles, Iowa 

5 to 6:30 p.m. / M080 Meeting Rooms 8-9 

Media Ethics and Scholastic Journalism Divisions 


Ethical Objectivity vs Minority Identity: 

Obstacles to Diversity in College Student Media 


Margot Susca, American 

Monday

78 




Panelists: 

Angie Chuang, Colorado 

John C. Watson, American 

Wayne Dawkins, Morgan State 

Karla Kennedy, Florida International 





#BTS: Millennial Marketing & PR Strategists 

Debate the Power of Mobile Communications 


Paisley M. Benaza, Arizona State 

Panelists 

Daren Jenkins, Director of Basketball 

Communications, Washington Wizards 

Devon Dow, US Director of Strategy and 

Partnerships, Mailman Group 

Thomas N. Lutes, Publicist; Founder TLPR 

Dave McMenamin, ESPN.com Cleveland Cavaliers 

beat writer, ESPN 

Richie Cruz, Sr. Director of Integrated Marketing, 

Foot Locker 

5 to 6:30 p.m. / M082 Mount Vernon A 

Public Relations and Law and Policy Divisions 


How Robust Should a Company’s Social Media 

Policy Be? A Debate on Employee Privacy Versus 

the Need to Protect Corporate Reputation 


Kathy Fitzpatrick, American 

Judges 

Pat Curtin, Oregon 

Matt Ragas, DePaul 

Panelists 


Karen Freberg, Louisville 

Ai Zhang, Stockson 


Cayce Myers, Virginia Tech 

Daxton “Chip” Stewart, Texas Christian 





The Politics of Voice, Visibility, and Transparency 


Mary Bock, Texas at Austin 

Panelists 

Weaving Texts: An Untitled Audio Tour 

xtine burrough, Texas at Dallas 

Who speaks for place – and how? Voice, Visibility, 

and Transparency in the Shaping of Place 


Race, Racism, and Resistance: The Visualization 

of the Voice of an Asian American Woman Activist 

Jenny Ungbha Korn, Harvard 

No Way Out: Exploitation, Incarceration 

and the Politics of Visibility 

Mei-Ling McNamara, Colorado Boulder 


AEJMC Council of Affiliates 


American Society of News Editors Diversity Survey 

& Diversity Initiatives: Why Higher Education 

Needs to Support a Pipeline of Talent into 

America’s News Organizations 

Moderator 

Lucy Dalglish, Maryland, College Park 

Panelist 

Mizell Steward, senior director of Talent, 

Partnership & Innovation, Gannett Co. 

Meredith Clark, Virginia 

Teri Hayt, executive director, American Society 

of News Editors, ASNE 


Commission on the Status of Women and Lesbian, Gay, 

Bisexual, Transgender and Queer Interest Group 


Out of the Intersectional Ghetto: Publishing 

Inclusive Research in Mainstream Mass Comm 

and Journalism Journals


79 





Panelists 

Robert Byrd, Memphis 

Natalie J. Tindall, Lamar 

Jennifer Huemmer, Ithaca 

Nathian Rodriguez, San Diego State 

5 to 6:30 p.m. / M086 Meeting Rooms 12-13 


Communication and Scripps Howard Foundation 


Tweet This: Two Weeks on the Social Media 

Frontlines 


Tracy Simmons, Gonzaga 

Presentation of Scripps Howard Awards: 

Introduction: Liz Carter, President and CEO, Scripps 

Howard Foundation 

2017 Scripps Howard Journalism & Mass 

Communication Teacher of the Year 

Award Recipient: Sheri Broyles, North Texas 

2017 Scripps Howard Journalism & Mass 

Communication Administrator of the Year 

Award Recipient: Don Heider, Loyola-Chicago 

AEJMC Equity & Diversity Award presentation: 

2018 Recipient 

Klein College of Media and Communication, 

Temple University 

Award accepted by 

David Boardman, Dean, Temple 

Keynote Panel 

Covering the White House: From Eisenhower 

to Trump 

Monday 

Panelists 

Joe Glennon, Temple 

Tracy Simmons, Gonzaga 

Elizabeth Stoycheff, Wayne State 

Howard Mortman, C-SPAN 


JHistory Internet Group 


Objectivity and Race: Past, Present, Future 


David T. Z. Mindich, Temple 

Panelists 

Earnest L. Perry, Missouri 


Brian Creech, Temple 

Felicia Harris, Houston-Downtown 

6:45 to 8:15 p.m. / M088 Renaissance Ballroom 



Keynote Session 


Jennifer D. Greer, Alabama, 2017-18 AEJMC 

President 

Panelists 

John Cochran, former chief Capitol Hill 

correspondent for ABC News and chief 

NBC White House correspondent 

Christi Parsons, former White House correspondent, 

Tribune Co.; senior editor, The Atlantic 

Kristin Welker, White House correspondent, 

NBC News 

White House reporters share their experiences covering 

presidents throughout the modern era, reflecting on the 

sometimes touchy relationships between chief executives 

and the press. Cochran, who was assigned in the Army 

to the Eisenhower and Kennedy press offices, offers perspective 

from his time with every president between Ike 

and the second Bush. Parsons, who served as the president 

of the White House Correspondents’ Association 

and who covered Obama longer than any other reporter, 

discusses the evolution of Obama’s relationship with the 

media from the Illinois legislature through his eight years 

at 1600 Pennsylvania Ave. Welker, who has covered the 

White House since 2011 and witnessed the transition 

between Obama and Trump, reflects on the current climate 

in the White House press corps as well as changes 

in the D.C. news cycle in this new era.

80 




8:30 to 9:30 p.m. / M089 Congressional Hall 



Opening Reception 

Featuring light hors d’oeuvres and a cash bar, the reception 

is a perfect place to reconnect with friends and meet 

new colleagues. Free to all attending the conference, 

including family members. Tickets are not required, but 

please wear your name badge. 

JOIN A PANEL, REUNION 

and RECEPTION 

Celebrating the 50 th Anniversary 

of the Urban Journalism Workshop 

at American University 

Wednesday, August 8 

3:30 - 5 p.m., Meeting Room 3 

Marking the 1968 release of the Kerner Report 

Sponsored by the Dow Jones News Fund 

dowjonesnewsfund.org

Tuesday Sessions 

85 

85 



7 to 8 a.m. / T001 Meeting Rooms 8-9 

Communication Technology Division 


Committee Business Meeting 


Jessica Smith, Abilene Christian 

7 to 8 a.m. / T06 Meeting Rooms 10-11 



JPRR Editorial Board Meeting 


Bey Ling Sha, JPRR editor, San Diego 

7 to 8 a.m. / T002 Meeting Room 02 

7 to 9:45 a.m. / T007 Meeting Room 12 



Members’ Meeting 






Professional Freedom and Responsibility 




Dean Kruckeberg, North Carolina-Charlotte 

Tuesday 





Douglas Cumming, Washington and Lee 




Executive Committee and Publication 

Business Meeting 


Jason Martin, DePaul 




Executive Committee Business Meeting 






Research 




Marcia DiStaso, Florida 




Teaching 




Chris Roush, North Carolina at Chapel Hill

86 




7 to 8 a.m. / T010 Hotel Lobby 



Off-site Gathering 

AEJMC Fun Run 


Richard D. Waters, San Francisco 

The 2018 Fun Run will leave from the conference hotel 

lobby at 7 a.m. 





Journalism and Mass Communication Educator 

Editorial Meeting 


Jami Fullerton, J&MCE editor, Oklahoma State 



Communication and Association of Schools of 

Journalism and Mass Communication 


Institute for Diverse Leadership in Journalism 

and Communication 


Elizabeth L. Toth, Maryland 

Session open only to IDL Fellows. 

7 to 9 a.m. / T013 Penn Quarter 




Executive Committee Meeting 


Sonya Duhé, Loyola New Orleans, 

2017-18 ASJMC President 

and, Thor Wasbotten, Kent State, 

2018-19 ASJMC President 

7 to 10 a.m. / T014 Congressional Hall A 

Kappa Tau Alpha 


Chapter Advisors’ Breakfast/Business Meeting 


Beverly J. Horvit, Missouri 

All advisors from KTA chapters are welcome to attend. 

KTA remains committed to its guiding principles of 

Knowledge, Truth and Accuracy. Pre-registration is 

required. 

8:15 to 9:45 a.m. / T015 Grand Ballroom South 



Trends in Advertising Research 


Topic I — Consumer Engagement 

1. Beauty Brands and Micro-blogging in China: How 

Content Choices Affect Consumer Engagement on 

Sina Weibo 

Mengling Cao, Youngju (YJ) Sohn, 

and Heidi Hatfield Edwards, Florida Institute 

of Technology 

2. Comparative Advertising as a Signal of Quality: 

The Role of Brand Credibility in Consumer 

Responses 

Naa Amponsah Dodoo, Emerson 

3. Investigating the Implications of Distinct Personality 

and Message Factors on Consumer Responses 

Naa Amponsah Dodoo, Emerson 

and Cynthia Morton Padovano, Florida 

4. Political Campaigning Meets Digital Engagement: 

“Old” Failures and “New” Triumphs 

Sally McMillan, Courtney Childers 

and Stuart Brotman, Tennessee-Knoxville; 

Jinhee Lee, Michigan State; Jian Huang 

and Natalie Bogda, Tennessee-Knoxville 

5. Testing the Limits: Self-Endorsement in Ambient 

Intelligent Environments 

Kristy Hamilton, SeoYoon Lee, 

Un Chae Chung, 

and Weizi Liu, Illinois at Urbana-Champaign 

Discussant 

Frauke Hachtmann, Nebraska-Lincoln


87 



Topic II — Social Media Applications 

6. How Advertising Relevance and Brand Relationship 

Strength Limits Disclosure Effects of Native Ads on 

Twitter 

Jameson Hayes, Alabama; 

Guy Golan 

and Janelle Applequist, South Florida; 

and Stephen Rush, Alabama 

7. Informing, Reinforcing, and Referencing: Chinese 

Young Male Consumers’ Interpretation of Social 

Media Luxury Advertising 

Huan Chen, Florida; 

Ye Wang, Missouri Kansas City 

and Eric Haley, Tennessee 

8. Perceived Native-ness of Social Media 

Advertisements: A Conceptualization and Scale 

Development Study 

Jing Yang, Loyola-Chicago; 

Linwan Wu, South Carolina; 

Rachel Quint 

and Jaini Bhavsar, Loyola-Chicago 

9. Soil and Flower: The Relationship between Social 

Media Usage and Consumer Response to Social 

Media Advertising 

Yang Feng, San Diego State 

and Quan Xie, Bradley 

10. Watching AD for Fun: Native Short-video 

Advertising on Chinese Social Media 

Ruowen Wang and Huan Chen, Florida 

Discussant 

Jay Newell, Iowa State 

Topic III — Consumer Health and Safety 

11. Applying Artificial Neural Networks to Predict 

Ad Viewership During TV Programs 

Fiona Chew, Beth Egan, Chilukuri Mohan, 

Ruochen Jiang, Sushanth Suresh, 

and Kartik Joshi, Syracuse 

12. Cognitive Appraisals on a Brand Safety Issue 

and Hostile Consumer Behaviors: The Appraisal- 

Emotion-Behavior (AEB) Model 

Joon Soo Lim, Syracuse; Junga Kim, 

and Chunsik Lee, North Florida 

13. I (Don’t) Want to Consume Counterfeit Medicines: 

Preliminary Results on the Antecedents of 

Consumer Attitudes Toward Counterfeit Medicines 

S. Senyo Ofori-Parku, Oregon; 

and Sung Eun Park, Alabama at Tuscaloosa 

14. The 360-Degree Drunk Driving Prevention 

Advertising: The Impacts of Gender Role Beliefs 

and Self-Referencing on Purchase Intentions 

and Drunk Driving Avoidance 

Wen Zhao, Washington State 

15. When Our Goals Set Our Biases: How Regulatory 

Focus Moderates Persuasion Knowledge 

and Third-person Perception in Health Advertising 

Giang Pham and Chang-Dae Ham, Illinois 

at Urbana-Champaign 

Discussant 

Juan Mundel, DePaul 

Topic IV — Corporate and Social Responsibility 

16. Credible Corporates Require Many Likes: An 

Examination of Corporate Credibility 

and Bandwagon Cues 

Ruobing Li, Louisiana State; 

Michail Vafeiadis, Auburn; 

Anli Xiao and Guolan Yang, Pennsylvania State 

17. Determining the Effectiveness of Sustainability 

Initiatives in Advertisements for Congruent 

and Incongruent Companies 

Brett Sherrick and Jennifer Hoewe, Purdue 

18. Social Network for Good: Framing the Message 

Type and Execution Style of “Cause- Related 

Marketing” Advertising for a Sports Brand 

on Social Network Sites 

Ji Yoon (Karen) Han, Ball State 

and Seungae Lee, Oakland 

19. The Effect of Soliciting Consumer Participation 

in Corporate Social Responsibility Campaigns 

Sun Young Lee, Maryland; 

Yeuseung Kim, Chung-Ang University 

and Young Kim, Marquette 

20. Value from Construal Level Theory: The Matching 

Effects of Social Distance and Message Orientation 

for Environmental Advertising 

Sun-Young Park, Massachusetts 

and Eunyi Kim, Incheon National University 

Discussant 

Kelty Logan, Colorado-Boulder 

Topic V — Branded Entertainment 

21. Does VR Attract Visitors? The Mediating Effect 

of Presence on Consumer Response in Tourism 

Advertising Using Virtual Reality 

Wai Han Lo 

and Benjamin Ka Lun Cheng, Hong Kong Baptist 

22. Effects of Sensation Seeking, Creator Attractiveness, 

and Content Characteristics on Branded 

Entertainment 

Dahyun Hong 

and Jong Woo Jun, Dankook University 

23. How Storytelling Advertising Affects Consumers: 

Emotion as a Mediator Between Narrative Level 

and WOM Intention 

Sookyeong Hong, Hansei University; 

Jin-Ae Kang and Glenn Hubbard, East Carolina 

Tuesday

88 




24. Make It Fit: The Effects of Brand-Game Congruity 

in Advergames on Brand Recall, Attitude, 

and Purchase Intent 

Frank Dardis and Michael Schmierbach, 

Pennsylvania State; 

José Aviles, Wittenberg University; 

Erica Bailey, Angelo State; 

Stephanie Orme 

and Jin Kang, Pennsylvania State 

Discussant 

Marcel Jennings, Virginia Commonwealth 

Topic VI — Instagram and Facebook Applications 

25. Influencer Marketing on Instagram: The Effects 

of Sponsorship Disclosure, Source Credibility, 

and Brand Credibility 

Susanna Lee and Eunice Kim, Florida 

26. #Insta-Credible: The Impact of Influencer-Brand 

Fit on Source Credibility and Persuasive 

Effectiveness 

Priska Breves, Nicole Liebers, Marina Abt, 

and Annika Kunze, University of Wuerzburg 

27. Placing Brands on Facebook: How the Source 

and Context of Brand Posts Affect Brand Likeability 

Mira Mayrhofer, Brigitte Naderer, 

and Jörg Matthes, University of Vienna 

28. Social Information in Facebook News Feed Ads: 

A Social Impact Theory Perspective 

Fei Xue, Southern Mississippi 

29. Teens’ Responses to Facebook Newsfeed 

Advertising: The Effects of Cognitive Appraisal 

and Social Influence on Privacy Concerns 

and Coping Strategies 

Seounmi Youn, Emerson 

and Wonsun Shin, University of Melbourne 

Discussant 

Keith Quesenberry, Messiah College 

Topic VII — Consumer Intentions and Responses 

30. How Anticipated Regret Messages Interact With 

Mood To Influence Purchase Intention 

Yanyun Wang 

and Sela Sar, Illinois at Urbana-Champaign 

31. Measuring Consumer Perceptions of Influencer 

Product Recommendation Motives on Social Media 

Mengtian (Montina) Jiang, Kentucky 

and Nora Rifon, Michigan State 

32. Memory at Play: Personalizing Advertisements 

Based on Consumers’ Autobiographical Memory 

Lewen Wei, Jin Kang, 

and Michael Schmierbach, Pennsylvania State 

33. The Attitudinal and Behavioral Effects of Pictorial 

Metaphors in Advertising: Considering Need 

for Cognition and the Mediating Effect 

of Emotional Response 

Soojin Kim, Louisiana State 

34. The Effect of Ad appeals on Materialistic 

Consumers’ Ethical Purchase 

Yuhosua Ryoo, WooJin Kim, 

and Eunjoo Jin, Texas at Austin 

35. Do Disabilities Belong?: Exploring Non-disabled 

Consumer Attitudes Toward Persons with Physical 

Disabilities in Advertising 

Summer Shelton, Florida 

Discussant 

Mary Liz Brooks, West Texas A&M 

8:15 to 9:45 a.m. / T016 Meeting Room 04 

Communicating Science, Health and Environment Risk 

Division 


Persuasive Strategies in Science Communication 


Shupei Yuan, Northern Illinois 

User Engagement in Public Discourse of Genetically 

Modified Organisms: The Role of Opinion Leaders on 

Social Media 

Qian Xu, Elon and Nan Yu, 

and Yunya Song, Central Florida 

Barriers in Communicating Science for Policy in Congress 

Karen Akerlof, George Mason; 

Maria Carmen Lemos, Michigan; 

Emily T. Cloyd, Erin Heath, Selena Nelson, 

Julia Hathaway and Kristin Timm, George Mason 

How Does Media Promote Pro-environmental Behaviors 

as Collective Action: An Examination of Illusion of 

Knowledge 

Xiaodong Yang, Shandong University; 

Xiaoming Hao 

and Shirley Ho, Nanyang Technological 

Name Frame and Celebrity Endorsement Effects 

of Autonomous Vehicle Technology Communications: 

Mechanisms and Moderators 

Jessica Myrick, Lee Ahern, Ruosi Shao, 

and Jeff Conlin, Pennsylvania State 

Examining the Impact of Motivational Salience 

and Involvement on Visual Attention to Scientific 

Information 

Laura Fischer, Kentucky; Courtney Meyers, 

Glenn Cummins, Courtney Gibson, 

and Mathew Baker, Texas Tech


89 



8:15 to 9:45 a.m. / T017 Meeting Rooms 8-9 





and Commission on the Status of Women 


New Skills The Biz Needs Us to Teach 


Ronald Yaros, Maryland 

Panelists 

Jody Brannon, TOW-Knight Center; American 

Everdeen Mason, The Washington Post 

Reid Williams, USA Today Network 

Kathleen Culver, Wisconsin-Madison; 

Poynter Institute 




Has Feminist Communication Theory Changed 


Research — and Should It? 


Lana Rakow, North Dakota 

and Diana Nastasia, Southern Illinois-Edwardsville 

Panelists: 

Amanda Kennedy, St. Mary’s 

Diana Nastasia, Southern Illinois-Edwardsville 

Radhika Parameswaran, Indiana 

Lana Rakow, North Dakota 


Angharad Valdivia, Illinois, Urbana-Champaign 

Tuesday 


Top Paper Session 


William (Bill) Davie, Louisiana at Lafayette 

Rehash or Reset? Examining the Intermedia Agenda 

Setting Effect Between Twitter and Newspapers on 

Climate Change* 

Yan Su, Washington State 

Real Time Political Deliberation on Social Media: 

Can Televised Debates Lead to Rational and Civil 

Discussions on Broadcasters’ Facebook Pages?** 

Lindita Camaj, Houston 

Small Station with Big Voices: Giving a Microphone to 

Communities Through Student-Citizen Collaborations*** 

Deborah Chung, Mike Farrell, Kakie Urch, 

and Yung Soo Kim, Kentucky 

Frames and Sources of Links in the Climate Discussion 

on Twitter, 2012-2015**** 

JA Lavaccare and Kjerstin Thorson, Michigan State 

and Luping Wang, Cornell 

Discussant 

Maria Fontenot, Tennessee 

* First Place Student Paper 

** First Place Faculty Paper 

*** Second Place Faculty Paper 

****Third Place Faculty 

8:15 to 9:45 a.m. / T020 Meeting Rooms 10-11 



Podcasts as Audio Accessories to Magazine 

Media: Bridging Skillsets to Address 

Emerging Platform Needs 


Elizabeth Hendrickson, Ohio 

Panelists 

Ben Bogardus, Quinnipiac 

Hans Meyer, Ohio 

Michael O’Connell, producer, 

“It’s All Journalism” podcast 

Vanessa Vancour, Nevada, Reno 

8:15 to 9:45 a.m. / T021 Congressional Hall B 

Media Ethics and Media Management, Economics and 



Ethics Issues Against a Backdrop of Disruption 


Stephanie Craft, Illinois

Congratulations! 

S. Shyam Sundar 

2018 Paul J. Deutschmann Award 

for Excellence in Research

Welcome to our newest faculty members: 

Mark Birschbach 

Lecturer 

Advertising/Public Relations 

Stephanie Madden 



Walter Middlebrook 

Donald P. Bellisario 

Professional in Residence 

Juliet Pinto 


Journalism 

Heather Shoenberger 



Recent Ph.D. graduate job placements: 

l Anna Aupperle, NBCUniversal Media, Senior Analyst, Program Research 

l Stephanie Berberick, Washington and Jefferson College, Assistant Professor 

l Arienne Ferchaud, Florida State University, Assistant Professor 

l Jenna Grzeslo, SUNY New Paltz, Assistant Professor 

l Jinyoung Kim, Amazon, UX Researcher 

l Sushma Kumble, Towson University, Assistant Professor 

l Rose Luqiu, Hong Kong Baptist University, Assistant Professor 

l Anli Xiao, Texas A&M University Corpus Christi, Assistant Professor 

bellisario.psu.edu 

@PSUBellisario

92 




Panelists 

Kevin Stoker, Nevada, Las Vegas 


Patrick Ferrucci, Colorado-Boulder 

Ronen Shay, Wentworth Institute of Technology 

8:15 to 9:45 a.m. / T022 Renaissance Ballroom West A 



Breakfast With Hispanic Media: U.S. Hispanic 

Media at the Crossroads of Culture and Industry 

Opportunity 


Kent Wilkinson, Texas Tech 

Panelists 

Janette Luviano, WZDC Telemundo, 

Washington, DC 

Alberto Avendano, The N Group 

Francisco Montero, Fletcher, Heald & Hildreth 

This breakfast session features discussion with television 

and publishing professionals working in the Washington 

D.C. region. Hispanic-oriented media have become 

more diverse and influential within U.S. society. The 

breakfast co-sponsors, the Fletcher, Heald & Hildreth law 

firm and the Thomas Jay Harris Institute for Hispanic & 

International Communication at Texas Tech University, 

are committed to opening spaces for dialogue among 

scholars, media practitioners and policymakers in key 

forums such as the Minorities and Communication 

Division of AEJMC. 

8:15 to 9:45 a.m. / T023 Renaissance Ballroom West B 


and Scholastic Journalism Divisions 


Breakfast of Editing Champions 


Kirstie Hettinga, California Lutheran 

Panelist 

Angie Drobnic Holan, Politifact 

Angie Drobnic Holan will discuss editing news stories 

for accuracy and relevance in a deadline-driven environment. 



and Internships and Careers Interest Groups 


Research at the Intersection of Public Relations 

and Health: Paths for Publishing 

and Research Opportunities 


María E. Len-Ríos, Georgia 

Panelists 

Linda Aldoory, Maryland 

Rachel Young, Iowa 

Brooke Weberling McKeever, South Carolina 

John C. Besley, Michigan State 


8:15 to 9:45 a.m. / T025 Mount Vernon B 



Visual Communication Division Top Papers Session 


Gabriel Tait, Arkansas State 

Celebrating Life or Adversity? The Redefinition of 

Features in the Pictures of the Year International Contest 

Jennifer Midberry, Ryan N. Comfort, 

and Joseph Roskos, Indiana University-Bloomington 

Effects of Visual Theme and View Perspective on Visual 

Attention and Brand Constructions: An Eye-Tracking 

Study on Instagram Posts 

Lijie Zhou, Southern Utah 

and Fei Xue, Southern Mississippi 

Giving Guidance to Graphs: Evaluating Direct and 

Indirect Annotations of Data Visualizations for the News 

Russell Chun, Hofstra 

It Costs a Lot to Look This Cheap: Preference for Low 

Quality Graphic Design 

Shannon Zenner, North Carolina at Chapel Hill 

8:15 to 9:45 a.m. / T026 Mount Vernon A 


Communication and News Engagement Day Committee 


Where are We on News Engagement?


93 




Paula Poindexter, Texas at Austin 

Panelists 

The State of News Engagement Five Years After 

NED’s Founding 

Paula Poindexter, Chair, News Engagement 

Day Committee 

Understanding Teens’ Social Media 

and Smartphone Use 

Monica Anderson, Pew Research Center 

of the Library’s Manuscript, Newspaper, and Prints and 

Photographs reading rooms. Meet promptly at 9:30 

a.m. in the Madison Building’s main floor lobby, just 

beyond the security checkpoint. Enter the building from 

Independence Avenue. Nearest Metro stop is Capitol 

South on the Blue, Orange, and Silver lines. The offsite 

tour should last a little more than two hours. Preregistration 

is required. 

9:30 to 10 a.m. / T029 Grand Ballroom North 

• Announcement of 2018 Winner of News Audience 

Research Paper Award 

• Ideas for Expanding News Engagement Day 

• NED Book and Blu-Ray Disc Give-Away 

As we prepare for NED on Tuesday, October 2, 2018, this 

session will examine the state of news engagement today 

as well as social media and mobile use of the upcoming 

generation that will affect news engagement in the future. 

Plus, the 2018 Winner of the News Audience Research 

Paper Award will be announced and there will be a new 

book and Blu-Ray Disc GiveAway. 

8:30 a.m. to 5 p.m. / T027 Meeting Room 15 





Institute for Diverse Leadership in Journalism 

and Communication Scholars 


Lillian Coleman, senior project manager, 


Session open only to IDL fellows. 




Join colleagues for networking and light refreshments. 

10 a.m. to 11:30 a.m. / T030 Mount Vernon B 

Communicating Science, Environmental Health and 

Risk Division and Participatory Journalism Interest 

Group 


Localized Fear: Communicating Science and Risk 

at the Community Level 


Katherine Rowan, George Mason 

Panelists 

Jessica Myrick, Pennsylvania State 

Janet Yang, Buffalo 

Brian Houston, Missouri 

Karen Akerlof, George Mason 

Bruce Hardy, Temple 

Meghnaa Tallapragada, Clemson 

Tuesday 

9:30 a.m. to 12:30 p.m. / T028 Library of Congress 


Off-site Tour 

Off-site at the Library of Congress 

Hosting 


The Library’s Madison Building, 101 Independence 

Ave., SE. Library experts and curators will discuss how 

to make best use of the only-in-Washington resources 

10 to 11:30 a.m. / T031 A Baked Joint 

Cultural and Critical Studies, Magazine Media Divisions 

and Lesbian, Gay, Bisexual, Transgender and Queer 

Interest Group 


Graduate Student “Coffee Klatch” 

Hosting 

Jessica Hennenfent Maddox, Georgia 

Meet at A Baked Joint, 440 K Street.

94 




10 to 11:30 a.m. / T032 Mount Vernon A 




The Status of Graduate Teaching Assistants: 

Update 2018 


Tom Moore, City University of New York 

Panelists 

Aaron Atkins, Ohio 


Ashley Gimbal, Arizona State 

Kevin Hull, South Carolina 

Alex Lucshinger, Elon 




Technology, Intellectual Property and the Law 


Kathy Olson, Lehigh 

Artificial Authors: Making a Case for Copyright in 

Computer-Generated Works 

Nina Brown, Syracuse 

Give Me a ©: Refashioning the Supreme Court’s 

Decision in Star v. Varsity 

Jared Schroeder, Camille Kraeplin, 

Anna Grace Carey, 

and Lauren Hawkins, Southern Methodist 

Considering Fair Use: DMCA’s Takedown & Repeat 

Infringers Policies 

Amanda Reid, North Carolina at Chapel Hill 

Discussant 




and Sports Communication Interest Groups 


DID SHE REALLY SAY THAT?: How Sports Media 

Present and Represent Political, Social and Cultural 

Issues 


John Shrader, Nebraska-Lincoln 

Panelists 

Cynthia Frisby, Missouri 

Jon Solomon, Sport and Society Program, 

The Aspen Institute 

Danielle Coombs, Kent State 

Steve Bien-Aime, Northern Kentucky 




Communication, Culture and Gentrification: 

Pedagogy, Methodology and Case Studies 


Gracie Lawson-Borders, Howard 

Panelists 

Locating Communication on Gentrification 

in Critical Research and Teaching 

Carolyn Byerly, Howard 

Choosing Segregation: Mapping the Racial Subtext 

around Educational Options 

Natalie Hopkinson, Howard 

When Neighborhoods Gentrify Around Historically 

Black Colleges and Universities 

Brittany-Rae Gregory, Howard 

Yelp Meets Food Culture: An Ethnography 

of a Caribbean Restaurant on a Gentrifying Corridor 

Sharifa Simon-Roberts, Howard 

“The Gentrification Express:” Analyzing the 

Discourse Around the Revival of the DC Streetcar 

Morgan Smalls, Howard


95 



10 to 11:30 a.m. / T036 Busboys & Poets 

10 to 11:30 a.m. / T039 Renaissance Ballroom East 


Off-site Luncheon Session 

Graduate Student Brunch 

Hosting 

Tyler Page, Mississippi 

and Virginia Harrison, Pennsylvania State 

Luncheon will be held at Busboys & Poets, 5th and K 

Street. Pre-registration is required. Sponsored by Texas 

Tech University. 




Future of Journalism 


Jan Schaffer, Executive Director, 

J-Lab; Institute for Interactive Journalism 

Panelists 

Matt DeRienzo, Executive Director, LION 

(Local Independent Online News Publishers) 

Burt Herman, Director of Innovation Projects, 

The Lenfest Institute 

Jeff Sonderman, Deputy Director, American Press 

Institute 

Al Cross, Kentucky 


Communication Elected Standing Committee 

on Research 


Cornerstone Session: Manuscript Reviews: 

Is This the Best We Can Do? 


Serena Carpenter, associate editor, Journalism 

Studies, Michigan State 

Panelists 

Pat Curtain, Oregon 

Louisa Ha, editor, Journalism & Mass 

Communication Quarterly; Bowling Green State 

Stephen Lacy, former editor, Journal of Media 

Economics; Michigan State 

Karen Miller Russell, former editor, Journal of 

Public Relations Research; Georgia 

Silvio R. Waisbord, editor, Journal of 

Communication; George Washington 

Manuscript reviews and reviewing can be fraught with 

problems. Yet, done well, reviewing makes an important 

contribution to quality scholarship. Panelists offer assessments 

of the state of reviewing and prescriptions for ways 

to improve reviews. 

10 a.m. to 11:30 a.m. / T040 Meeting Rooms 8-9 

Commission on Public Relations Education 

Tuesday 

10 a.m. to 11 a.m. / T038 Grand Ballroom North 




Spotlight — “Getting That Job” 











Ethics, Diversity, a New Required Course, 

New Content Recommendations and MORE 


Elizabeth L. Toth, Maryland 

and Kathleen Larey Lewton, Lewton, Seekins 

& Trester 

Panelists 

Kathleen Larey Lewton, co-chair, principal, Lewton, 

Seekins & Trester 

Elizabeth L. Toth, Maryland, College Park 

Ken Plowman, Brigham Young 

Hongmei Chen, San Diego State 

An open session for an up-close look and discussion of the 

Commission on Public Relations Education 2017 Report: 

Fast Forward. Foundations + Future State. Educators + 

Practitioners (www.CommissionPRed.org)

96 




10 a.m. to 11:30 a.m. / T041 Meeting Room 04 

C-SPAN 

Panel Session 

Resolutely Non-Partisan: Researching C-SPAN’s 

Video Archives 


Howard Mortman, Director of Communications, 

C-SPAN 

Panelists 

Robert X Browning, Executive Director, C-SPAN 

Archives and director, Center for C-SPAN 

Scholarship and Engagement at Purdue 


Gary Price, Librarian, Researcher, Founder 

of infoDOCKET.com 

This session will highlight the vast, accessible online 

resources of the C-SPAN Video Library for teaching and 

research in the journalism and media fields. With over 

327,000 hours of online video that can be searched, 

clipped, and shared, the C-SPAN Video Library is an 

unparalleled source of public affairs programming for students, 

professors, and journalists. This session will demonstrate 

how to search the Archive, to make clips, and 

the type of applications that will help journalism teachers 

to understand and use the C-SPAN Video Library. There 

will also be a discussion of C-SPAN’s use of social media. 

10 a.m. to 11:30 a.m. / T042 Meeting Room 05 

SAGE Publishing 

Panel Session 

Journalism in Practice: What It Means to Be 

a Science Reporter in the Age of Trump 


Patricia Moy, Washington; chair, AEJMC Elected 

Standing Committee on Publications 

Panelists 

Francie Diep, staff writer, Pacific Standard 

David Malakoff, deputy news editor, Science 

Magazine 

Elizabeth Shogren, reporter, Reveal 

Nsikan Akpan, digital science producer, PBS 

NewsHour 

In this highly interactive session, a panel of reporters will 

address what it’s like to report on science, science policy, 

and today’s important, yet rapidly changing, issues with a 

scientific angle. A lively Q&A ends the session, 

11:45 a.m. to 1:15 p.m. / T043 Congressional Hall B 



Should Digital Partnerships Be Treated Differently 

Than Traditional Media Buys? The Ethically Blurred 

Lines & Legal Implications of Native Advertising & 

Influencer Marketing 


Courtney Childers, Tennessee 

Panelists 

Nate Evans, Georgia 

Lesley Fair, senior attorney, Federal Trade 

Commission 


Michael Hoefges, North Carolina 

Mariea Grubbs, Tennessee 

11:45 a.m. to 1:15 p.m. / T044 Mount Vernon B 


Risk Division and Small Programs Interest Group 


Communication and Media Relations Training 

in Risk and Crises 


John Besley, Michigan State 

Panelists 

Michelle Baum, Metropolitan State University 

of Denver 

Charles Lubbers, South Dakota 

Michelle Maresh-Fuehrer, Texas A&M-Corpus Christi 

11:45 a.m. to 1:15 p.m. / T045 Congressional Hall C 



The Many Uses and Effects of Social Media 


Margaret Yee Man Ng, Texas at Austin 

Topic I — Top Faculty Papers 

Pundits, Presenters and Promoters: Investigating Gaps 

in Digital Production Among Social Media Users Using 

Self-Reported and Behavioral Measures* 

Ke Jiang, Rui Wang, Lance Porter, 

and Martin Johnson, Louisiana State


97 



The Alternatives to Being Silent: Exploring the Opinion 

Expression Avoidance Strategies for Discussing Politics 

on Facebook** 

Tai-Yee Wu, National Chiao Tung University; 

Xiaowen Xu, and David Atkin, Connecticut 

Issue-Based Micromobilization via Call-to-Action 

Message: Path Analysis Model Linking Issue 

Involvement to Expressive Action in Social Media*** 

Elmie Nekmat and Ismaharif Ismail, National 

University of SingaporeAnyone Can Be a Troll: 

Predicting Behaviors and Perceptions of Uncivil 

Discourse Among Reddit Users*** 

Daniel Montez, Pamela Brubaker, 

Scott Church, Ching (Jina) Shih, 

and Spencer Christensen, Brigham Young 

Discussant 

Jessica Smith, Abilene Christian 

Topic II — The Intersections of Communication 

Technology and Media Psychology 

Beyond the “Good or Bad” Typology: A Meta-Analytic 

Review of the Association between Social Media Use 

and Psychological Well-Being 

Fan Yang, University at Albany, SUNY 

and Ruoxu Wang, Memphis 

Information Control as a Mood Enhancer: Mood 

Management Through Website Interactivity 

Taylor Jing Wen, Linwan Wu, 

and Reece Funderburk, South Carolina 

Emotional Expression and Social Media Practices: 

A Social Identity-based Perspective 

Xi Cui, College of Charleston 

The Emotional Consequences of Social Exclusion 

through Social Media 

Dominik Neumann 

and Nancy Rhodes, Michigan State 

Discussant 

Wenjing Xie, Marist College 

* First Place Faculty Paper 

** Second Place Faculty Paper 

*** Third Place Faculty Papers 

11:45 a.m. to 1:15 p.m. / T046 Meeting Room 03 




Relationships Between Grad Students and Advisors 


Brett Sherrick, Alabama 

Panelists 

Kjerstin Thorson, Michigan State 

Andy Billings, Alabama 

Fuyuan Shen, Pennsylvania State 

Aaron Veenstra, Southern Illinois-Carbondale 

11:45 a.m. to 1:15 p.m. / T047 Renaissance BR West B 

Electronic News 



Breaking News: Guns and the Media 



Panelists 

Maria Williams-Hawkins, Ball State 

Patrick Walters, Kutztown of Pennsylvania 

Mitch McKenney, Kent State 

Darrell Roe, Eastern New Mexico 


11:45 a.m. to 1:15 p.m. / T048 Renaissance BR West A 



Social Media and Its Influences Across the World: 

From Empowerment to Disempowerment 


Manuel Chavez, Michigan State 

News Believability, Trustworthiness and Information 

Contagion in African Online Social Networks: An 

Experimental Design* 

Gregory Gondwe, Colorado 

To Censor and Surveil: Cross-national Effects of Online 

Suppression Technologies on Democratization 

Elizabeth Stoycheff, Maria Clara Martucci, 

and G. Scott Burgess, Wayne State 

Covering Protests on Twitter – The Influences on 

Brazilian Journalists’ Social Media Portrayals of the 

2013 and 2015 Demonstrations 

Rachel Mourao and Weiyue Chen, Michigan State 

Dalit Online Activism: The Digital Archive as a Site of 

Political Resistance in India 

Subin Paul and David Dowling, Iowa 

Discussant 


* Third Place Student Paper, Markham Competition 

Tuesday

98 





Magazine Media Division and Lesbian, Gay, Bisexual, 

Transgender and Queer Interest Group 


Interrogating Objectivity in the Trump Era: 

Feminist Ethics as Media Ethics 



Panelists 

Joy Jenkins, Oxford 

Jade Metzger-Riftkin, Wayne State 

Chelsea Reynolds, California State-Fullerton 

Stine Eckert, Wayne State 

Business Characteristics of a Network Media Agency: 

A Case Study Using a Dyadic Perspective of Agency– 

Client Joint Business Activities 

Melanie Herfort, University of Bayreuth 

and Reinhard Kunz, Management Center Innsbruck 

Emotional Responses to Online Video Ads: The 

Differential Effects of Self-Brand 

Congruity and Ad Duration 

Todd Holmes, California State Northridge 

Special Topic Industry Commentary 

Panelists will be joined by industry professionals who will 

discuss the topics areas of the refereed papers with the 

researchers and audience. 

Discussant 

Anthony Palomba, St. John’s 


Media Ethics and Law and Policy Divisions 


The Ethics of Weedvertising: Duties 

and Obligations of Ad and PR Professionals 


Margaret Duffy, Missouri 

Panelists: 

Lee Wilkins, prof. emerita, Missouri and Wayne State 

Lee Peeler, president & CEO, Advertising Self- 

Regulatory Council; executive vice president, 

Council of Better Business Bureaus, Inc. 

Kati Berg, Marquette 

Erik Ugland, Marquette 

Derigan Silver, Denver 



Division 


2018 Special Topic - Agencies: Agency-Client 

Activities and Audience Response 






Targeting Racial/Ethnic Minority Audiences: 

Environmental, Nonprofit and Health 

Communication 


Felicia McGhee-Hilt, Tennessee-Chattanooga 

Impact of Media Use and Pro-Environmental 

Orientations on Racial/Ethnic Groups’ Attitudes Towards 

Ecobranding* 

Troy Elias, Oregon 

Representation of Minorities in Hospitals’ Online 

Platforms: Manifestation of Diversity in Images 

and Videos 

Taryn Myers, Finie Richardson, 

and Jae Eun Chung, Howard 

Acculturation, Pluralism, Empowerment: Cultural Images 

as Strategic Communication on Hispanic Nonprofit 

Websites** 

Melissa Adams 

and Melissa Johnson, North Carolina State 

Marketing to One Color: An Analysis of the Emergent 

Themes in Cancer Television Commercials from 2014- 

2017*** 

Aqsa Bashir, Florida 

Discussant 

Mia Moody-Ramirez, Baylor 

* First Place, Faculty Paper Competition 

** Third Place, Faculty Paper Competition 

*** Second Place, Student Paper Competition


99 



11:45 a.m. to 1:15 p.m. / T053 Mount Vernon A 




Taking a Knee for Social Justice: Opportunities 

and Challenges for Talking about Race in the 

Applied Communication Classroom 


Stephanie Madden, Pennsylvania State 

Panelists 

Stephanie Mahin, North Carolina at Chapel Hill 

Nathian Rodriguez, San Diego State 

Melissa Janoske, Memphis 

Meredith Clark, Virginia 

Kathleen McElroy, Texas at Austin 

Panelists 

Lorraine Branham, Syracuse 

Juan-Carlos Molleda, Oregon 


Megan S. Sanders, Louisiana State 



11:45 a.m. to 1:15 p.m. / T056 Penn Quarter 




Oral Histories Committee 


Maggie Rivas-Rodriguez, Texas at Austin 

Tuesday 

11:45 a.m. to 1:15 p.m. / T054 Meeting Rooms 8-9 




Teaching Writing Skills to Students Who 

Can’t Write 


Peter Bobkowski, Kansas 

Panelists: 

Candace Perkins Bowen, Kent State 

Amy Devault, Wichita State 

Maggie Cogar, Ashland 

Marina Hendricks, South Dakota State 



and AEJMC Council of Affiliates 


How Women and People of Color Can Move 

into Higher Ed Leadership Positions 


Laura Castaneda, Southern California 

11:45 a.m. to 1:15 p.m. / T057 Meeting Rooms 12-13 

Elon University and Louisiana State University 

Roundtable Panel Session 

Emerging Leader? A Session to Decide If 

a Leadership Path is Right for You 


Brooke Barnett, Elon 

Panelist 

Marie Hardin, Pennsylvania State 

Gracie Lawson-Borders, Howard 

Meghan Sanders, Louisiana State 

Temple Northup, Houston 

David Kurpius, Missouri 

This interactive session will allow you to hear from colleagues 

who are in or have previously held a variety of 

academic leadership roles. In an energetic, round table 

format we will address translating faculty skills into 

leadership potential that may help you with leading curricular 

innovation, program distinction and branding, and 

managing from the middle (among other topics). You will 

also have a chance to ask your questions about the good, 

bad, ugly, and often surprising when it comes to moving 

into a formal leadership role. This session is for faculty 

colleagues who are thinking about exploring faculty or 

administrative leadership, those early in leadership roles 

and thinking about future roles and graduate students 

considering all the possible careers that they might 

explore as they enter the academy.

100 




11:45 a.m. to 1:15 p.m. / T058 Congressional Hall A 

Kappa Tau Alpha and Association for Education 

in Journalism and Mass Communication 

Award Luncheon 


Beverly J. Horvit, Missouri 

and Jennifer D. Greer, Alabama, AEJMC President 

This luncheon recognizes both associations’ award winners 

and divisions’ top student paper winners. Anyone is 

welcome to attend. KTA remains committed to its guiding 

principles of Knowledge, Truth and Accuracy. Preregistration 

is required. 

1 to 2:30 p.m. / T059 Pew Research Center 


Off-site Session 

Pew Research Center 



This session at Pew Research Center’s offices in Downtown 

Washington will feature a seminar on the latest research 

into digital news. Pre-registration is required. 

1 to 2 p.m. / T060 Grand Ballroom North 




Spotlight — “Getting Published” 


Kathryn Harrison, Acquisitions Editor, Media/ 

Communication & Performing Arts, 

Peter Lang Publishing, Inc. 








This session is sponsored by Peter Lang Publishing, Inc. 

1:15 to 1:45 p.m. / T061 Grand Ballroom North 




Mayborn School of Journalism, University of North Texas 

honoring Scripts Howard Teacher of the Year Sheri 

Broyles. 

1:30 to 3 p.m. / T062 Grand Ballroom South 





Topic — Teaching for Today and Tomorrow: Preparing 

Students and Professionals for the Road Ahead 

1. Dimensions of News Media Literacy Among U.S. 

Advertising Students 

Jami Fullerton, Oklahoma State 

and Alice Kendrick, Southern Methodist 

2. “Keep It True-to-Life”: The Role of Experiential 

Learning in Advertising and Public Relations 

Pedagogy 

Amanda Weed, Ohio 

3. Rebuilding from the Ground Up: Developing a New 

Approach to Visual Communications Curriculum 

Adam Wagler 

and Collin Berke, Nebraska-Lincoln 

4. Training to Lead in an Era of Change: Insights from 

Ad Agency Leaders 

Sabrina Habib, South Carolina 

and Padmini Patwardhan, Winthrop 

Discussant 



Topic — Communication Technologies for Social 

Capital and Social Change 

5. Repurposed Geo-data and the Counterpublic: 

Folk Theories of Remote Check-ins to Standing 

Rock on Facebook 

Jeeyun Baik, Southern California 

6. Facilitating Role of Opinion Climate in Speaking 

Out: Testing Spiral of Silence in Social Media 

Sherice Gearhart and Weiwu Zhang, Texas Tech 

7. From the Margins to the Newsfeed: Social Media 

Audiences’ Disruption of the Protest Paradigm 


and Danielle Kilgo, Indiana

MULTIPLE BUILDINGS comprise Elon’s expanded School of Communications. 

One of the nation’s finest 

learning environments 

for communications 

Elon University’s School of Communications dedicated 

new facilities in 2017, providing students with 

a learning-centered environment and the latest 

technological resources on par with professional 

communications settings. The school’s quad 

brings together 1,300 students and 75 full-time faculty 

and staff in four adjoining buildings, creating 

a 105,000-square-foot learning laboratory. The 

expansion includes a 220-seat movie theater. 

The School 

The School of Communications offers multiplatform 

majors in Journalism, Strategic Communications, 

Cinema & Television Arts, Communication Design, 

Media Analytics and Sport Management. Through 

the benefits of ACEJMC accreditation, the school has 

grown to 20 percent of Elon’s student body. 

Elon Distinctives 

l All classes between 10 and 33 students 

l Two-thirds of Elon students study abroad 

l Winner of the 2016 collegiate Emmy for 

"30 Minutes" magazine show arising from a 

master class in partnership with "60 Minutes" 

l National Top 10 finishes in the 2016 Hearst 

writing and multimedia competitions and 

2017 broadcast competition 

l One of five finalists in the 2018 

Coca-Cola/Regal Films competition 

l AEJMC’s national Equity and Diversity Award, 2010 

l Operates Los Angeles program with 75 students 

in residence during spring and summer terms 

l Publishes the nation’s only undergraduate 

research journal in communications

102 




8. Information and Communication Technologies 

(ICTs) and Social Capital: Examining the Impacts 

of Mobile, PC, and Tablet Uses 

on Bonding and Bridging Social Capital 

Hoon Lee, Kyung Hee University 

and Scott Campbell, Michigan 

9. Big Data and Crowdfunding for Startups: An 

Application of Social Capital Theory 

Sun-Young Park, Massachusetts 

and Boon Thau Loo, Pennsylvania 

Discussant 

Cindy Vincent, Salem State 


Topic — Globalization and Representation: Adaptation 

and Identity in a Global Media Landscape 

10. Glocal Television Possibilities: When Guyana 

Meets US Appeals 

Emeka Umejei, University of the Witwatersrand 

and Carolyn Walcott, Georgia State 

11. Public Discourse at a Moment of Racial Reckoning 

in a Progressive City: An Ideological Analysis 


12. Local Identity in a Global City: Social Media 

Discourse of Hong Kong Localist Movement** 

Yidong Wang, Wisconsin-Madison 

13. The People Could Fly: (Re)Imagining the Slave 

Experience Through Afrofuturistic Readings 

of a Black Folktale 

Taryn Myers, Virginia Wesleyan 

14. Between Emotion, Politics and the Law: Narrative 

Transformation and Authoritarian Deliberation 

in a Mediated Social Drama* 

Limin Liang, City University of Hong Kong 

Discussants 

Suman Mishra, Southern Illinois, Edwardsville 

and Bob Trumpbour, Pennsylvania State, Altoona 

* Top Faculty Paper, First Place, Cultural and Critical 

Studies Division 

** Top Student Paper, Third Place, Cultural 

and Critical Studies Division 


15. Biting The Hand: Accountability Journalism in the 

Trade Press 

Rob Wells, Arkansas 

Lesbian, Gay, Bisexual, Transgender, Queer Interest 

Group 

16. Audience Perceptions of LGBTQ Television 

Characters 

Aryana Gooley, California State, Sacramento 

17. “Coming Out and Going Home”: Communication 

Action and Regional Mobility Among the Gay 

Supportive Families in Taiwan 

Hong-Chi Shiau, Shih-Hsin University 

18. HIV and Anniversary Journalism: Susceptibility 

and Severity Messaging in News Coverage of World 

AIDS Day 

Josh Grimm, Louisiana State 

and Joseph Schwartz, North Eastern 

19. The LGBT Activist on Social Media: Analyzing 

LGBT Activism Online in India and Taiwan 

Paromita Pain, Texas at Austin 

and Victoria Chen, National Chung Cheng 

University 

20. Who “Framed” Ramchandra Siras?: News 

Discourses of a Controversial Outing Case in India 

Khadija Ejaz 

and Leigh Moscowitz, South Carolina 


21. Cross-Country Collaboration: Student Evaluations 

of a Collaborative Journalism Project Between Two 

U.S. Universities 

Stephanie Bluestein, California State, Northridge; 

Karima Haynes, Bowie State 

and Yue Zheng, California State, Northridge 

22. Integrating Writing Processes: An Assignment Model 

Sharlene Kenyon, Oklahoma State 

Discussant 

Jackie Incollingo, Rider 

1:30 to 3 p.m. / T063 Congressional Hall B 



News Philosophies and Practices 


Therese Lueck, Akron 

Walter Lippmann and the Follies of Detachment 

Julien Gorbach, Hawaii at Manoa 

Journalism with the Voice of Authority: The Rise of 

Interpretive Journalism at The New York Times, 1919- 

1931 

Kevin Stoker, Nevada, Las Vegas 

“Songs of the Craft”: Poetry in 20th-Century U.S. 

Newsrooms 

Will Mari, Northwest

Putting Skills Into Practice 

The School of Communications encourages its 

students to get involved in student media and 

campus organizations to enhance their ability to 

write, edit, analyze, take video and photographs, and 

produce multimedia content that reaches a broad 

audience. Our students have responded, creating 

accurate, thoughtful and often award-winning work. 

ELON COMPLETELY renovated the Jane and Brian 

Williams Studio, a versatile broadcast center with 

all-LED lighting, flexible sets and exterior windows to 

downtown Elon. The expansion project also includes 

a new multiplatform student newsroom as well 

as headquarters for Live Oak Communications, a 

student-run strategic communications agency. 

In 2018, Elon students and their teams earned five 

BEA Festival of Media Arts honors, including national 

first-place awards in the TV Newscast (3 days per 

week or less) and TV News Magazine competitions. 

Additionally, four strategic communications majors 

received highly selective scholarships provided by 

The LAGRANT Foundation, which supports ethnic 

minority communications students. At the 

undergraduate level, Elon tied for tops in the nation 

for 2018 TLF scholarships.

104 




“More News Space”: Money and Publisher 

W. E. “Ned” Chilton III, 1953-1984 

Edgar Simpson, Central Michigan 

Discussant 

Aimee Edmondson, Ohio 

1:30 to 3 p.m. / T064 Renaissance Ballroom West A 



Focus on Africa: Media Representations 

and Audience 


Yusuf Kalyango, Ohio 

The West Africa We Were Shown: A Visual Content 

Analysis of the 2014 Ebola Epidemic* 

Phillip Arceneaux, Florida 

Foreign Correspondents and the International News 

Coverage of Africa** 

Mel Bunce, City, University of London 

Thanks, Tonto and Mercy! Three Nigerian Newspapers’ 

Coverage of Domestic Violence in Nigeria, 2015-2017 

Aje-Ori Agbese, Texas, Rio Grande Valley 

De-Westernizing Journalism Curriculum in Africa 

through Glocalization and Hybridization 

Bellarmine Ezumah, Murray State 

Discussant 

Zakaria Tanko Musah, Ghana Institute of Journalism 

* Second Place Student Paper, Markham Competition 

** African Journalism Studies Best Paper Award 

1:30 to 3 p.m. / T065 Newseum 


Off-site Tour 

Trip to the Newseum 


Dean Cummings, Georgia Southern 

Tour arranged by MCSD. 

1:30 to 3 p.m. / T066 Meeting Room 04 



Accuracy and Objectivity in Media Coverage: 

Ethical Expectations and Actual Practice 



Electoral Reckonings: Press Criticism of Presidential 

Campaign Coverage, 2000-2016* 

Elizabeth Bent, Kimberly Kelling 

and Ryan Thomas, Missouri 

Fair Balance or False Balance: Accuracy or Impartiality 

in Climate Change Reporting 

Kristin Timm, Richard Craig, William Yagatich, 

and Ed Maibach, George Mason 

The Discursive (Re)Construction of the Objectivity Norm 

Tim Vos, Ryan Thomas, Amanda Hinnant 

and Yong Volz, Missouri 

Discussant 

Linsday Palmer, Wisconsin-Madison 

* Top Faculty Paper 







1:30 to 3 p.m. / T068 Mount Vernon A 



Emerging Scholarship in Corporate 

Social Responsibility 


Natalie T.J. Tindall, Lamar 

Predicting Public Support: Applying the Situational 

Theory of Problem Solving to Prosocial Behaviors 

Brooke McKeever 

and Robert McKeever, South Carolina; 

Geah Pressgrove, West Virginia; 

and Holly Overton, South Carolina

M.A. in Interactive Media 

Elon’s M.A. in Interactive Media degree prepares 

students to think strategically across platforms, 

create interactive media content, and manage 

information in a digital age. This year, iMedia 

students produced interactive projects for the 

public good in Costa Rica, Haiti, Nicaragua and the 

Netherlands. The intensive 10-month program 

serves up to 36 full-time students a year, and we 

just graduated our ninth class. 

A Partnership with Business 

The School of Communications has partnered with 

the Elon business school to create a Corporate 

Communications concentration in the M.S. in 

Management degree. Business faculty teach the 

business courses, and Communications faculty 

teach corporate communications courses. 

INTERACTIVE MEDIA graduate students 

spend January working on a team project 

for the public good, which includes an 

international trip to collect audio and video 

content. Interactive content and websites 

are produced to help nonprofit organizations 

build community recognition, increase 

volunteer efforts and boost fundraising. 

Sponsor of the D.C. App 

Elon is pleased to be the sponsor of AEJMC’s 2018 conference app, offering information on sessions and speakers.

106 




What about Our Cause? The Influence of Corporate 

Social Responsibility on Nonprofit Reputation 

Virginia Harrison, Pennsylvania State; 


Pratiti Diddi, and Jeff Conlin, Pennsylvania State 

What Shapes Environmental Responsibility Perceptions? 

Measuring Collectivistic Orientations as a Predictor of 

Situational Motivations and Communicative Action 

Jo-Yun Queenie Li, Joon Kyoung Kim, 

Holly Overton, Nandini Bhalla, Won-ki Moon; 

Minhee Choi and Nanlan Zhang, South Carolina 

A Cross-National Comparison of Transparency Signaling 

in CSR Reporting 

Hyejoon Rim, Jisu Kim 

and Chuqing Dong, Minnesota Twin Cities 

The Co-Creation of Shared Value: What Motivates the 

Public to Engage with Participatory Corporate Social 

Responsibility Activities 

Sun Young Lee, Maryland; Young Kim, Marquette 

and Yeuseung Kim, Chung-Ang University 

Discussant 

Denise Sevick Bortree, Pennsylvania State 




Student Internships and Fair Labor Revisited 


Karen Theveny, Pennsylvania State, Brandywine 

Panelists 

Susan Tomasovic, Internship Coordinator, 

Communication Department, George Mason 

Synergistic Effect of Internship and Senior Seminar 

Courses in Mass Communications 

Cherlyn Johnson and Bridgett Robertson, 

Virginia State 

1:30 to 3 p.m. / T070 Meeting Rooms 8-9 



JMCQ Special Issue Research Panel Session 

Social Media and Political Campaigning 

Around the World 


Daniela Dimitrova, Iowa State 

Panelists 

Jörg Matthes, Vienna 

John Brummette, Radford 

Michael Chan, Chinese University of Hong Kong 

Maria Elizabeth Grabe, Indiana 

Brent Hale, Indiana 

Sara Yeo, Utah 

1:30 to 3 p.m. / T071 Renaissance Ballroom East 





First Amendment Award Presentation and Panel 


Wendy Wyatt, St. Thomas 

Panelists 

Ronan Farrow, investigative reporter, 

The New York Times 

Jodi Kantor, The New York Times 

Megan Twohey, The New York Times 

This session honors Ronan Farrow, Jodi Kantor and 

Megan Twohey, who broke the Harvey Weinstein story. 

The three award recipients will talk about their work and 

the shift in the cultural conversation about sexual harassment/assault 

that has followed. 

1:30 to 3 p.m. / T072 Renaissance Ballroom West B 



PF&R/Business Panel Session 

Gerald M. Sass Award for Distinguished Service to 

JMC Education and ASJMC General Business Meeting 


Sonya Duhé, Loyola New Orleans, ASJMC President 

Part I — 2018 Sass Award Presentation 

Recipient: Mizell Stewart, Vice President for news 

operations, Gannett/USA Today 

Part II — General Business Meeting 

Current ASJMC activities 

ASJMC Winter Workshop 

Installation of ASJMC 2018-19 President 

Thor Wasbotten, Kent State


107 




South Asia Communication Association 


South Asia Initiative Committee Meeting 


Rauf Arif, Texas Tech 

3:15 to 4:45 p.m. / T076 Meeting Room 02 


Risk Division and Political Communication Interest 

Group 


Discussing Politically Contentious Scientific Issues 

in the Classroom 

Facilitators 

Pallavi Guha, SACA 


Jordan Stalker, SACA 

Led by the SACA Executive Committee, this business 

meeting will identify current and future initiatives for 

the association. A guest from the International Center 

for Journalists will identify how that organization can 

assist SACA members interested in possible teaching or 

research opportunities in the South Asia region. 


Mitchell Bard, Iona 

Panelists 

Asheley Landrum, Texas Tech 

Linda Pfeiffer, Purdue 


Kate Roberts Edenborg, Wisconsin-Stout 

D. Jasun Carr, Idaho State 


Tuesday 

3 to 4 p.m. / T074 Grand Ballroom North 




Spotlight — “Getting the Money: Grant Writing” 


Kimberly Bissell, Alabama 








3:15 to 5:30 p.m. / T075 Ogilvy DC 


Off-site Tour 

Tour to Ogilvy DC 

Hosting 

Jay Adams, Virginia Commonwealth; Ogilvy DC 

Meet in the lobby of the Renaissance Hotel at 3:15 p.m. 

to board bus. Bus will depart promptly at 3:30 p.m. for 

Ogilvy DC, 1111 19 th Street, NW, Floor 3. 


and Media Management, Economics and 



Teaching Data Analytics 


Todd Holmes, California State, Northridge 

Panelists 

Ann Hollifield, Georgia 



Stephen Marshall, East Tennessee State 

Natalie Brown Devlin, Texas at Austin 

Itai Himelboim, Georgia 




Making Sense of Media in the Trump Era 


Ruth DeFoster, St. Catherine 

Ignoring Our Own Cultural Imperialism: New York 

Times’ International 

Coverage of Birth Control 1960-2002 

Ana Garner and Christina Mazzeo, Marquette

108 




Old Norms, New Platforms: Objectivity and U.S. 

Reporting About Race in a Digital Era 

Carolyn Nielsen, Western Washington 

Tsunamis on the U.S.-Mexico Border? Use of Metaphors 

in News Coverage of Unaccompanied Minors 

Christa Reynolds 

and Celeste Gonzalez de Bustamante, Arizona 

Identity Formation and Voter Suppression: The 

Iconography of Fake Memes in the 2016 Presidential 

Election 

Melissa Janoske, Robert Byrd 

and Dana Cooper, Memphis 

Talking Back: Journalists Defending Attacks Against 

Their Profession in the Trump Era 

Michael Koliska, Georgetown, Alison Burns 

and Kalyani Chadha, Maryland, College Park 

Discussant 

Jacqueline Lambiase, Texas Christian 

3:15 to 4:45 p.m. / T079 Congressional Hall A 

Electronic News and Visual Communication Divisions 


Visual News and Photojournalism in the 

Age of Social Media 


Erik Palmer, Southern Oregon 

Panelists 

Local News and the New Media Landscape 

Debora Rae Wenger, Mississippi 

and Bob Papper, Hofstra 

Toward a Transformative Ethic for Seeing 

—and Living 

Julianne Newton, Oregon 

I “Like” That: Exploring the Characteristics That 

Promote Social Media Engagement with News 

Photographs 

Keith Greenwood, Missouri 

“Really Social Photojournalism” and a 

Photojournalistic Changing of the Guard 


3:15 to 4:45 p.m. / T080 Meeting Rooms 12-13 



Traditional Journalists on Gaming Journalism: 

Metajournalistic Discourse on the Rise of Lifestyle 

Journalism 


and Tim Vos, Missouri 

Understanding the Process of Construction 

of Masculinity in Indian Editions of Global Men’s 

Lifestyle Magazines 

Suman Mishra, Southern Illinois-Edwardsville 

Satiric Magazines in Latin America as Hybrid 

Alternative Media 

Paul Alonso, Georgia Tech 

Discussant 

Lona Cobb, Winston-Salem State 

3:15 to 4:45 p.m. / T081 Congressional Hall B 

Newspaper and Online News and History Divisions 


Contextualizing Media Credibility in 2018 


Kristin Gustafson, Washington-Bothell 

and Susan Keith, Rutgers 

Panelists 

Kathy Roberts Forde, Massachusetts-Amherst 

Kristen Heflin, Kennesaw State 

David T.Z. Mindich, Temple 

Kim Pearson, New Jersey 

Brad Schwartz, Princeton 

3:15 to 4:45 p.m. / T082 Penn Quarter 



Past Heads Meeting 


Susan Grantham, Hartford 



The Magazine as Construct of Reader Lifestyle


109 






Views from the Trenches: Women Professionals 

Tell Their Stories 


Nikoleta Morales, managing editor/publicist, 

ExtraNews Online; Chicago 

Panelists 

Tracy Everbach, North Texas 

Maya Francis, Washington, co-founder, Critical 

Frequency Podcast Network 

Alicia Shepherd, former ombudsperson, NPR; 

Washington 


Community College Journalism Association 

and Scholastic Journalism Division 


Third Annual 10 Tech Tools in 10 Minutes 


Toni Albertson, Mt. San Antonio 

Panelists 

Michelle Dowd, Chaffey 

Nicole Kraft, Ohio State 

Brian Steffan, Simpson 

Jenn Mackay, Virginia Tech 

Carrie Brown-Smith, City University of New York 





Top Research Papers 

The Women’s Convention: Reclaiming a Movement** 

Katie Blevins, Idaho 

“A Group That’s Just Women for Women:” Feminist 

Affordances of Private Facebook Groups for 

Professionals*** 

Urszula Pruchniewska, Temple 

Gendered Visa: Korean Dependent Visa Women’s 

Media Use and Home-making in U.S.**** 

Claire Shinhea Lee, Texas at Austin 

* First-place Faculty Paper 

** Second-place Faculty Paper 

*** First-place Student Paper 

****Second-place Student Paper 

3:15 to 4:45 p.m. / T086 Mount Vernon B 

Entertainment Studies Interest Group 


Exploring Television: Sitcom Fathers, Music 

and Narratives, and Entertaining Sports 


Gregory Adamo, Morgan State 

Forever Foolish? A Content Analysis of Depictions 

of Fathers in U.S. Sitcoms 

Stephen Warren, Eean Grimshaw, Gichuhi Kamau, 

Menno H. Reijven and Congcong Zhang, 

Massachusetts, Amherst 

Soundtracking Shondaland: Televisual Identity Mapped 

Through Music 

Jennifer Billinson 

and Michaela Meyer, Christopher Newport University 

When 18 Days of Television Coverage Is Not Enough: A 

Six-Nation Composite of Motivations for Mobile Media 

Use in 2018 Winter Olympic Games 

Andrew Billings, Alabama; 

Natalie Brown-Devlin, Texas at Austin; 

Kenon Brown, Alabama 

and Michael B. Devlin, Texas State 

“Mighty” Kacy: Gender Framing within American 

Ninja Warrior 

Kevin Hull and Lauren Schwartz, South Carolina 

Tuesday 



#SELFIES at the 2016 Rio Olympics: Comparing Self- 

Representations of Male and Female Athletes from the 

U.S. and China* 

Qingru Xu, Cory Armstrong 

and Panfeng Yu, Alabama 

Discussant 

Donnetrice Allison, Richard Stockton University

110 






and Media Ethics Division 


The Proof is in the Picture: Verification Techniques 

for User-Generated Content 


Jennifer Brannock Cox, Salisbury 

Panelists: 

Mandy Jenkins, Storyful 


Michael Martinez, Tennessee-Knoxville 


3:15 to 4:45 p.m. / T088 Mount Vernon A 



Publications 


Prior Publications: What Are They? Do You 

Have Any? And How Do They Impact Your 

Future Publications? 


Patricia Moy, Washington 

Panelist 

Martha Avtandilian, SAGE Publishing 

Louisa Ha, Bowling Green State 

Scott Reinardy, Kansas 

With online options available through university archives, 

and personal and professional websites, the posting and/ 

or publication of research materials has created some 

confusion about prior publication, plagiarism and copyright. 

This session addresses what “prior publication” 

entails as well as its implications for authors. 


The Urban Communication Foundation 


Gene Burd Urban Journalism Award 


Gary Gumpert, President, Urban Communication 

Foundation 

Presentation 2018 Gene Burd Urban Journalism Award 

Recipient 

Brian Lehrer, “Brian Talks New York,” WNYC 

93.9 FM, AM 820 

Panelists 

Brian Lehrer, “Brian Talks New York,” 

Paul S. Voakes, Colorado 

Charles Self, emeritus, Oklahoma 

Peter Haratonik, Urban Communication 

Foundation 

Susan J. Drucker, Hofstra 

Gary Gumpert, Urban Communications 

Foundation 

David Lieberman, The New School 

Brian Lehrer is a notable voice and his weekly dialogue 

with Mayor Bill de Blasio is an important connection 

between bureaucracy and citizens. In addition to his 

radio life, “Brian Talks New York” is a weekly television 

program over CUNY-TV where the voices of the 

city are heard. In 2017 some of the topics included food 

and nutrition, gender bias, and congestion pricing. As 

a lifelong New Yorker with a commitment to the urban 

condition, Brian Lehrer is simply a part of everyday life 

and required listening for several members of the Urban 

Communication Foundation Board. 

5 to 6:30 p.m. / T090 Mount Vernon B 



Student Research on Cues, Behaviors, 

and Influencers in Digital Media 


Sreyoshi Dey, Syracuse 

Normalized Incivility: Two Studies of Social Cues 

in Online Discussion Environments* 

David Silva, Washington State 

Human-like vs. Robot-like Voices: The Impact of 

Voice Cues of a Virtual Health Assistant and Health 

Information Sensitivity on Users’ Perception and 

Behavioral Intentions** 

Hyun Yang and Ruosi Shao, Pennsylvania State 

Snapping Up Legacy Media: Using Theory of 

Affordances to Explain How News Outlets Behave on 

Snapchat*** 

Eun Jeong Lee, Texas State 

Playing the Visibility Game: How Digital Influencers 

and Algorithms Negotiate Influence on Instagram 

Kelley Cotter


111 



Intermittent Discontinuance: The Case of Twitter 

Margaret Yee Man Ng, Texas at Austin 

Discussant: 

YoungAh Lee, Ball State 


** Second Place Student Paper 

*** Third Place Student Paper 

5 to 6:30 p.m. / T091 Mount Vernon A 



History Division Top Research Papers 


Erika Pribanic-Smith, Texas at Arlington 

The Amateurs’ Hour: South Carolina’s First Radio 

Stations, 1913-1917* 

John Armstrong, Furman 

The War Council: Editors’ Publicity Campaign for Louis 

D. Brandeis’s1916 Supreme Court Nomination** 

Erin Coyle, Elisabeth Fondren, 

and Joby Richard, Louisiana State 

Driving and Restraining Forces Toward the 

Marketization of Broadcasting in the UK in the 1990s*** 

Madeleine Liseblad, Middle Tennessee State 

Textbook News Values: A Century of Stability 

and Change*** 

Perry Parks, Michigan State 

The Danger of Words: Major Challenges Facing Myanmar 

Journalists on Reporting the Rohingya Conflict* 

Nyan Lynn, Kansas 

Nation’s Media Usage and Immigration Attitudes in 

Europe: Exploring Contextual Effects Across Media 

Forms, Structures, and Messages** 

Olesya Venger, Nevada, Las Vegas 

Framing the Colombian Peace Process: Between Peace 

and War Journalism*** 

Victor García-Perdomo, Universidad de La Sabana; 


and Danielle Kilgo, Indiana 

ProQuote: A German Women Journalists’ Initiative to 

Revolutionize Newsroom Leadership**** 

Karin Assmann, Maryland 

and Stine Eckert, Wayne State 

Discussant 

Ammina Kothari, Rochester Institute of Technology 

* First Place Student Paper, Markham Competition 

** First Place Paper, Stevenson Open Competition 

*** Second Place Paper, Stevenson Open Competition 

and First Place Paper, Latino/Latin American 


****Third Place Paper, Stevenson Open Competition 

5 to 6:30 p.m. / T093 Meeting Rooms 02 



Top Papers in LAWP 

Tuesday 

Discussant 


* First-Place Faculty Paper 

** Second-Place Faculty Paper 

*** First-Place Student Paper (tie) 

5 to 6:30 p.m. / T092 Meeting Rooms 10-11 



Award Winning Papers in International 

Communication 


Mohammed Al-Azdee, Bridgeport 


Daxton “Chip” Stewart, Texas Christian 

“Walk” This Way, Talk This Way: How Do We Know 

When the Government is Speaking After Walker v. Sons 

of the Confederacy?* 

Kristen Patrow, North Carolina Chapel Hill 

Journalists’ Access to 911 Recordings: Balancing 

Privacy Interests and the Public’s Right to Know about 

Casualties**** 

Erin Coyle 

and Stephanie Whitenack, Louisiana State 

The Artificial Marketplace: Examining Potential 

Changes to Marketplace Theory in the Era of AI 

Communicators*** 

Jared Schroeder, Southern Methodist

At the University of Nebraska–Lincoln, we’re preparing professional 

journalists and communicators through experiential learning. 

UNDERGRADUATE PROGRAMS 

Advertising and Public Relations 

Broadcasting 

Journalism 

Sports Media and Communication 

Launched in Fall 2017 

GRADUATE PROGRAMS 

Integrated Media Communications (M.A.) 

Professional Journalism (M.A.) 

PR and Social Media (Graduate Certificate) 

Launched in Fall 2017

IN 2017 

• Our students won the 2017 Robert F. Kennedy Journalism Award—the first ever Grand Prize 

awarded to a college group. 

• We launched a series of five faculty-led Pop-Up Classes. 

• We hired a new career specialist and three new faculty positions. 

• Professors were awarded the Sigma Delta Chi Award from the Society of Professional 

Journalists for the documentary “Black Jack Pershing: Love and War.” 

• Two alumni were part of Pulitzer Prize-winning teams. 

HANDS-ON STUDENT EXPERIENCES 

• Depth Reports — Students produce long-form, visually-rich stories on issues in Nebraska, 

the region and other countries such as Bolivia and Cuba. 

• Jacht Ad Lab — Our student-powered agency works with real clients 

• Drone Journalism Lab — Students and faculty build drone platforms, use them in the field 

and research the ethical, legal and regulatory issues 

• Global Eyewitness Program — Students travel twice a year to photograph places of great 

human need and produce multimedia stories for public presentation 

• Nebraska Mosaic — Students create stories on growing immigrant and refugee 

communities in Nebraska 

• Nebraska Spring Game — Students learn about promotion and events, shoot photos and 

video from the sidelines and shadow sports professionals 

The University of Nebraska does not discriminate based upon any protected status. Please see go.unl.edu/nondiscrimination. 

©2018, The Board of Regents of the University of Nebraska. All rights reserved. 1806.005

114 




Report and Repeat: Investigating Facebook’s Hate 

Speech Removal Process** 

Caitlin Carlson and Hayley Rousselle, Seattle 

Discussant 

Paul Siegel, Hartford 


** First Place Faculty Paper 

*** Second Place Faculty Paper 

****Third Place Faculty Paper 




The Magazine as Marketplace: Driving Consumer 

Behavior Through Magazine Editorials, 

Advertorials, and Ads 



So They Claim: A Content Analysis of Magazine Food 

Advertising Techniques and Branding 

Clay Craig, Texas State; 

Mark Flynn, Emmanuel College; 

and Andrea Bergstrom, Coastal Carolina 

Selling Yoga “Off the Mat”: A 10-year Analysis 

of Lifestyle Advertorials in Yoga Journal Magazine 

Nandini Bhalia 

and Leigh Moscowitz, South Carolina 

and Jane O’Boyle, Elon 

Slam Dunk: An Examination of How Magazines Can 

Create Loyal Readers 

Kevin Hull, Joon Kyoung Kim, Danial Haun, 

and Matthew Stilwell, South Carolina 

Discussant 


5 to 6:30 p.m. / T095 Meeting Room 03 



Best of Mass Communication & Society 


John Pollock, College of New Jersey 

The Effects of Constructive Television News Reporting 

on Prosocial Intentions and Behavior in Children* 

Iris Van Venrooij, Tobias Sachs, 

and Mariska Kleemans, Radboud 

Errors and Corrections in Digital News Content** 

Kirstie Hettinga, California Lutheran; 

and Alyssa Appelman, Northern Kentucky 

Who is to Blame? Analysis of Government and News 

Media Frames During the 2014 Earthquake in Chile*** 

Magdalena Saldana, Pontificia Universidad Catolica 

de Chile 

Nothing But the Facts? Journalistic Objectivity and 

Media Adjudication of President Trump’s False 

Claims**** 

Deborah Dwyer, North Carolina at Chapel Hill 

Asian International Students’ Mass Media Use and 

Acculturation Strategies: Considering the Effects of 

Remote Acculturation***** 

Lin Li, Michigan State 

and Shao Chengyuan, North Carolina at Chapel Hill 

Discussant 

Brendan Watson, Michigan State 

* First Place, Open Competition 

** Second Place, Open Competition 

*** Third Place, Open Competition 

**** First Place, Moeller Student Competition 

***** First Place, Student Competition 




Ethical Issues in Media: Past, Present and Future 


Patrick Plaisance, Pennsylvania State 

How “Activist” Ethics at the New York Times Overcame 

the “Chilling Effects” of Libel 

Ali Mohamed, United Arabs Emirates 

An Ethic of Advocacy: Metajournalistic Discourse on the 

Practice of Leaks and Whistleblowing 2004-2017 

Brett Johnson, Elizabeth Bent, 

and Caroline Dade, Missouri 

Discussant 

Jenn Mackay, Virginia Tech


115 





Division 


Top Faculty Papers: The Modernization of News 

and Audio Media for Contemporary Audiences 


Amber Hinsley, Saint Louis University 

Entrepreneurial News Sites as Worthy Causes? Exploring 

Readers’ Motivations Behind Donating to Latin 

American Journalism* 


Substitutability and Complementarity of Broadcast 

Radio and Music Streaming Services: The Millennial 

Perspective** 

Sylvia Chan-Olmsted and Rang Wang, Florida 

and Kyung-Ho Hwang, Kyungnam University 

McClatchy’s “Reinvention” and Socially Responsible 

Existentialists: An Interview-based Case Study*** 

Mark Poepsel, Southern Illinois Edwardsville 

Legacy Media Versus Emerging Online Sources of News 

and Information: A Niche Study of Competition and 

Coexistence*** 

Mohammad Yousuf, Oklahoma 

Discussant 

Patricia Phalen, George Washington 



*** Third Place Faculty Paper 

3. Hashtag Activism and Message Frames Among 

Social Movement Organizations: Semantic 

Network Analysis and Thematic Analysis 

of Twitter During the #MeToo Movement 

Ying Xiong, Moonhee Cho, 

and Brandon Boatwright, Tennessee 

4. The Roles of Self-identity Cues and Public Self- 

Consciousness in Supporting Stigmatized Causes 


Hyun Ju Jeong, Kentucky 

Discussant 


Group II — Ethics and Moral Reasoning 

5. Ethical Public Typology: How Does Moral 

Foundation Theory and Anti-Corporatism 

Predict Public Differences in Crisis? 

Seoyeon Hong, Rowan 

and Kyujin Shim, Melbourne 

6. Public Relations Primed: An Update on 

Practitioners’ Moral Reasoning, from Moral 

Development to Moral Maintenance 

Erin Schauster, Colorado-Boulder; 

Marlene Neill, Baylor; 

Patrick Ferrucci, Colorado-Boulder; 

and Edson Tandoc, Nanyang Technological 

7. Do Ethics Matter? Investigating Donor Responses 

to Primary and Tertiary Ethical Violations, 

Nicholas Browning 

Sung-Un Yang, Young Eun Park, Ejae Lee 

and Taeyoung Kim, Indiana 

8. Being Honest to the Public: Lessons from Haidilao’s 

Crisis Responses in China 

Keqing Kuang and Sitong Guo, Alabama 

Tuesday 

5 to 6:30 p.m. / T098 Grand Ballroom North 

Public Relations and Visual Communication Divisions 



Group I — Activist Communication and Social 

Movements 

1. Grassroots Social Movements in Authoritarian 

Settings: Examining Activists’ Strategic 

Communication and Issues Management 

Hue Duong, Georgia; Hong Vu, Kansas; 

and Nhung Nguyen, Vietnam Ministry of Health 

2. Strategic Value of Conflict, Activism, 

and Two-way Communication: Examination 

of Activists’ Public Relations 

Minhee Choi, South Carolina 

and Soo-Yeon Kim, Sogang University 

Discussant 

Dean Kruckeberg, North Carolina, Charlotte 

Group III — Building Relationships: Shared Value, 

Authenticity, and Social Capital 

9. Developing a Measure of Social Capital 

for Public Relations 

Melissa Dodd, Central Florida; 

Hilary Sisco, Quinnipiac; 

John Brummette and William Kennan, Radford 

10. How Public Relations Builds Mutually Beneficial 

Relationships: Public Relations’ Role in Creating 

Shared Value (CSV) 

Jungkyu Rhys Lim, Maryland 

11. Authenticity in Public Relations: The Effects 

on Organization-Public Relationships 

Ejae Lee, Indiana

116 




12. The Relationship Exchange Theory: Organization- 

Public Relationship (OPR) in the Big Data Age 

Hongmei Shen, San Diego State 

and Yang Cheng, North Carolina State 

Discussant 

Burton St. John III, Old Dominion 

Group IV — Consumer Communication and 

Relationship Building 

13. Examining the Impact of Electronic Word-of- 

Mouth on Consumer Responses toward Company: 

An Alignment-Social Influence Model 

Zifei Chen, San Francisco 

14. The Love-Hate Dilemma: Interaction of Relationship 

Norms and Service Failure Severity on Consumer 

Responses 

Zongchao Cathy Li, San José State; 

Weiting Tao, Miami 

and Linwan Wu, South Carolina 

15. Exploring Negative Peer Communication 

of Companies on Social Media and Its Impact 

on Organization-Public Relationships 

Yufan Qin and Rita Men, Florida 

16. #sponsored: Consumer Insights on Social Media 

Influencer Marketing 

Savannah Coco and Stine Eckert, Wayne State 

Discussant 

Geah Pressgrove, West Virginia 

Group V — Health, Environmental, and Social Issues in 


17. H1N1 News Releases: How Two Media Systems 

Responded to a Global Health Pandemic 

Seow Ting Lee, Colorado-Boulder 

18. Publics’ Communication on Controversial 

Sociopolitical Issues: Extending the Situational 

Theory of Problem Solving 

Weiting Tao, Cheng Hong, 

Wanhsiu Sunny Tsai, 

and Bora Yook, Miami 

19. Climate Change Lacuna Publics: Advancing 

a Typology of Climate Change Disinformation 

Susceptibility 

Arunima Krishna, Boston 

20. Championing Women’s Empowerment as a Catalyst 

for Purchase Intentions: Testing the Mediating Roles 

of OPRs and Brand Loyalty 

in the Context of Femvertising 

Alan Abitbol, Dayton 

and Miglena Sternadori, Texas Tech 

Group VI — Crisis Communication Theory Building 

21. Were These Studies Properly Designed?: An 

Examination of 22 Years of SCCT Experimental 

Research 

Ziyuan Zhou, Alabama; 

Xueying Zhang, Kent State; 

and Eyun-Jung Ki, Alabama 

22. Ultimate Crisis? An Examination of Linguistics 

and Ultimate Attribution Error in International 

Organizational Crisis 

Jonathan Borden, Syracuse 

and Xiaochen Zhang, Kansas State 

23. Leadership Matters: The Role of Values Congruence 

Between Leadership Styles and CSR Practice 

in Corporate Crises 

Jeesun Kim, Incheon National University; 

Hyun Jee Oh, Hong Kong Baptist University; 

and Chang-Dae Ham, Illinois at Urbana- 

Champaign 

24. Linguistic Crisis Prediction: An Integration 

of Linguistic Categorization Model in Crisis 

Communication 

Xiaochen Zhang, Kansas State 

and Jonathan Borden, Syracuse 

Discussant 

Brooke Fisher Liu, Maryland 

Group VIII — Social Responsibility and Social Media 

25. The Quest for Legitimacy and the Communication 

of Strategic Cross-Sectoral Partnership on Facebook: 

A Big Data, Social Network Study 

Aimei Yang, Southern California 

and Yi (Grace) Ji, Virginia Commonwealth 

26. Exploring Tweeting at the Top: Do Goods- 

Producing and Service-Producing Firms Appear 

to Set Different CSR Agendas on Twitter? 

Rachel Deems, Moroch Partners 

and Jan Wicks, Arkansas 

27. Control Mutuality and Social Media Revisited: 

A Study of National Animal Welfare Donors 

Diana Sisson, Auburn 

28. Understanding the Effects of CSR Message Frames 

and NWOM Sources on Customers’ Responses on 

Social Networking Sites 

Liang (Lindsay) Ma 

and Joshua Bentley, Texas Christian 

Discussant 

Stephanie Madden, Memphis 

Discussant 

Maria Len-Ríos, Georgia


117 



Group IX — Examining Crisis Communications Cases 

29. Emotions in Social Media: An Analysis of Tweet 

Responses to MH370 Search Suspension 

Announcement 

Su Lin Yeo, Augustine Pang, Michelle Cheong, 

and Jerome Yeo, Singapore Management 

University 

30. The Sun (UK) Newspaper: Strategic Audience 

Choice in Crisis and Reputation Repair, 

Chuka Onwumechili, Howard 

31. Responding to Product (Mis)Placement: Analyzing 

Crock-Pot’s Paracrisis Management 

Chelsea Woods, Virginia Tech 

32. Revisiting Social-mediated Crisis Communication 

Model: The Lancôme Regenerative Crisis After 

Hong Kong Umbrella Movement 

Angela Mak 

and Song Ao, Hong Kong Baptist University 

Discussant 


Group X — Publicity and Perceptions 

33. Research Exposure: Associations Between 

University News Release Features, News Coverage, 

and Page Views 

Tien-Tsung Lee, Peter Bobkowski, 

George Diepenbrock 

and Patrick Miller, Kansas 

34. Exploring Country-of-Origin Perceptions 

and Ethnocentrism: Implications for PR Efforts to 

Introduce U.S. Dairy Products to China 

Xiaohan Xu, Maria Leonora Comello, 

and Suman Lee and Richard Clancy, North 

Carolina at Chapel Hill 

35. Dealing with Negative Publicity: A Dual Process 

Model of CSR Fit and CSR History on Purchase 

Intention and Negative Word-of-Mouth 

Angie Chung and Kang Bok, Auburn 

36. Combatting Fake News: Examining the Role 

of Crisis Response Strategies and Issue Involvement 

in Refuting Misinformation on Social Media 


Denise Bortree, Christen Buckley, 

Pratiti Diddi and Anli Xiao, Pennsylvania State 

37. “Comments Are Disabled For This Video”: 

A Heuristic Approach to Understanding Perceived 

Credibility of CSR Messages on YouTube 

Menqi Liao 

and Angela Mak, Hong Kong Baptist University 

Discussant 

Tim Penning, Grand Valley State 

Group XI — Employees and Internal Communication 

38. Dedicated to Our Work? An Employee Engagement 

Modelin Public Relations 

Hongmei Shen, San Diego State; 

and Hua Jiang, Syracuse 

39. Driving Employee Organization Engagement 

through CSR Communication and Employee 

Perceived Motives: CSR-Related Social Media 

Engagement and Job Engagement 

Hua Jiang, Syracuse; 

and Yi Luo, Montclair State 

40. The Internal Angle of Police-worn Body Cameras: 

A Hommo Narrans Approach to Understanding 

Patrol Officer Perceptions of Body Cameras 

Brooke Fowler, Maryland, College Park 

41. Enhancing Student Learning Outcomes from the 

Business Side of Student-run Public Relations 

and Communication Firms 

Tham Nguyen and Robert Pritchard, Oklahoma 

Discussant 

Kenneth Plowman, Brigham Young 


42. All About the Visuals: Image Framing, Emoticons 

and Sharing Intention 

for Health News Posts on Facebook 

Yen-I Lee and Bartosz Wojdynski, Georgia; 

Katherine Keib, Oglethorpe University; 

Brittany Jefferson, Jennifer Malson, 

and Hyoyeun Jun, Georgia 

43. Analysis of Photographic Representation 

of Refugees in France 

Anna Warner, Tamara Welter, 

and Jason Brunt, Biola 

44. Effects of Playfulness on SNS Emoji Uses 

Yeon Joo Kim, Jaehee Park 

and Jong Woo Jun, Dankook University 

Discussant 


45. From Reel Life to Real Change: The Role 

of Social-Issue Documentary in U.S. Public Policy 

Caty Borum Chattoo 

and Will Jenkins, American 

46. Internet Memes and Copyright Law: The 

Transformativeness of Memes as Tools of Visual 

Communication in Remix Culture 

Natalia Mielczarek 

and W. Wat Hopkins, Virginia Tech 

47. Mobile Augmented Reality through the Lens 

of Eye Tracking 

Sheree Josephson 

and Melina Myers, Weber State 

Tuesday

118 




Discussant 

Philip Loubere, Middle Tennessee State 

48. Profile Pictures Across Platforms: How Identity 

Visually Manifests Itself Among Social Media 

Communities 

T.J. Thomson and Keith Greenwood, Missouri 

49. Recoding Language with Fatty Memes: How 

Chinese Netizens Avoid Censorship When Referring 

to North Korea 

Bingbing Zhang, Sherice Gearhart, 

and David Perlmutter, Texas Tech 

50. Reinvestigating the Beauty Match Up in Food Ads 

Juan Mundel, DePaul 

and Patricia Huddleston, Michigan State 

Discussant 

Erik Palmer, Southern Oregon 

51. Social Beautifying: How Personality Traits 

and Social Comparison Affect Selfie-Editing 

Behavior 

Yu Liu and Weirui Wang, Florida International 

52. Two Days, Twenty Outfits: Coachella Attendees’ 

Visual Presentation of Self and Experience 

on Instagram 

Kyser Lough, Texas at Austin 

53. Who Can Be Put at Risk by “Virtual Makeovers”?: 

Self-Photo Editing, Disordered Eating, and the Role 

of Mindset Among Adult Female Instagram Users 

Roselyn Lee-Won and Dingyu Hu, Ohio State; 

Yeon Kyoung Joo, Myongji University; 

and Sung Gwan Park, Seoul National University 

54. Feminine, Competent, Submissive: A Multimodal 

Analysis of Depictions of Women in U.S. Wartime 

Persuasive Messages 

Easton Wollney, Florida 

and Miglena Sternadori, Texas Tech 

Discussant 

Carolyn Yaschur, Augustana College 




Intersecting Literacies: News, Journalism, 

Civics, and Data 


Melanie Wilderman, Oklahoma 

“We Are a Neeeew Generation”: Early Adolescents’ 

Views on News and News Literacy* 

Sanne Tamboer, Radboud University 

In Their Own Words and Experiences: Journalistic Roles 

of High School Journalists** 

Marina Hendricks, South Dakota 

Sources of Student First Amendment Knowledge 

Amy Sindik, Central Michigan 

Journalism or Public Relations? Coverage of Sports 

Teams in High School Journalism Programs 

Kevin Hull, South Carolina 

and Bradley Wilson, Midwestern State 

Data Journalism Education in Canada: Scaffolding 

of Skills for the Future 

Jennifer Leask, British Columbia Institute 

of Technology 

Discussant 

Genelle Belmas, Kansas 

* Top Student Paper 

** Top Faculty Paper 




From the Newsroom to the Retirement Home: 

Preserving Women’s Voices in a Male-Dominated 

World 


Teri Finneman, Kansas 

Growing Old Gracefully? Gendered Depictions 

on Retirement Communities’ Websites* 

Anne Cooper Chen and Hong Ji, Ohio 

Hear Their Voices: A Qualitative Study of Women 

in Public Media** 

Laura Harbert, Ohio 

Women Newspaper Editors in Collegial Wilderness: 

But Digital Environment Turning This Around 

Catherine Strong, Massey University 

Needle, Not Sword: How Nackey Scripps Loeb 

Used Editorials to Build Audiences and Influence 

Conservative Presidential Politics 

Meg Heckman, Northeastern 

* Third-Place Faculty Paper 

** Third-Place Student Paper


119 






The Best of PCIG 


Aaron S. Veenstra, Southern Illinois Carbondale 

Uniting for a Collaborative Protest: How NFL In-house 

Media Covered Athlete Activism, a Case Study 

Michael Mirer, Fairmont State 

Discussant 

Danielle Coombs, Kent State 

* Second Place, Faculty Paper Competition 

** Second Place, Student Paper Competition 

Zero Day Twitter: How Russian Propaganda Infiltrated 

the U.S. Hybrid Media System* 

Josephine Lukito, Jiyoun Suk, Yini Zhang, 

Larisa Doroshenko, Min-Hsin Su, Sang Jung Kim, 

Yiping Xia, and Chris Wells, Wisconsin-Madison 

They’re Not “Just” Words: The Verbal Style of U.S. 

Presidential Debates** 

David Painter, Rollins College 

and Juliana Fernandes, Miami 

Contesting the “Bad Hombres” Narrative: How U.S. and 

Mexican Presidents Shape Migrants’ Media Image*** 

Vanessa Bravo, Elon and Maria De Moya, DePaul 

Where Independents Are Getting News? Beyond 

Partisan Media and Polarization**** 

Hyesun Choung, Ayellet Pelled, 

Yin Wu, Song Wang, 

and Josephine Lukito, Wisconsin-Madison 

Discussant 

Bryan McLaughlin, Texas Tech 

5 to 6:30 p.m. / T103 Renaissance Ballroom West A 

Richard T. Robertson School of Media and Culture 

at Virginia Commonwealth University; Philip Merrill 

College of Journalism at the University of Maryland 

and Manship School of Mass Communication at 

Louisiana State University 

Social 

Hosting 

Dean Jerry Ceppos, Louisiana State University 

Manship School of Mass Communication; 

Dean Lucy A. Dalglish, Philip Merrill College of 

Journalism at the University of Maryland 

and Hong Cheng, director, Richard T. Robertson 

School of Media and Culture 

at Virginia Commonwealth University 

Tuesday 



*** Third Place Faculty Paper 

**** First Place Student Paper 

5 to 6:30 p.m. / T102 Renaissance Ballroom West B 



Sports Media and Athlete Activism 


Jack Breslin, Iona 

Sports Media versus News Media: Perceptions of Media 

Bias in Coverage of the NFL National Anthem Protests 

in 2017* 

Ken Kim and Randall Patnode, Xavier 

Colin Kaepernick, Corporate Social Responsibility 

and Diversion in Sports Crisis** 

Virginia Harrison 

and Sara Erlichman, Pennsylvania State 

5:30 to 8:00 p.m. / T104 NPR Headquarters 


Off-site Award Ceremony 

Electronic News Division Bliss 

and Burkum Award Ceremony 



NPR Headquarters is located at 1111 North Capitol St. 

NE. The Bliss/Burkum Awards Reception will take place 

from 6 to 8 p.m. Pre-registraton is required. 

6:45 to 8:15 p.m. / T105 Mount Vernon B 





Jessica Smith, Abilene Christian

120 




6:45 to 8:15 p.m. / T106 Mount Vernon A 











Chad Painter, Dayton 






Mohammed Al-Azdee, Bridgport 












Sharon Bloyd-Peshkin, Columbia-Chicago 








Media Management, Economics and 

Entrepreneurship Division 




Geoffrey Graybeal, Georgia State 


















Amy Becker, Loyola-Maryland

122 









Molly Yanity, Quinnipiac 

6:45 to 8:15 p.m. / T117 Congressional Hall B 

University of Texas at Austin Moody College of 

Communication, School of Journalism & Knight Center 

for Journalism in the Americas 

Social 

Hosting 

Jay Bernhardt, Dean, Moody College of 

Communication; 

Kathleen McElroy, Director, School of Journalism; 

and Rosental Alves, Director, Knight Center for 

Journalism in the Americas 

University of Texas at Austin School of Journalism 

Reception. Featuring light hors d’oeuvres and a bar, the 

reception is a perfect place to meet Longhorns. Tickets 

are not required, but please wear your name badge. 

6:45 to 8:15 p.m. / T118 Renaissance Ballroom East 

University of Tennessee and Michigan State University 

Social 

Hosting 

Mike Wirth, Tennessee 

and Lucinda Davenport, Michigan State 

7 to 9 p.m. / T119 National Union Building 


Off-site Divisional Social 

8:30 to 10 p.m. / T120 Capitol City Brewing Company 

History Division and Graduate Student Interest Group 

Off-site Social 

Hosting 


and George Pearson, Ohio State 

The History Division and Graduate Student Interest 

Group social will be held at the Capitol City Brewing 

Company, 100 New York Avenue, NW, immediately 

following the groups’ members’ meeting. It is about 2-3 

blocks from the hotel (about a 5- to 8-minute walk from 

the conference hotel). Buffet style food with meat and 

vegetarian options. Alcohol not included. 

8:30 to 10 p.m. / T121 TBA 



Hosting 

Mohammed Al-Azdee, Bridgport 

The International Communication Division off-site social 

will begin immediately following the Division business 

meeting. Drink tickets will be handed out during the 

Member’s Meeting! 

8:30 to 10 p.m. / T122 The Loft at The Hamilton 



Hosting 


Social to be held at The Loft at The Hamilton, 600 

14th Street NW, Washington DC 20005, 202-787-1000. 

From the Renaissance, walk 3 blocks south on 9th Street, 

then west to 14th Street (1/2 mile total). 

Hosting 

Holly Overton, South Carolina 

and Brooke Fowler, Maryland 

Social to be held at the National Union Building. Preregistration 

is required.


123 



8:30 to 10 p.m. / T123 Irish Channel Restaurant & Pub 



Hosting 


8:30 to 10 p.m. / T124 Matchbox 

8:30 to 10 p.m. / T128 Congressional Hall A 


Social Mixer 

Hosting 


Light refreshments and a cash bar will be available. Preregistration 

is required. 



Hosting 

Chad Painter, Dayton 

Social to be held at Matchbox. 

8:30 to 10 p.m. / T125 Renaissance Ballroom West B 

8:30 to 10 p.m. / T129 Mount Vernon A 

Commission on the Status of Minorities 





Tuesday 



Social 

Hosting 


and Sabine Baumann, Jade 






Nancy L. Green, Southern Newspaper Publishers 

Association 






Mark Poepsel, Southern Illinois-Edwardsville 












Toni Albertson, Mt. San Antonio College

124 




8:30 to 10 p.m. / T132 Renaissance Ballroom West A 

Marquette University, Ohio State University, University 

of Iowa, University of Minnesota and University of 

Wisconsin 

Social 

Hosting 

Ana C. Garner, Marquette; 

Michael Slater, Ohio State; David Ryfe, Iowa; 

Elisia Cohen, Minnesota 

and Hemant Shah, Wisconsin-Madison 

Be Informed. Stay Informed. 

Communication Booknotes Quarterly (CBQ) Journal 

highlights the latest publications in almost 20 specialized 

areas within journalism and mass communication. 

If you have published a book, or are interested in 

reviewing a book, I want to hear from you. 

Contact me for more details at mcarstarphen@ou.edu 

and put “CBQ Booknotes” in the subject line. 

For information about CBQ subscriptions, contact Jill O’Hara at 

Jillian.Ohara@taylorandfrancis.com. 

ABOUT CBQ 

Communication Booknotes Quarterly (CBQ) is an annotated review service for 

recent books, reports, documents, and electronic publications on all aspects of 

mediated communication designed for an audience of scholars and librarians 

in the United States and around the world. Subject areas of interest include, 

but are not limited to: advertising, public relations, strategic communications, 

journalism, telecommunications, global media, media theories, media economics, 

media regulation and policy, media ethics, risk communication, ethnicity 

and media, media communication history, critical/cultural studies of media, 

popular culture, social media, books and publishing, media and society, visual 

communication, gender and representation, and media management. 

CBQ enjoys the talents of an active editorial board, as well as of many topical and 

international experts who share the quarterly production of hundreds of descriptive, 

analytical and some peer-reviewed contributions. The journal’s contributors will 

cover English-language, and foreign-language publications translated into English, 

from the United States and other global publishers from countries around the world. 

Meta G. Carstarphen, Ph.D., APR 

Professor & Gaylord Family Professor 

Gaylord College of Journalism & 

Mass Communication 

University of Oklahoma 

CBQ Booknotes Editor-in-Chief 

@CBQ_Journal

NOVOTNY LAWRENCE 

LAURA WITZLING 

THE GREENLEE SCHOOL 

WELCOMES NEW FACULTY 

ANDY KING, Ph.D. 


Public Relations: Strategic Health Communications 

ANDY KING 

PLEASE JOIN US 

Meet the faculty 

at our social, 

along with Texas Tech 

and West Virginia, 

from 7-8:30 p.m. on 

Wednesday, Aug. 8, 

in Renaissance 

NOVOTNY LAWRENCE, Ph.D. 


Journalism: Race, Media and Popular Culture 

LAURA WITZLING, Ph.D. 


Public Relations: Environmental Communications 

TM 

Ballroom West A. 

@GreenleeSchool @ISU_GSJC

The College of Media & Communication at Texas Tech University is forging a 

unique partnership with the School of Nursing at the Texas Tech University 

Health Sciences Center to train the pre-nursing students of today to reach new 

levels of communication excellence and continuity of care tomorrow, from the 

clinic to the OR and from the office to the hospital. 

“The demands of nursing school can minimize the time spent on communication techniques, 

which can ultimately cause disastrous outcomes in health care,” according to Assistant Professor 

and Traditional BSN Program Director of Curriculum/Faculty in the School of Nursing, Amanda 

Veesart. 

The collaboration was first conceived by Dean of Nursing Michael Evans and College of Media & 

Communication Dean, David D. Perlmutter, who met to discuss ways to improve communication 

among health professionals and with the public. 

Dean Evans explained, “The [main] benefit is that the course impresses upon the pre-nursing 

students how vitally important and fundamental effective communication is to nursing and to 

health care.” 

“The nursing communication class is just one of the partnerships that we have already 

established or plan to establish in the near future and with other units at Texas Tech and in 

the health science system,” commented Dean Perlmutter. “We want to be seen as a world-class 

example of how a communication college can be in partnership with all sorts of units in health 

and STEM disciplines to advance science and the public good.” 

CoMC Dean Perlmutter (center top) with 

School of Nursing Dean Michael Evans 

(center bottom), Dr. Amanda Veesart (left) 

and Dr. Jenna Shimkowski (right). 

Dr. Jenna Shimkowski and Dean Perlmutter with 

the first Communication in Nursing class.

Students 

(from left) 

Jessy 

Forelli, 

Mo Irish 

and Zeina 

Cabrera- 

Peterson 

take a 

break 

from their 

reporting 

to watch 

the Aug. 

21 solar 

eclipse 

near the 

Arizona- 

Mexico 

border 

fence in 

Nogales. 

Photo by 

Celeste González 

de Bustamante 

University of Arizona Journalism 

Expanding students’ horizons in global and science reporting 

CONGRATS 

Carol Schwalbe 

named director, the 

second woman to 

lead the school since 

its inception in 1951. 

Schwalbe 

Dr. Jeannine Relly 

selected as a fellow 

in the AEJMC Institute 

for Diverse Leadership 

in Journalism and 

Communication, 

2018-19. 

Relly 

Dr. Celeste de González de Bustamante 

teaches a class at U.S.-Mexico border. 

GLOBAL 

JOURNALISM 

Student Sophie Daws peers into the 

Biosphere 2 ocean on a class trip. 

SCIENCE 

JOURNALISM 

Dr. Linda Lumsden 

promoted to tenured 

full professor with the 

School of Journalism. 

Dr. David Cuillier 

to release in 2019 

second edition of 

“The Art of Access: 

Strategies for Acquiring 

Public Records.” 

Lumsden 

Cuillier 

• Home of Center for Border 

& Global Journalism. 

• Dual master’s with Latin 

American, Middle Eastern and 

North African Studies. 

• Reporting, photo projects 

in Mexico, Costa Rica, Italy. 

• Courses in science and 

environmental journalism 

include visits to Biosphere 2. 

• Students produce science 

magazine and multimedia 

projects, and partner with 

the local PBS TV station. 

Director Carol Schwalbe 

520-621-7556 

journal@email.arizona.edu 

www.journalism.arizona.edu

Educator Toolkit 

Download free resources for your classroom 

plankcenter.ua.edu 

INTERVIEWS WITH INDUSTRY LEADERS 

More than 30 hours of interviews with PR leaders and legends 

WEBINARS 

More than 15 webinars on-demand including the most popular — Getting a Job in PR 

PLATFORM MAGAZINE 

An opportunity to advance writing skills — AP Style quizzes & contribute articles/blogs 

RESEARCH 

More than 35 studies exploring leadership, mentorship and diversity & inclusion in PR 

LESSONS FROM LEADERS 

Personal messages of counsel from legends in the field for generations of PR pros 

MENTORSHIP GUIDE 

A living series of tips on how to get the most out of a mentorship relationship 

FOR LEADERSHIP IN PUBLIC RELATIONS 

Shaping the future of public relations through leadership & mentorship 

@PlankCenterPR


in Journalism 


Congratulates 

The 2018 AEJMC 

Equity & Diversity Award 

recipient 

TEMPLE UNIVERSITY 

klein.temple.edu

AEJMC & ASJMC 

Announce the 

2018-19 IDL Class 

Margaretha Geertsema-Sligh 

Professor Director, 

Eugene S. Pulliam 

School of Journalism, 

Butler University 

Herman Howard 

Professor Department Chair, 

Department of Communication 

and Mass Media, 

Angelo State University 

Mia Moody-Ramirez 

Associate Professor, Graduate Program Director, 

Department of Journalism, 

Public Relations New Media, 

Baylor University 

Uche Onyebadi 

Associate Professor Chair, 

Bob Schieffer College 

of Communication, 

Texas Christian University 

Jeannine Relly 

Associate Professor, 

School of Journalism, 

University of Arizona 

Jennifer Vardeman 


Jack J. Valenti School 

of Communication, 

University of Houston 

Yong Volz 


Missouri School of Journalism, 

University of Missouri 

Vera Walker Hawkins 

Associate Professor of Journalism, 

School of Communication, 

Texas Southern University 

Weiwu Zhang 

Associate Professor Chairperson, 

College of Media and Communication, 

Texas Tech University

We’re Growing 

We’re Hiring 

Public 

Relations 

Broadcast 

Journalism 

Mass 


Jungmi Jun 

Kirstin Pellizzaro 

Mary Anne Fitzpatrick 

Business 

Media 

Visual 

Journalism 

Writing 


Michelle LaRoche 

Nina Brook 

Sabrina Habib 

The UofSC School of Journalism and 

Mass Communications welcomes six 

new faculty into our Gamecock family. 

And we’re looking for one more: 

Assistant Prof. in Public Relations 

www.sc.edu/cic

Wednesday Sessions 

135 

135 



7 to 8 a.m. / W001 Meeting Rooms 10-11 





Kelty Logan, Colorado 

7 to 8 a.m. / W002 Meeting Rooms 12-13 

This meeting is for incoming and outgoing Public Relations 

Division committee members. Members interested 

in serving in the Division are invited to attend. 

7 to 8 a.m. / W006 Meeting Room 15 




Divisional Journal Editors’ Meeting 





Suman Mishra, Southern Illinois-Edwardsville 








7 to 9:45 a.m. / W007 Penn Quarter 



Publications 


Publications Committee Meeting 


Patricia Moy, Washington 

Wednesday 












Outgoing and Incoming Executive 

Committee Meeting 


Giselle A. Auger, Rhode Island 

8:15 to 9:45 a.m. / W008 Meeting Room 16 

Communication Technology and Communication 

Theory and Methodology Divisions 


Best Polling Practices: Contemporary Polling 

and Reporting Methods Among Industry Leaders 


Matthew Barnidge, Alabama 

and Soo Young Bae, Massachusetts, Amherst 

Panelists: 

Emily Guskin, The Washington Post 

Ruth Igielnik, Pew Research Center 

Kyley McGeeney, PSB 

Jennifer Agiesta, CNN 

Stephanie Marken, Gallup

136 




8:15 to 9:45 a.m. / W009 Grand Ballroom South 


and Entertainment Studies Interest Group 



Group I — Bringing the Lessons of History to the 

Present: Otherness, Colonialism and Conflict 

1. Teenagers, Terrorism, and Technopanic: 

How British Newspapers Framed Female ISIS 

Recruits as Victims of Social Media 

Sara Shaban, Missouri 

2. Anti-Establishment Voices: Tensions of Fascism 

and Postmodernity in Balkan Rock Music* 

Christian Vukasovich, Oregon Institute 

of Technology 

3. Objectified Yoga: Commodity, Identity, 

and Embodiment in US Women’s Magazines 

Nandini Bhalla 

and David Moscowitz, South Carolina 

4. “For India is to be Redeemed!”: Reflections 

of an American Missionary in British India 

Khadija Ejaz, South Carolina 

5. Othering by Historicizing: The Journalistic 

Technique of Locating Foreign Societies in the Past 

Miki Tanikawa, Akita International University 

Discussant 

Karen Kline, Lock Haven 

Group II — Television, Celebrity and Media Culture 

6. A Theoretical Model on How the Media Play 

a Role in Celebrification Analyses: Based 

on Bourdieu (1986) and Driessens (2013) 

Li Chen, Syracuse 

7. Numinous Fortune and Holy Money: 

Dave Ramsey’s Cruel Optimism 

John Sewell, West Georgia 

8. Examining Affordances of African Agency 

through Cultural Brokerage in Anthony Bourdain’s 

Parts Unknown 

Tewodros Workneh, Kent State 

9. Trash and Treasure TV 

Sean Leavey, Rutgers 

10. Making Sense of Tastemaking: How Music 

Journalists Interpret Culture — and Their Place in It 

Kelsey Whipple, Texas at Austin 

Discussant 

Jeanne Criswell, Indianapolis 

* Top Faculty Paper, Second Place, Cultural and Critical 

Studies Division 


11. Examining a Prototype versus Exemplar Approach 

to Understanding Viewer Categorizations 

of Morally Ambiguous Characters 

Serena Daalmans, Radbound University; 

Benjamin Johnson, Vrije Universiteit Amsterdam; 

and Allison Eden, Michigan State 

12. Binge-watching: Social and Psychological Factors 

Behind Audience’s Binging Behavior 

Chun Shao and Paisley M. Benaza, Arizona State 

13. Videos Games as Mindfulness Training Partners 

Travis Loof, South Dakota 

14. The “Ellen” Agenda: How One Entertainer’s Twitter 

Account Provides Content and Sources for 

Mainstream News 

Jane O’Boyle and Alex Luchsinger, Elon 

15. Textual and Contextual Analysis of Moana 

Nafida Banu and Jocelyn Pedersen, Oklahoma 

16. Chinese Films Abroad: Balancing Soft Power 

and Orientalist Stereotypes in the “Big Three” 

Film Festivals 

Bruno Lovric, City University of Hong Kong 

17. In the Dark but Not Alone: The Fear of Missing Out, 

Social Capital, and Social Gratifications 

of Moviegoing 

Alec Tefertiller, Kansas State; 

Lindsey Maxwell, Southern Mississippi 

and David Morris II, Oregon 

18. Who Loves the Biblical Epic? A Mixed-Method 

Analysis of Online Community Perception 

of Epic Biblical Movies 

Gregory Perreault 

and Thomas Mueller, Appalachian State 

19. Measuring Virtual Reality Engagement: Survey 

and Electroencephalography (EEG) 

Gi Woong Yun, Nevada, Reno 

Claire Youngnyo Joa, Louisiana State-Shreveport; 

Daiwon Hyun, Sooyoung Lee 

Sooyoung Lee, Hongsuk Kim 

Sanghee Park, Sogang University 

and Sasha Allgayer, Bowling Green State 

20. College Women’s Alcohol Refusal Beliefs and 

Perceptions of Refusal Scripts in Popular Television 

Nicole O’Donnell, Virginia Commonwealth; 

Stacey Hust, Stephanie Gibbons 

and Soojung Kang, Washington State 

21. Playing Doctor on TV: Physician Portrayals 

and Interactions on Medical Drama, Comedy, 

and Reality Shows 

David Painter, Alison Kubala 

and Sarah Parsloe; Rollins College 

22. Gossip at One’s Fingertips: Influential Factors 

of Celebrity News on Twitter 

Yan Yan 

and Wanjiang Zhang, Wuhan University


137 



23. Teens’ Interpretation of the Controversial Show 

“13 Reasons Why” 

Colleen Kappeler, Carthage College 

24. Down With the Clown: Taste, Class and Protest 

in American Journalistic Coverage of Juggalos 


25. Recreational Video Games as a Value-supporting 

Activity for Cancer Survivors 

Maria Leonora Comello, North Carolina at 

Chapel Hill; 

Diane Francis, Louisiana State; 

Laurie Hursting, Elizabeth Breaux 

and Laura Marshall, North Carolina, Chapel Hill 

26. The Role of Narratives on the Enjoyment 

and Appreciation of Popular Music 

Nikki McClaran 

and Joseph Steinhardt, Michigan State 

27. “But, He’s So Serious”: Framing of Masculinity 

Among Western Hemisphere Indigenous Disney 

Animated Characters 

Tim Luisi, Missouri 

Discussant 

Monique L. R. Luisi, Missouri 

8:15 to 9:45 a.m. / W010 Congressional Hall B 

International Communication and Law and Policy 

Divisions 

8:15 to 9:45 a.m. / W011 Renaissance BR West B 



MCSD Journal Editorial Meeting 


Fuyuan Shen, editor, MCSD; Pennsylvania State 

8:15 to 9:45 a.m. / W012 Renaissance BR West A 


and Small Programs Interest Group 


Diversity Outcomes Beyond the Numbers- 

Expanding the Landscape 



Panelists 

Peter Bhatia, editor, The Detroit Free Press, 

President, ACEJMC 

Michael Andrews, Stillman 


Phil Wagner, South Florida-Sarasota-Manatee 

Doug Mendehall, Abilene Christian 

Wednesday 


State-Sponsored Messaging and Freedom of Speech 


Emily Metzgar, Indiana 

Panelists 

Propaganda via Public Service Broadcasting: C 

ases from South-Eastern Europe 


If You Can’t Censor Them, Distract Them: 

How Nation-States Use Bots & Sock Puppets 

to Steer and Neutralize Online Political Discussions 

Aaron Delwiche, Trinity 

Public Diplomacy & Freedom of Expression: 

Tensions & Synergies 

Shawn Powers, U.S. Advisory Commission on 

Public Diplomacy 

Media, Propaganda & Terrorism 

Jeannine Relly, Arizona 

Effects of Foreign State-sponsored Messaging 

on Iraqi Media During Elections 

Mohammed Al-Azdee, University of Bridgeport 

Mass Mobilization & Social Media in India 

Jatin Srivastava, Ohio 










Where Are All the Women?: Missing in Action 


Donnalyn Pompper, Oregon

138 




Kopenhaver Center Report: Women in Communications 

Industries Leave Earlier, Hold Lower Positions, Earn Less, 

and Have Their Careers Interrupted More Than Men 

Tracy Everbach, North Texas 

“WMC Report — Divided 2018: The Media Gender 

Gap:” A Women’s Media Center Investigation 

of Who Provides Coverage for Top News Outlets 

Kate McCarthy, Director of Women’s Media 

Center Programs 

“WMC Report — The Status of Women of Color in U.S. 

News Media:” A Women’s Media Center Investigation 

of the Status of Women of Color in Legacy Print, Radio, 

TV, and Digital News 

Cristal Williams Chancellor, Director of Women’s 

Media Center Communications 

8:15 to 9:45 a.m. / W015 Meeting Rooms 10-11 


and Scholastic Journalism Division 


Teaching Digital Media in Low Income Communities 



Panelists 

Sally Renaud, Illinois 

Crystal McMorris, Delta 


Tom Moore, CUNY 



and Media Ethics Division 


On the “Other Side:” How to be a Good 

Advisor to Your (International) Graduate 

Students from an Ethical, Feminist Perspective 


Stine Eckert, Wayne State 

Panelists 


Bonnie Brennen, Marquette 



Federico Subervi, University of Leeds 

Sahar Khamis, Maryland 

8:15 to 9:45 a.m. / W017 Mount Vernon A 




Innovating Ideas that Foster a Community 

and Its History 


Christina Smith, Georgia College 

and Kristin Gustafson, Washington Bothell 

Panelists 

Kevin Naff, editor, Washington Blade 

Eric Falquero, editor-in-chief, Street Sense Media 

Andrew Lightman, managing editor, East of the River 

Miguel Guilarte, sports editor, El Tiempo Latino 

Rafael Roncal, editor, El Pregonero 

8:15 to 9:45 a.m. / W018 Congressional Hall C 



Campaign 2016 Revisited/Media Use and Effects 


Thomas J. Johnson, Texas at Austin 

News and Entertainment Preferences, Political 

Knowledge and Attentiveness in Campaign 2016 

Matthew Thornton, Drake 

Social Media for Political Campaigns: An Examination 

of Donald Trump’s Frame Building and its Effect on 

Audience Engagement 

Abdulsamad Sahly, K. Hazel Kwon, 

and Chun Shao, Arizona State 

“Nothing That I Did Was Wrong:” Image Repair and the 

Hillary Clinton Email Controversy* 

Miles Sari, Washington State 

Sisters Are Doin’ It For Themselves: Hillary Clinton’s 

2016 Hybrid Media Campaign 

Katherine Haenschen, Virginia Tech 

Gender, Nonverbal Communication, and Televised 

Debates: Examining Clinton and Trump’s Nonverbal 

Language During the 2016 Town Hall Debate 

Ben Wasike, Texas Rio Grande Valley 

Discussant 

Juliana Fernandes, Miami 

* Third Place Student Paper


139 



Media Quality and Democracy: Claims and Reality 

—A Cross-Media Study 

Maren Beaufort 

and Josef Seethaler, Austrian Academy of Sciences 

Peers versus Pros: Confirmation Bias in Selective Exposure 

to User-Generated versus Mass Media Messages 

Axel Westerwick and Daniel Sude, Ohio State; 

Melissa Robinson, Slippery Rock 

and Silvia Knobloch-Westerwick, Ohio State 

Partisan Media, News Events, and Asymmetric Political 

Evaluations in the 2016 Election 

Jiyoun Suk and Dhavan Shah, Wisconsin-Madison; 

Leticia Bode, Georgetown; 

Stephanie Edgerly, Northwestern; 

Kjerstin Thorson, Michigan State; 

Emily Vraga, George Mason; 

Chris Wells and Jon Pevehouse, Wisconsin-Madison 

From Information Reception to Political Learning on 

Social Media: Advancing the Interaction Mediation Model 

Dam Hee Kim, Brian Weeks, Daniel Lane, 

Lauren B Potts, and Nojin Kwak, Michigan 

Young Adults, Passive and Active Forms of News Use 

on Social Media, and Political Engagement 

Chang Sup Park 

and Masahiro Yamamoto, University at Albany 

Discussant 

Rosie Jahng, Wayne State 

8:15 to 9:45 a.m. / W019 Mount Vernon B 



Digital and Social Media in Sports 


Karen Markin, Rhode Island 

Examining Public Perceptions of CSR in Sport: The Role 

of Attributions, Fit, and Information Source 

Joon Kyoung Kim, Holly Overton, 

Kevin Hull and Minhee Choi, South Carolina 

Identification and Crisis: An Exploration into the 

Influence of Sports Identification on Perceptions of 

Sports Crises* 

Jennifer Harker, North Carolina at Chapel Hill 

Social Media for the Win: How Brands Integrated Social 

into their Advertising Strategy During Super Bowl LI 

Clay Craig, Texas State; 

Shannon Bichard, Texas Tech 

and Mary Liz Brooks, West Texas A&M 

Why Do You Follow? A Closer Look at Sport Fan 

Engagement with Athletes on Twitter 

David Cassilo 

and Zachary Humphries, Kent State 

Discussant 

Michael Bruce, Alabama 

* First Place, Student Paper Competition 




Research Roundtable Session 

AEJMC 2018 Senior and Emerging Scholars: 

Creating a Winning Research Grant Application 


Kimberly Bissell, Alabama 

2018 Senior Scholar Projects: 

When Polls Go Bad: The Wary Interplay of Journalism 

and Survey Research 


The American Narrative: U.S. Information Diplomacy 

Since World War II 

Emily T. Metzgar, Indiana 

Developing Criteria for Assessing the Quality of News 

Coverage of Health Policy: Toward Improving Coverage 

to Better Inform Citizens and Policy-makers 

Kim Walsh-Childers, Florida 

2018 Emerging Scholar Projects: 

Responsibility, Vulnerability, and Climate Change: 

Toward a Model of Influences on Climate Journalism 

in Developing Countries 

Suzannah Evans Comfort, Indiana 

Care in Action: Disaster Communication Ethics 

and Preparedness in Vulnerable Communities 

Julia Daisy Fraustino, West Virginia, 

and Amanda K. Kennedy, St. Mary’s 

Disrupting the Protest Paradigm: Toward a Model 

of the Sociological Effects, Routines and Norms 

Influencing Journalistic Coverage of U.S. Protests 

Summer Harlow, Houston, 

and Danielle Kilgo, Indiana 

Act Like a Lady: Women’s Press Clubs and the Rise 

of the Twentieth Century Newswoman 

Candi S. Carter Olson, Utah State 

Wednesday

MEDILL IS COAST-TO-COAST 

AT THE INTERSECTION 

OF MEDIA AND 

TECHNOLOGY 

Medill’s San Francisco programs put our 

journalism and integrated marketing 

communications students in heart of the 

thriving tech and media culture. This winter 

we welcomed Lawrence Patrick as director 

of Medill programs in San Francisco. 

LAWRENCE 

PATRICK 

medill.northwestern.edu/our-locations 

Evanston / Chicago / Washington, D.C. / San Francisco / Doha, Qatar

JOIE 

CHEN 

IN THE HEART 

OF THE 

NATION’S 

CAPITAL 

Our 52-year history in Washington, D.C. 

provides our undergraduate and graduate 

journalism students with a chance to cover 

the nation’s capital. This spring we welcomed 

Joie Chen (BSJ82, MSJ83) as director of 

Medill programs in Washington, D.C.

THANK YOU 

BRADLEY J. HAMM 

FOR YOUR SERVICE 

AS DEAN OF MEDILL 

Under Dean Hamm’s leadership from 2012 to 2018, Medill created a year-round program in San 

Francisco to be a leader in the field in innovation and technology; opened a new site in Chicago 

for graduate students; surpassed the school’s $60 million fundraising goal more than two years 

ahead of schedule in the University’s We Will campaign and hired more than a dozen top faculty 

and directors. 

Hamm also led Medill as the school increased scholarships and financial aid by 50 percent; 

created new domestic and global study programs that grew by more than 300 students per 

year; funded significant reporting projects throughout the country and internationally; 

greatly increased alumni events and outreach; expanded the work of the Spiegel Research 

Center, Medill’s first research center; and launched signature specializations in the journalism 

graduate program. 

In addition, Hamm has raised financial aid to create a “need-blind” model at Medill so every 

student, regardless of family income, can take advantage of internships, the Washington, D.C. 

and San Francisco sites, professional conferences and the new domestic and global programs. 

We welcome Professor Charles Whitaker as interim dean. A global search will be conducted in 

fall 2018. 

medill.northwestern.edu

MEDILL LEADS 

NORTHWESTERN’S 

LOCAL NEWS 

INITIATIVE 

Pairing Medill’s expertise in journalism and integrated 

marketing communications, Northwestern University and 

Medill have launched an innovative, two-year research 

and development project aimed at providing greater 

understanding of how digital audiences engage with local 

news and finding new approaches to bolster local news 

business models. Three local news organizations—the 

Chicago Tribune, San Francisco Chronicle and The 

Indianapolis Star—will join us as “Learning Labs” for 

the Local News Initiative. 

Learn more: medill.school/local-news-initiative

144 





James W. Foley Legacy Foundation 

Session 

Breakfast Session 


Amy Coyne, Foley Foundation 

Pre-registration is required. Contact Amy Coyne at amy. 

coyne@jamesfoleyfoundation.org for additional information. 

9:30 to 10 a.m. / W022 Grand Ballroom North 




Join colleagues for networking and light refreshments. 

9:45 a.m. to 12:15 p.m. / W023 Library of Congress 


Off-site Tour 

Library of Congress Tour 



Pre-register for tour through the Mass Communication 

and Society Division. 

9:45 a.m. to 12:15 p.m. / W024 WAMU Public Radio 


Division and Participatory Journalism Interest Group 

Off-site Tour 

Audience Engagement Tour at WAMU Public Radio 

Members must purchase their own Metro pass for the trip. 

10 a.m. to 11 a.m. / W025 Renaissance Ballroom East 




AEJMC General Session 


Jennifer D. Greer, Alabama, 

AEJMC President 2017-18 

AEJMC Awards 

Hillier Krieghbaum Under-40 Award 

Recipient: Shirley S. Ho, Nanyang Technological 


Recipient: Donald Wright, Boston 

AEJMC-Knudson Latin America Prize 

Recipient: Liberation Technology in El 

Salvador: Re-Appropriating Social Media 

Among Alternative Media Projects 

authored by Summer Harlow, Florida State 

Research Committee Awards 

Paul J. Deutschmann Award for Excellence 

in JMC Research 

Recipient: S. Shyam Sundar, Pennsylvania State 

Nafziger-White-Salwen Dissertation Award 

Recipient: Brooks Fuller, Louisiana State 

Other Awards 

Lionel C. Barrow, Jr. Award for Distinguished 

Achievement in Diversity Research and Education 

Recipient: Mia Moody-Ramirez, Baylor 

2018 News Audience Research Paper Award Winner 

AEJMC Professional Relevance Research Awards 

2018 Gene Burd Urban Journalism Award 

Recipient: Brian Lehrer, “Brian Talks 

New York”, WNYC 

Installation of 2018-19 AEJMC President 



Magda Konieczna, Temple 

and Amber Hinsley, St. Louis 

The tour group will meet in the hotel lobby and depart 

promptly at 9:45 a.m., walking a few blocks to the Metro 

Red Line station at Gallery Place-Chinatown to take the 

train to WAMU, located near the Van Ness-UDC stop.


145 



11:15 a.m. to Noon / W026 Renaissance Ballroom East 



Roundtable Session 

Career Advancement: Engaging with Leaders 










AEJMC President 2018-19 

and Jennifer D. Greer, Alabama, 

AEJMC President, 2017-18 

Table I: 

Getting Tenure 

Noon to 2 p.m. / W028 


Off-site Luncheon 

Adams/Edelman Luncheon 

Clyde’s 

Table II: 

Table III: 

Table IV: 

Developing a Research Agenda 

Considering Leadership 

How to Stand-Out in a Job Search 


Dustin Supa, Boston 

Clyde’s (707 7th St., NW). Pre-registration is required. 

Table V: 

Table VI: 

Table VII: 

Table VIII: 

Table IX: 

Enhancing my Teaching 

Getting Published in JMC Quarterly 

Bringing Equity & Diversity into Your 

Program 

Moving Up to Full 

Connect with the Industry 

This session will feature 20-minute discussions on topics 

related to your career. Each attendee will be able to select 

two topics during this 45-minute session. Pick from nine 

topics. Each topic will feature a session leader that will 

be introduced at the beginning of the roundtable session. 

11 a.m. to Noon / W027 Grand Ballroom North 




Spotlight — “Fast-Tracking Changes to Your 

Curriculum” 


Tom Reichert and Andrea Tanner, South Carolina 

12:15 to 1:30 p.m. / W029 Grand Ballroom South 



Scholar-to-Scholar Refereed Paper Research Poster 

Session 


Risk Division 

1. Does Truvada “Prevent” HIV? Examining How 

News Can Alter FDA-Regulated Messages 

Ryan Wallace, Texas at Austin 

2. From Sensation to Stigma: Changing Standards 

for Suicide Coverage in Journalism Textbooks, 

1894-2016 


3. Revisiting the Effects of Threat Appraisal 

and Self-efficacy on Protection Motivation 

from a Terror Management Theory Perspective 

Jiyoung Lee, Syracuse 

and Yungwook Kim, Ewha Womans University 

4. Tweeting in the Midst of Disaster: A Comparative 

Case Study of Journalists’ Practices Following 

Four Crises 

Amber Hinsley, Saint Louis 

and Hyunmin Lee, Drexel 

5. “You Can’t Drink Oil”: How the Water is Life 

Movement Employed Risk Communication 

Techniques to Garner Popular Support 

for Their Cause 

Sarah Smith-Frigerio, Missouri 

Wednesday

146 




6. Newspapers as Quasi-Stationery in Nineteenth 

Century America: The Economic Role of the 

Letter-Sheet Price-Currents 

Bradford Scharlott, retired, 

and Matthew Baker, Westminster College, UT 

7. Mortimer Thomson’s Witches: Undercover 

Reporting on the Fortune-Telling Trade 

Samantha Peko, Ohio 

Discussant 

John Ferré, Louisville 

8. Voices on Woman’s Suffrage: Lingering Structures 

of Feeling in 1917 U.S. Letters to the Editor 

Lori Amber Roessner, Tennessee 

9. Southern Education Report: An Examination 

of a Magazine’s Contribution to Education News 

in the Civil Rights Era 

Melony Shemberger, Murray State 

10. Race and Rhetorical Choices: Newspaper Coverage 

of Detroit’s Twelfth Street Riot 

Brandon Storlie, Wisconsin-Madison 

Discussant 

Jon Bekken, Albright College 


11. A Woman at 300: Gendering News Coverage 

in a Historic Mayoral Election 

Shearon Roberts, Xavier 

and Sheryl Kennedy Haydel, Dillard 

12. Women Public Relations History Forgot 

to Discover: Community Building 

on and after the Oregon Trail 

Donnalyn Pompper 

and Tugce Ertem Eray, Oregon 

13. Reaching a Balance Between Crimes of Passion 

& Femicides: Influences on the Construction 

of News in Mexican Journalists 

Miriam Hernandez, City University 

of Hong Kong 

14. Women Journalists Face Danger and Death While 

Doing their Jobs 

Carolyn Byerly and Jasmin Goodman, Howard 

Discussants 

Paromita Pain, Nevada at Reno, 

and Mimi Perreault, Appalachian State 


Theme — Social Media and Politics 

15. Social Capital, Civic Engagement and Identity: 

Exploring a Model for Political Talk on Facebook 

Toby Hopp, Patrick Ferrucci, 

and Chris Vargo, Colorado-Boulder 

16. Speaking in a Woman’s Name: Gender Difference 

of Political Expressive Participation on Twitter 

Lingshu Hu and Mike Kearney, Missouri 

17. Campaign Strategies on Twitter in 2016 U.S. 

Presidential Election: Real-time Event, Negativity, 

and Online Engagement 

Daud Isa, Georgia; Qin Li, Meredith Wang 

and Porismita Borah, Washington State 

and Itai Himelboim, Georgia 

18. Identifying the Motivations of Political Donors 

Using Social Media Data 

Ross Dahlke, Wisconsin-Madison 

19. How Informed Are Messaging App Users About 

Politics? A Linkage of Messaging App Use 

and Political Knowledge and Participation 

Masahiro Yamamoto 

and Matthew Kushin, Shepherd University 

and Dalisay Francis, University of Guam 

Discussant 



20. An Analysis of the Rise and Fall of “The Boy Who 

Came Back from Heaven” 

Jim Y. Trammell, High Point 

21. Effective Intercultural Workgroup Communication 

Theory: The Impact on Church Dynamics 

Stephen Kabah, Regent 

21. Terrorism News Coverage and Attitude Towards 

Islam: Does Following Terrorism News Cultivate 

Opinions about Muslims 

V. Michelle Michael, Ohio 

23. A Longitudinal Analysis of the Linguistic Tone 

of American Churches Online 

Doug Mendenhall 

and Lani Ford, Abilene Christian 

24. “In the World, Not of It: Exploring Evangelical 

Christian Women’s Negotiation of Meaning Within 

a Shared Community 

Jennifer Huemmer, Ithaca 


25. Interplay of Second Screening for Sports, Attachment 

to School, and Smartphone Use in Campus Life 

Bumsoo Kim, Alabama 

26. The Evolution of eSports in the Eyes of Mainstream 

Media and Public Relations, 2000-2017 

Jue Hou and Xiaoxu Yang, Alabama 

Discussant 

Patrick Ferrucci, Colorado 

27. Pardon My Critique: Using Comedy to Critique — 

and Reinforce — Masculine Norms in Sports 

Colin Storm, Washington State


147 



28. Examining the Growth of Sport Communication 

Programs in Higher Education through a Survey 

of Program Coordinators 

Minhee Choi and Kevin Hull, South Carolina; 

and Ted Kian, Oklahoma State 

29. Compliments vs. Criticisms: What Network 

Television Announcers Say About Major League 

Baseball Players During Nationally Televised Games 

James Rada, Ithaca 

and K. Tim Wulfemeyer, San Diego State 

Discussant 

Bill Cassidy, Northern Illinois 

12:15 to 1:30 p.m. / W030 Mount Vernon B 



Your Attention Please! Attracting 

Today’s Audience 


Caryl Cooper, Alabama 

The Impact of Erotic Appeal and Message Relevance on 

Selective Attention to Print Advertisements 

Zijian Gong, Steven Holiday 

and Glenn Cummins, Texas Tech 

The Role of Media Context and General Advertising 

Attitudes on Ad Avoidance 

Esther Thorson and Samuel M. Tham, Michigan State; 

and Margaret Duffy, Missouri 

The Positive and Negative Effects of Intrusive In-App 

Advertising 

Yunmi Choi, Indiana-Southeast 

Does When and Where Matter? The Influence of Ad 

Timing and Placement Context on the Effects of Online 

Behavioral Advertising 

Xinyu Lu, Haesung (Claire) Whang 

and Jisu Huh, Minnesota 



Invited Panelists 

Maria Len-Ríos, Georgia 

Shawnika Hull, George Washington 

Refereed Research Papers 

Creating Patient Self-Advocacy Workshops for 

Transgender and Gender Nonconforming Individuals: 

Process Description, Pilot Results, and Suggestions to 

Establish Evidence-Based 

Richard Mocarski, Nebraska at Kearney; 

William (Sim) Butler, Alabama; 

Nathan Woodruff, Trans Collaborations; 

Robyn King, Nebraska at Kearney; 

Debra Hope and Natalie Holt, Nebraska-Lincoln; 

Larisa Spencer, Brittany Hanzlik, 

and Joshua Eyer, Alabama 

Now or Future? Motivating Chinese Women 

to Get the HPV Vaccines for Their Children 

Sixiao Liu, Janet Yang, 

and Haoran Chu, University at Buffalo 

Why Aren’t We Talking About Weight? Information 

Underrepresented Women Receive about Weight 

Management During Pregnancy 

Summer Shelton, Matthew R. Cretul, 

Amanda Kastrinos, Debbie Treise, 

Amanda Bradshaw, Easton Wollney, Alexis Bajalia 

and Kendra Auguste, Florida 

Changing the Image of STEM: Challenging Adolescents’ 

STEM Stereotypes Using Diverse Media Role Models 

Jocelyn Steinke, Brooks Applegate, Jay R. Penny, 

and Sean Merlino, Western Michigan 

Reaching an At-Risk Population: Visual Health 

Communication Campaigns for Migrant Workers 

Susan Dun, Northwestern University in Qatar; 

Amal Ali 

and Bothayna Al-Mohammadi, Northwestern; 

Sana Hussain, Muhammad Muneeb Ur Rehman, 

and Muhammad Humam, Northwestern University 

in Qatar 

Wednesday 

Discussant 

Lisa Farman, Ithaca 

12:15 to 1:30 p.m. / W031 Meeting Room 03 


Risk Division 

Special Research Session 

Race, Ethnicity, and Identity in Science 

and Health Communication 

12:15 to 1:30 p.m. / W032 Renaissance BR West A 



The Cutting Edge of Communication Technologies 


Su Jung Kim, Southern California

148 




Hey Alexa! Tell Us Why People Adopt and Trust Voice 

Activated Digital Assistants 

Claire Sauter, Morgan van der Horst, Mary Wilson 

and Sophia Germano,St. John Fisher; 

and Ronen Shay, Wentworth Institute of Technology 

The Effects of Modality, Device, and Task Differences on 

Human-likeness in Virtual Assistant Interaction 

Eugene Cho, Maria D. Molina 

and Jinping Wang, Pennsylvania State 

Effects of User versus Object Agency in Interaction 

with Smart Objects: A Moderated Mediation Model of 

Anthropomorphism and Perceived Connectedness 

Hyunjin Kang, Nanyang Technological University 

and Ki Joon Kim, City University of Hong Kong 

Predicting Artificial Intelligence (AI) Chatbot Use 

in South Korea: The Roles of Socio-Demographic 

Characteristics, Innovativeness, Sense of Belonging, 

and Computer Self-Efficacy 

Kyungeun Jang, Jinyoung Choi, Seonggyeol Cho 

and Namkee Park, Yonsei University 

How Should an Embodied Conversational Agent Carry 

Out Small Talks? The Effect of the Agent’s Passivity in 

Small Talks on User Psychology 

Jin Kang and Lewen Wei, Pennsylvania State 

Discussant 

Bart Wojdynski, Georgia 

12:15 to 1:30 p.m. / W033 Congressional Hall B 



Torts 


Jason Sheppard, California State, Fullerton 

Defamation Per Se and Transgender Status: When 

Macro-Level Value Judgments About Equality Trump 

Micro-Level Reputational Injury 

Austin Vining, Ashton Hampton 

and Clay Calvert, Florida 

Making @YourState “Friends” With #Privacy: 

Rights and Wrongs In State Social Media Privacy 

Password Statutes 

Jacob Elberg and Genelle Belmas, Kansas 

First Amendment Envelope Pushers: Revisiting the 

Incitement-to-Violence Test with Messrs. Brandenburg, 

Trump & Spencer 

Clay Calvert, Florida 

Discussant 

Jane Kirtley, Minnesota 

12:15 to 1:30 p.m. / W034 TBA 



Magazine Media Luncheon 

Hosting 

Sharon Bloyd-Peshkin, Columbia-Chicago 

12:15 to 1:30 p.m. / W035 Renaissance BR West B 


MCS Awards Luncheon 

Hosting 

Robert McKeever, South Carolina 

By invitation only. 

12:15 to 1:30 p.m. / W036 Congressional Hall A 

Minorities and Communication, Scholastic Journalism 

Divisions and The Trailblazers of Diversity Oral History 

Project 

Luncheon 

Trailblazers of Diversity Awards Luncheon 

and Panel 



Panelists 

June Nicholson, Virginia Commonwealth 

Maggie Rivas-Rodriquez, Texas at Austin 

Barbara Hines, emeritus, Howard 

Paula Poindexter, Texas at Austin 

Thomas Hrach, Memphis 

Award Presentation and Recognitions 


Robert P. Knight Multicultural Recruitment Award 

Recipient: Acel Moore High School Journalism 

Workshop, The Philadelphia Media Network 

Lionel C. Barrow Award for Distinguished Achievement 

in Diversity Research and Education 

Recipient: Mia Moody-Ramirez, Baylor 

Lee Barrow Minority Doctoral Scholarship 

Recipient: Qun Wang, Rutgers


149 



The panel will explore the status of diversity efforts in 

news coverage over five decades and the objective of 

the AEJMC Diversity Project in capturing the contributions 

and perspectives over that period of many members 

and leaders of AEJMC and other academic and professional 

organizations. Panelists also will examine how 

the AEJMC Diversity Project work can educate a new 

generation of journalists and educators about the important 

principles in covering all of society. Pre-registration 

is required. 

12:15 to 1:30 p.m. / W037 Del Frisco’s Double Eagle 

Steakhouse 


12:15 to 1:30 p.m. / W039 Zaytinya Restaurant 



Teacher of the Year Luncheon 

Hosting 

Sony DePalma, North Carolina Asheville 

Teacher of the Year luncheon will be held at Zaytinya, 

701 9th St. NW. (Dutch treat). In walking distance from 

AEJMC. Pre-registration is required. 



Annual Luncheon 

Hosting 


Panelists 

Andrew P. Scott, USA Today 

Ashley Perks, The Hill 

Jahi Chikwendiu, The Washington Post 

Walk two minutes and join VisCom colleagues for a 

lunchtime presentation by prominent DC-based visual 

journalists. Luncheon will be held at Del Frisco’s 

Double Eagle Steakhouse (near the conference hotel). 

Pre-registration is required. 




Teaching 


Doctors Are In 


Chris Roush, North Carolina at Chapel Hill 

Panelists 

Preparing for Next Semester 

Carol Schwalbe, Arizona 

So, You’re a College Instructor. Now What? 


Teaching a Practicum 

Mary Rogus, Ohio 

Assessment and Your Class 

Jennifer Henderson, Trinity 

Wednesday 


Invited Paper Session 

Forecasting Avenues for Religion and Media 

Research 



Panelists 

Guy Golan, South Florida 

Debra Mason, Missouri 

Kimberly Meltzer, Marymount 

Sahar Mohamed Khamis, Maryland 

Discussant 

Mariam Alkazemi, Virginia Commonwealth 

This session features teaching tips from the committee’s 

new book “Master Class: Teaching Advice for Journalism 

and Mass Communication Instructors.” 

12:15 to 1:30 p.m. / W041 Meeting Rooms 8-9 




Award Panel Session 

Building a Culture, Not a Quota: Diversity, 

Equity and Inclusion Beyond the Numbers 


Chris Callahan, Arizona State, 2017 recipient 

of the AEJMC Equity and Diversity Award

150 




2018 EDA Recipient: 

Klein College of Media and Communication, 


Panelists 

David Boardman, Temple 

Marc Lamont Hill, Temple 

David Brown, Temple 

Scott Gratson, Temple 


Clemencia Rodriguez, Temple 

David T.Z. Mindich, Temple 

Bryan Monroe, Temple 





Journalism & Mass Communication Quarterly 

Editorial Luncheon 


Louisa Ha, J&MCQ editor, Bowling Green State 


Donald W. Reynolds National Center for Business 

Journalism 


What Works: Introducing Business Fundamentals 

into Your Curriculum 


Andrew Leckey, president, Reynolds Center 

Panelists 

Andrew Leckey, president, Reynolds Center 

Rob Wells, Arkansas 

Leslie Wayne, Columbia and NYU 

Rob Reuteman, Colorado State 

For more than a decade, educators have learned tactics 

for teaching business journalism and a better understanding 

of money and the economy in all reporting at weeklong 

training workshops and funded visiting professorships 

through the Donald W. Reynolds National Center 

for Business Journalism. This panel, will draw on what 

works – bringing the fundamentals of covering business 

and the economy into all classrooms. 


Korean American Communication Association 



Dong Hoo Kim, North Carolina at Chapel Hill 

A Historical Prologue to Online Activism: The Pure 

Hangul (Korean) Movement in the Prehistory of Internet 

Kwang-Suk Lee, Seoul National University 

Can This Be an Effective Media Supporting Health 

Promotionfor Korean People?: A Study for Developing 

Better Pictorial Health Warnings on Cigarette Packets 

in Korea 

Jay (Hyunjae) Yu, Sogang University 

and Sungkyu Lee, Korea Health Promotion Institute 

Korean Digital Diaspora and its Social Movements since 

2014* 

Hojeong Lee, Temple 

JournalisTrash: The Intense Distrust of Journalists in South 

Korea and the Dual Crisis of Journalism and Democracy 

Siho Nam, North Florida 

Discussant 

Yong-Chan Kim, Yonsei University 


12:15 to 1:30 p.m. / W045 Mount Vernon A 


Panel Session 

Digitizing the Curriculum: Modifying Instruction 

Today to Meet the Needs of the Future 


Lee Ahern, Pennsylvania State 

Panelists 

Natalie Brown-Devlin, Texas at Austin 

Elise James-Decruise, Senior Director and Head 

of Global Training, New Marketing Institute 

Michael Texidor, Senior Director, Learning and 

Certification Operations, the Interactive 

Advertising Bureau 


Ranjeeta Baijnauth, Director of Learning and 

Development, Interactive Advertising Bureau 

Digital technologies are disrupting the media landscape. 

No aspect of the industry is immune from massive change; 

audiences, media companies, marketers, regulators and


151 



educators are all adapting to new realities at a pace that 

seems only to accelerate. This panel will explore ways to 

make that happen, now and into the future. In addition 

to the panelists, all attendees will be encouraged to share 

their experiences and move the conversation forward. 

Once desired outcome will be the organization of the 

core of a committee to research, propose and organize 

specific activities to meet these objectives within AEJMC 

and in conjunction with industry partners. 

Meet in the lobby of the Renaissance Hotel at 1:15 p.m. 

to board bus. Bus will depart promptly at 1:30 p.m. for 

visit to Washington Media Scholars Foundation. 



and Electronic News Divisions 

12:30 to 2 p.m. / W046 Grand Trunk Restaurant 

South Asian Communication Association 

Off-site Lunch 

South Asian Food and Fellowship 



and Pallavi Guha, SACA 

Join us South Asian food and fellowship at “going Dutch” 

lunch at the Grand Trunk restaurant, 641 Indiana Ave 

NW, Washington D.C., 20004. We’ll meet at the restaurant. 

Persons participating in our group lunch will pay for 

themselves. This session of the South Asia Initiative will 

bring together AEJMC members with interest and expertise 

in Afghanistan, Bangladesh, Bhutan, India, Maldives, 

Myanmar (Burma), Nepal, Pakistan and Sri Lanka and 

the South Asian diaspora worldwide. If you’ve questions, 

email Pallavi Guha (pallaviguha@gmail.com). No preregistration 

is required. Just show up. All are welcome. 


Reading Between the Lies: Addressing a Lack 

of Truth in Today’s Political Discourse 


Bob Trumpbour, Pennsylvania State-Altoona 

Panelists 

Maria Fontenot, Tennessee- Knoxville 

Karen Kline, Lock Haven 

Jacqueline Lambiase, Texas Christian 

Leonard Pitts, Jr., Miami Herald 

Bob Trumpbour, Pennsylvania State-Altoona 

2018 Cultural and Critical Studies Division’s PF&R 

Award 

Recipient: Leonard Pitts, Jr., Miami Herald 

The award will be presented following the presentations. 



Wednesday 

1:30 to 2 p.m. / W047 Grand Ballroom North 




This break is sponsored by……… 

1:30 to 3:30 p.m. / W048 Washington Media 

Scholars Foundation 


Off-site Tour 

Visit to Washington Media Scholars Foundation 

Hosting 

Jay Adams, Virginia Commonwealth; Washington 

Media Scholars Foundation 


International Journalists and Global News 


Caryl Cooper, Alabama 

Making China Their “Beat”: A Collective Biography 

of U.S. Correspondents in China, 1900-1951 

Yong Volz and Lei Guo, Missouri 

Henry Luce’s American and Chinese Century: 

An Analysis of U.S. News Magazine’s Coverage 

of General Chiang Kai-shek from 1936 to 1949 

Daniel Haygood and Glenn Scott, Elon 

The German-American Press and Anti-German 

Hysteria During World War I 

Kevin Grieves, Whitworth 

Retreat from the Golden Age: Russian Journalists 

and Their World, 1992-2000 

Rashad Mammadov, Suffolk University, 

and Owen V. Johnson, Indiana

152 




Discussant 

Catherine Cassara, Bowling Green State 



and Magazine Media Divisions 


Teaching Data Journalism in a Global Context: 

The Best Tools and the Most Effective Tips 



Panelists 

Teaching Data Journalism to Tell Global Stories 

in the Classroom 


Global Data Sources and Freedom of Information 

Laws: Tips on Best Practices Searching for Data 

Gerry Lanosga, Indiana 

Storytelling with Data: A Resource Guide 

for Data Journalism 

Wenli Gao and Lindita Camaj, Houston 

Data Journalism with Google 

Nicholas Whitaker, Training and Development 

Manager, Google News Lab 

1:45 to 3:15 p.m. / W052 Congressional Hall B 

Law and Policy Division and Lesbian, Gay, Bisexual, 

Transgender and Queer Interest Group 


True Threats, Hate Speech and the Rise of Trump 

in America – Does the First Amendment 

Protect Too Much “Offensive” Speech? 


Jason Shepard, California State, Fullerton 

Panelists 

Rodney Smolla, dean, Widener Law School 

Joseph Cabosky, North Carolina at Chapel Hill 

Hadar Harris, executive director, Student Press 

Law Center 

Chelsea Reynolds, California State, Fullerton 

Cristian Farias, writer-in-residence, Thurgood 

Marshall Institute of the NAACP Legal Defense 

Fund; columnist for New York magazine 




News, Framing, and Effects 


Alyssa Appelman, Northern Kentucky 

Framing and Persuasion: A Frame-Building Perspective 

Jiawei Liu and Douglas McLeod, Wisconsin-Madison 

Exploring Mechanisms of Narrative Persuasion in a News 

Context: The Role of Narrative Structure, Homophily, 

Stigma, and Affect in Changing Attitudes and Altruistic 

Behavior 

Daniel Tamul, Virginia Tech; 

Mary Beth Oliver, Pennsylvania State 

and Jessica Hotter, Virginia Tech 

Can Inspiration Cross Party Lines? How News Framing 

of Morality and Partisan Cues Influence Elevation, 

Disgust, and Moral Judgments of Political Actors 

T. Franklin Waddell, Florida 

Why? Because I Like You: Effects of Familiarity on 

Perceptions of Media Trustworthiness 

Stephanie Schartel Dunn, Missouri Southern State 

An Experimental Test of the Effects of Hurricane News 

about Human Behavior on Climate-Related Attitudes 

Jessica Myrick and Jeff Conlin, Pennsylvania State 

Discussant 





Ethics in Advertising and CSR: Relationships, 

Stereotypes and Authenticity 


John Ferré, Louisville 

This Corporation Cares: Considering Ethics in 

Communicating Nonprofit CSR Relationships Online* 

Virginia Harrison, Pennsylvania State 

Still No End to Gender Stereotypes in Advertising: A 

Content Analytical Comparison of Different Channels 

Kathrin Karsay, Jörg Matthes, 

and Valerie Fröhlich, Vienna


153 



Ethics of Authenticity: Travel Influencers and the 

Production of Sponsored Content 

Mariah Wellman, Ryan Stoldt, Melissa Tully 

and Brian Ekdale, Iowa 

Discussant 

Jack Breslin, Iona 


1:45 to 3:15 p.m. / W055 Renaissance BR West A 




Teaching Media Programming in the Non-Linear 

and On-Demand Media Consumption Era 




Burn ‘Em: Can Outing a Confidential Source 

Ever Be Justified? 



Panelists 

Jack Shafer, Politico 


Ashley Messenger, NPR in-house counsel 


1:45 to 3:15 p.m. / W058 Penn Quarter 


Jiyoung Cha, San Francisco State 

Panelists 

Douglas Ferguson, College of Charleston 

Karen Han, Ball State 

Gregory G. Pitts, Middle Tennessee State 

John Turner, Towson 



and Participatory Journalism Interest Group 


How Journalists Define, Measure 

and Discuss Impact 


Elia Powers, Towson 

Panelists 

Elia Powers, Towson 

Magda Konieczna, Temple 

Jason Alcorn, local news consultant, Democracy 

Fund & Metrics and Impact editor, MediaShift 

Lindsay Green-Barber, director of Strategic 

Research, The Impact Architects 



Top Papers for Graduate Student Interest Group 


George Pearson, Ohio State 

Love Triangles: Effects of Relationship Status, Reception 

Partners, and Interpersonal Communication on Romantic 

Parasocial Interactions* 

Nicole Liebers, Julius Maximilian University 

of Würzburg 

Reddit’s Cops and Cop-Watchers: Context Reclamation 

in Online Interpretive Communities** 

Michael Buozis, Temple 

Stop Watching Me: Examining a Moderated 

Mediation Model of Privacy Concern and Information 

Control*** 

Bin Chen, Tsinghua University 

and An Hu, Chinese University of Hong Kong 

How Employees Perceive Organizational Change? 

An Investigation into Change Management from an 

Internal Communication Perspective**** 

Cen April Yue, Florida 

Discussant 


* First-Place Paper 

** Second-Place Paper 

*** Third-Place Paper 

****Fourth-Place Paper 

Wednesday

154 






and Minorities and Communication Division 


From Smith & Carlos to Abdul-Rauf to Kaepernick: 

What is Next for the Advocate Athlete 

and the Press that Covers Them? 


Molly Yanity, Quinnipiac 

Panelists 

Kevin Blackistone, Maryland 

Jerry Brewer, The Washington Post 

Abraham Khan, Pennsylvania State 

Michael Mirer, Fairmont State 

Etan Thomas, former NBA player and activist 

1:45 to 3:15 p.m. / W060 Renaissance Ballroom East 



Presidential Panel Session 

AEJMC 102: Making AEJMC Work for You 

Throughout Your Career 


Jennifer D. Greer, Alabama, 

AEJMC President 2017-18 

Panelists 

Dwight Brooks, Zayed 

Sheri Broyles, North Texas 


Chris Roberts, Alabama 

Ken Ward, Ohio 

Kyu Ho Youm, Oregon 

This session, a companion to AEJMC 101 on 3:15 p.m. 

Monday, August 6, is designed for newer members, 

graduate students, and anyone at any stage of their career 

looking to become more involved in AEJMC. Want to 

know how to serve on an appointed or standing committee, 

head a division or interest group, get a mentor, be 

part of the Institute for Diverse Leadership, win a senior 

or emerging scholar grant, run for office? Panelists at 

different stages of their careers talk about how they got 

involved and how they leveraged their AEJMC activities to 

enhance all aspects of their academic lives, from research 

and teaching success to tenure/promotion to climbing the 

administrative ladder at their home institutions. 




Research 

Award Panel Session 

Deutschamann Award 


Jisu Huh, Minnesota 

Paul J. Deutschmann Award for Excellence in JMC 

Research: 

Recipient: S. Shyam Sundar, Pennsylvania State 

Panelists 



Sriram Kalyanaraman, Florida 

Dhavan Shah, Wisconsin - Madison 

S. Shyam Sundar, Pennsylvania State 


Walter Cronkite School of Journalism 



Teaching the Next Generation of Broadcast 

Journalists 


Mark Lodato, associate dean, Arizona State 

and Jennifer Preston, vice president of journalism, 

Knight Foundation 

The Cronkite School’s Associate Dean Mark Lodato and 

Jennifer Preston, vice president of the Journalism Knight 

Foundation, along with two other panelists from schools 

driving change in broadcast journalism, discuss how to 

foster innovative students whose ideas and experience 

will support and transform local television news and 

engage communities in new ways.


155 



3:30 to 5 p.m. / W063 Congressional Hall C 

Advertising and Public Relations Divisions 


ADVD Outstanding Open Research and Student 

Papers and Top PRD Student Papers 


Valerie Jones, Nebraska-Lincoln 

“Recovery Warriors”: The National Eating Disorder 

Association’s Online Public and Rhetorical Vision 

Sarah Aghazaden, Maryland, College Park 

Discussant: Arunima Krishna, Boston 

“I Don’t Consider Myself a Corporate Fundraiser”: 

Understanding the Nonprofit Perspective in CSR 

Relationships 


Discussant: Brook McKeever, South Carolina 


A Meta-Analysis of Cause-Related Advertising Effects on 

Global Consumers* 

Michelle Rego, Johnson & Wales University; 

Dana Rogers, Southern Connecticut 

and Mark Hamilton, Connecticut 

The Changing Landscape of Mobile Advertising: Current 

Practices, Key Insights and Future Research Directions** 

Xinyu Lu, Minnesota 

The Effects of Mood and Arousal on Information Searching 

and Processing on a Search Engine: Implications for Paid 

Search Ads*** 

Sela Sar, Illinois at Urbana-Champaign; 

George Anghelcev, Northwestern in Qatar; 

Taylor Jing Wen, South Carolina; Chang-Dae Ham, 

and Jie (Doreen) Shen, Illinois at Urbana-Champaign 

We Eat What We Can “Process”: How Regulatory Fit 

Affects Consumers’ Evaluation of Front-of-package Food 

Label and Health Claim**** 

Giang Pham, Illinois at Urbana-Champaign 

Discussant 

John Wirtz, Illinois at Urbana-Champaign 

* Third Place Paper, Open Research Category, 


** Second Place Paper, Student Research Category, 


*** Second Place Paper, Open Research Category, 


**** Third Place Paper, Student Research Category, 



Supervisor Humor Styles and Employee Advocacy: 

A Serial Mediation Model* 

Patrick Thelen, Florida 

Discussant: Marlene Neill, Baylor 

Exploring Publics’ Expectations for Crisis Outcomes: 

A Communication Mediated Psychological Mechanism 

in Social Media Era** 

Yingru Ji, The Chinese University of Hong Kong 

Discussant: Linda Aldoory, Maryland 

Sharing the Problem-Solving Experience with 

Corporations: How Brand Activism Creates 

Brand Loyalty 

Keonyoung Park, Syracuse 

Discussant: Chris McCollough, Columbus State 

* Second Place Student Paper, Public Relations 

Division 

** Third Place Student Paper, Public Relations Division 

3:30 to 5 p.m. / W064 Grand Ballroom South 

Communication Technology, Communication Theory 

and Methodology and International Communication 

Divisions 



Topic I — Brand Promotion and Social Media 

1. Whenever, Wherever: The Persuasive Effects 

of Commercials Experienced 

with Mobile Virtual Reality 

Priska Breves 

and Nicola Dodel, University of Wuerzburg 

2. “This Message Will Self-Destruct”: Brand Use of 

Ephemeral Content on Snapchat for Strategic 

Communication 

Brooke Smith, Christopher Wilson, 

and Pamela Brubaker, Brigham Young 

3. Characteristics of Compensated Consumer Reviews 

and the Effect of Compensation Disclaimer on 

Attitude and Purchase Intention 

Su Jung Kim, Southern California; 

Ewa Maslowska, University of Amsterdam; 

and Ali Tamaddoni, Deakin University 

4. How Does Customization Influence Conspicuous 

Consumption Among Socially Excluded versus 

Included Consumers? 

Linwan Wu, Nanlan Zhang, Nandini Bhalla, 

and Anan Wan, South Carolina 

Discussant 

Frank Parcells, Austin Peay State 

Wednesday

156 




Topic II — Motivations for Social Media Use 

5. The Effects of Gratifications on the Continuance 

Intention to Use a Mobile Instant Messenger Service 

Hyunjung Kim, Keimyung University 

6. Checking in During Irma: Investigating Motivations, 

Emotions, and Narratives on Facebook’s Safety 

Check Feature 

Seoyeon Kim, and Lucinda Austin, North 

Carolina at Chapel Hill; 

and Jeanine Guidry, Virginia Commonwealth 

7. I DON’T USE FACEBOOK ANYMORE: An 

Investigation into the Relationship 

Between the Motivations to Leave Facebook 

and the Big Five Personality Traits 

Seoyeon Hong, Rowan 

and Klive (Soo-Kwang) Oh, Pepperdine 

Discussant 

Gi Woong Yun, Nevada, Reno 

Topic III — Communication Technologies and the Self 

8. Instagramming Social Presence: A Test of Social 

Presence Theory and Heuristic Cues on Instagram 

Sponsored Posts 

Erika Johnson, East Carolina 

and Seoyeon Hong, Rowan 

9. No Time to Think: The Impact of Smartphone 

Technology on Mindfulness and Reflection 

Mary Beth Bradford, Florida Southern College 

10. Smartphone and Self-Extension: Functionally, 

Anthropomorphically, and Ontologically 

Extending Self via the Smartphone 

Chang Sup Park, University at Albany, SUNY 

and Barbara Kaye, Tennessee, Knoxville 

Discussant 


Topic IV — Use and Effects of Social Media 

11. A Review of Media Addiction Research 

from 1991 to 2016 

Louis Leung and Cheng Chen, Chinese 

University of Hong Kong 

12. International Student’s Social Networking Sites Use, 

Perceived Social Support, and Acculturative Stress 

Lin Li, Michigan State 

13. Snapchat Usage from the International Perspective: 

Comparison Between the United States 

and South Korea 

Haseon Park, Soojung Kim, 

and Joonghwa Lee, North Dakota 

14. YouTube, Show Me “How-to”: Exploring Parasocial 

Interaction and Self-efficacy Mechanism Governing 

Behavioral Intent in YouTube Tutorial Videos 

Hyosun Kim, Wisconsin, Stevens Point 

Discussant 

Pamela Brubaker, Brigham Young 

Topic V — Gaming and Online Communities 

15. Moving with Presence: A 4-week Virtual 

Reality-based Exergame Training with Cognitive 

Challenges on Executive Functions in People 

Aged 50 and Over 

Tim Huang, Michigan State 

16. Relationships between Gameplay Motives, Gaming 

Activities, and Quality-of-Life Perceptions Among 

Older Game Players 

Yowei Kang, Kainan University 

and Kenneth C.C. Yang, Texas at El Paso 

17. Predictors of Peer-to-Peer Communication Among 

Elder Adults within an Online Interactive 

Communication System 

Juwon Hwang 

and Junhan Chen, Wisconsin-Madison 

18. “NextDoor People Are Nuts”: Analyzing Twitter 

Perspectives About the People and Purpose 

of NextDoor 


19. Who Will Reply to A Troll? A Network Approach 

to Understanding Trolls in Online Communities 

Qiusi Sun and Cuihua Shen, California, Davis 

Discussant 

James D. Ivory, Virginia Tech 

Topic VI — Changing Trends in Online and Mobile News 

20. How Many Will Read It on Reddit? A Model That 

Predicts Rankings of Reddit News 

Aditya Ravindra Bhat 

and Ronald Yaros, Maryland 

21. News Finds Them, and Then What? How Post- 

Millennials Engage with Social and Mobile 

Media News 

Anne Oeldorf-Hirsch 

and Preeti Srinivasan, Connecticut 

22. When Journalism and Automation Intersect: 

Assessing the Influence of the Technological Field 

on Contemporary Newsrooms 

Shangyuan Wu, Edson Tandoc, 

and Charles Salmon, Nanyang Technological 

University Singapore 

Discussant 

John Russial, Oregon 

Topic VI — Communication Technologies and the Self 

20. No Time to Think: The Impact of Smartphone 

Technology on Mindfulness and Reflection 

Mary Beth Bradford, Florida Southern College


157 



21. Smartphone and Self-Extension: Functionally, 

Anthropomorphically, and Ontologically 

Extending Self via the Smartphone 

Chang Sup Park, University at Albany, SUNY 

and Barbara Kaye, Tennessee, Knoxville 

22. Instagramming Social Presence: A Test of Social 

Presence Theory and Heuristic Cues on Instagram 

Sponsored Posts 

Erika Johnson, East Carolina 

and Seoyeon Hong, Rowan 

23. Space-body Relationship: Visualizing Geolocation 

on Instagram and the Implications on Psychological 

Well-being 

Shaojung Sharon Wang, National Sun Yat-sen 

University 

Discussant 


Topic VII — Media Multitasking 

24. Who Are the Second Screeners? Personality Traits 

Predicting Dual Screen Use 

Brigitte Huber 

and Homero Gil de Zúñiga, Vienna 

and James H. Liu, Massey University 

25. Predicting Cellphone Use While Driving 

and Walking Among College Students 

Tao Deng, Michigan State; 

Juan Mundel, DePaul; Kristen Lynch, 

Anastasia Kononova, 

and Saleem Alhabash, Michigan State 

26. Self-control and Media Multitasking: The Role 

of Conflict Identification and Intrinsic Motivation 

Shan Xu and Guanjin Zhang, Ohio State 

27. Predictors of Multiscreen Use: A Comparative Study 

of the United States and the Netherlands 

Claire Segijn, Minnesota, Twin Cities 

and Anastasia Kononova, Michigan State 

Discussant 

Mike Horning, Virginia Tech 

Topic VIII — Communication Technology and Health 

28. Pro-Vaxxers Get Out: Anti-Vaccine Advocates 

Influence Questioning First-Time, Pregnant, 

and New Mothers on Facebook 

Amanda Bradshaw, Summer Shelton, 

Easton Wollney, Debbie Treise, 

and Kendra Auguste, Florida 

29. The Effects of Expectation Fulfilment of Likes 

on Anxiety and Depression: The Role of Perceived 

Lipei Tang, Chinese University of Hong Kong 

30. Risk Factors for Cyberbullying Victimization: 

A Survey of Adult Internet Users in 19 Countries 

Tiernan Cahill, Kate Mays, 

and John Donegan, Boston University; 

Homero Gil de Zúñiga, University of Vienna 


31. Peer-To-Peer Connections: Perceptions of a Social 

Networking App Designed for Young Adults with 

Cancer 

Allison Lazard, Adam Saffer, 

and Lindsey Horrell, North Carolina, Chapel 

Hill; 

Catherine Benedict, Northwell Health 

and Brad Love, Texas at Austin 

32. Developing and Testing Web-based Avatar 

Customization as a Self-Affirmation Manipulation 

Tool 

Hyunjin Kang and Hye Kyung Kim, Nanyang 

Technological University 

Discussant 


Topic IX — Stories, Narratives and Communication 

Technology 

33. Who Leads the Conversation on Climate Change?: 

A Study of the Global Network of NGOs on Twitter 

Hong Vu, Kansas; Hung Do, Trader Interactive; 

Hyunjin Seo and Yuchen Liu, Kansas 

34. Twitter versus Facebook: Discussing Controversial 

Issues on Social Media 

Mustafa Oz, Southern Indiana 

35. Take Them There: From Narrative Engagement 

to Behavioral Intention in Cause-related Immersive 

Storytelling 

Geah Pressgrove, Nicholas Bowman, 

and Jennifer Knight, West Virginia 

36. Social Media and the Classroom: Reversing the 

Knowledge Gap through Tweets 

Jason Turcotte, California Poly Pomona 

37. Does Being an Expert Make You More Negative? 

An Investigation of Subjective Expertise and 

Electronic Word-of-Mouth Communication 

Jiangmen Liu, Seattle and Cong Li, Miami 

Discussant 

Frank Russell, California State, Fullerton 


38. Mental Schema as Explanations for Third-person 

Perceptions, Censorship and Media Literacy 

Programs Addressing “Revenge Porn” 

Michael Boyle, West Chester 

and Michael Schmierbach, Pennsylvania State 

Wednesday

158 




39. The Effects of Hostile Media Perception and Third 

Person Perception on Political Participation in the 

Partisan Media Context 

Ki Deuk Hyun, Akita International 

and Mihye Seo, Sung Kyun Kwan 

40. Understanding the Effects of Perspective-taking 

on Stereotyping and Negative Evaluations: 

A P-curve Analysis 

Qian Huang, Wei Peng, 

and Jazmyne Simmons, Miami 

41. How Issue Attribution and Power Exemplification 

Redirect Transgender Intergroup Stereotype Content: 

An Integrated Threat Approach 

Minjie Li, Louisiana State 

42. The Evolution of Regime Legitimacy Imaginaries 

on the Chinese Internet 

Yingru Ji and Angela Xiao Wu, Chinese 

University of Hong Kong 

Discussant 


43. Terror, Terror Everywhere? How Terrorism News 

Shape Anti-Muslim Policy Support: Perceived 

Threat and Risk Controllability 

Jörg Matthes, Desiree Schmuck 

and Christian von Sikorski, Vienna 

44. Overriding the Threat Dynamic: Facebook 

Sociability for Trust and Perceptions of Difference 

Brandon Bouchillon, Indiana-Purdue Fort 

Wayne 

45. Who has Set Whose Agenda on Social Media? 

A Dynamic Social Network Analysis of Tweets 

on Paris Attack 

Fan Yang, SUNY-Albany 

46. The Trump Bump: The Influence of Elite Anti-Media 

Rhetoric and Political Activity on Emotions, 

Perceptions of News Media Importance, 

and Public Support for the Press 


Discussant 

Bryan Wang, Nebraska-Lincoln 

47. Cause and Effect: Development and State of the Art 

of Experimental Communication Research, 

1980-2015 

Jörg Matthes, Vienna 

and Franziska Marquart, Amsterdam 

and Brigitte Naderer, Desiree Schmuck, 

Florian Arendt, Munich 

48. Thumbs Up! Impacts of Interactive News Voting 

Affordances on Selective Exposure, Voting 

and Persuasion 

George Pearson, Daniel Sude 

and Silvia Knobloch-Westerwick, Ohio State 

49. Communication Mediation Model Across Cultures: 

Multilevel Mediation Model Effects of News 

and Discussion on Participation 

Homero Gil de Zúñiga 

and Trevor Diehl, Vienna 

and Brigitte Huber and James H. Liu, Massey 

50. Equal Access to Online Information? Google’s 

Suicide-Prevention Disparities May Amplify 

a Global Digital Divide 

Sebastian Scherr, Leuven; 

and Mario Haim and Florian Arendt, Munich 

51. What’s More Scandalous? How the Interplay 

of Textual and Visual Frames Affects Candidate 

Attitudes and Voting Intentions in Political Scandals 

Christian von Sikorski 

and Johannes Knoll, Vienna 

Discussant 

Fuyuan Shen, Pennsylvania State 

52. Testing the Criterion Validity of 10 Measures 

of Media Favorability for Corporate Financial 

Performance: A Case Study of the Media Coverage 

of Food Companies 

Xiaoqun Zhang, North Texas 

53. Mediatized Rituals: De-reify the Media in the Age 

of Deep Mediatization 

Xi Cui, Charleston 

54. A Typology of Information Distribution Organizations 


55. Electroencephalography in Communication 

Research: Some Fundamentals, Opportunities, 

and Challenges 

Alyssa Morey, Albany 

56. Questionable Morals: A Systematic Analysis 

of Reliability in Research Using the Moral 

Foundations Questionnaire 

Daniel Tamul, James Ivory, Jessica Hotter, 

Madison Lanier and Jordan Wolf, Virginia Tech 

Discussant 



Topic I — Social media and cultural influences 

57. Reading, Commenting, and Posting: Social Media 

Engagements and Chinese Students’ 

Acculturation in the United States 

Liefu Jiang and Peter Bobkowski, Kansas 

58. Target Intimacy: Notes on the Convergence 

of the Militarization and Marketization of Love 

in Colombia 

Alex Fattal, Pennsylvania State 

59. Thanks, Obama: Internet Memes as Contested 

Political Spaces in the United States and Russia 

Volha Kananovich, Iowa


159 



60. A Different Story: Examining the Relationship 

between Exposure to Snapchat’s “LIVE” Story 

Feature and Perceptions of Muslims and Arabs 

Katherine Grasso, Desales University 

and William Edwards, Ohio 

Discussant 

Jeremy Saks, Old Dominion 

69. Raping Europa Again?: Discursive Constructions 

of the European Refugee Crisis in Four German 

and Polish News Magazine Covers 

Lyombe Eko, Texas Tech 

and Natalia Mielczarek, Virginia Tech 

Discussant 

Siho Nam, North Florida 

Topic II — Social Media and Audience Across Cultures 

61. Liberation or Control? How Do the Attitudes 

of Russian Facebook Users Differ from Those on 

Runet Platforms Vkontakte and Odnoklassniki? 

Olga Kamenchuk and Erik Nisbet, Ohio State 

62. Online Social Viewing: Cross-Cultural Adoption 

and Uses of Bullet Screen Videos 

Anan Wan, Leigh Moscowitz, 

and Linwan Wu, South Carolina 

63. Influence of Cultural Distance on Female Body 

Image: Race, Beauty Type, and Image Processing 

Chen Gan, Chinese University of Hong Kong 

Discussant 

Hong Tien Vu, Kansas 

Topic III — Exploring Culture in International Contexts 

64. Making Home Through Cord-cutting: The Case 

of Korean Temporary Visa-Status Migrants’ Post- 

Cable Culture in U.S. 

Claire Shinhea Lee, Texas at Austin 

65. Political and Cultural Forces on the Uses 

and Gratifications: Twitter, Facebook, Instagram 

and Snapchat in the U.S and Kuwait 

Ali Al-Kandari, Gulf University for Science 

and Technology; 

Mariam Alkazemi, Virginia Commonwealth; 

and Deb Aikat, North Carolina at Chapel Hill 

66. Predictors of Cultural Conservatism in Six Arab 

Countries 

Ralph Martins, Shageaa Naqvi, 

and Justin Martin, Northwestern in Qatar 

Discussant 

Hyunjin Seo, Kansas 

Topic IV — Media Representations Across the World 

67. Facebook Groups as Affective Counterpublics 

James Gachau, Maryland 

68. When Hippocrates encountered Confucius – 

A Textual Analysis of Representations of Medical 

Professionalism on Chinese Medical Dramas 

Li Chen, West Texas A&M 

Topic V — Contemporary Journalism and International 

Issues: Trends in Theory and Practice 

70. Tweeting about Terror: Using World Systems 

Theory to Compare International Newspaper 

Coverage Online 

Nataliya Roman, North Florida; 

Mariam Alkazemi, Virginia Commonwealth, 

and Margaret Stewart, North Florida 

71. Giving Voice to Terrorists: A Longitudinal Model 

Explaining How National Political Contexts 

Influence Media Attention Toward Terrorist 

Organizations 


and Valerie Hase, University of Zurich 

72. Discourse of the Cross-Sectoral Alliances Network 

in the Global Refugee Crisis: Studying CSR through 

a Global Perspective 

Aimei Yang, Southern California; 

Wenlin Liu, Houston 

and Rong Wang, Northwestern 

Discussant 

Enakshi Roy, Western Kentucky 

Topic VI — Training and Practice of Contemporary 

Journalism: Emerging Issues 

73. Innovation and Entrepreneurship: International 

Journalism Students’ Interpretive Repertoires 

for a Changing Occupation 

Jane B. Singer, City, University of London, 

and Marcel Broersma, University of Groningen 

74. Seeking Transnational, Entrepreneurial News from 

Latin America: An Audience Analysis* 

Vanessa Higgins Joyce, Texas State 

and Summer Harlow, Houston 

75. “Pivoting” With the President’s Gaze: Exploring 

New York Times Foreign-Policy Coverage Across 

Nine Administrations 

Kirsten Adams and Daniel Riffe, North 

Carolina at Chapel Hill; 

Meghan Sobel, Regis University 

and Seoyeon Kim, North Carolina 


Wednesday

160 




76. Media Improvisations and Bureaucratic Tensions 

in China: Transcending Media Control and News 

Routines in Disasters 

Li Zhi 

and Limin Liang, City University of Hong Kong 

Discussant 

Delwar Hossain, South Alabama 

* Second Place Paper, Latino/Latin American 


3:30 to 5 p.m. / W065 Meeting Room 04 

History and Cultural and Critical Studies Divisions 


Remembering, Forgetting and Nostalgizing 1968: 

The Year that Rocked Our World 


Janice Hume, Georgia 

Panelists 

Jill Edy, Oklahoma 

Carolyn Kitch, Temple 

Abe Peck, Northwestern 

Amber Roessner, Tennessee, Knoxville 

3:30 to 5 p.m. / W066 Congressional Hall B 



First Amendment 


Benjamin Holden, Illinois 

Confronting Power, Defining Freedom and Awakening 

Participation: An Argument for Expanding Media Law 

Education 

Erik Ugland, Marquette 

Anthem Protests & Public-College Athletes: Is There a 

Need for a Constitutional Audible? 

Carmen Maye, South Carolina 

Sheppard v. Maxwell Revisited: A “Roman Holiday,” a 

“Carnival” or “Decorum Comparable with the Best”? 

W. Wat Hopkins, Virginia Tech 

3:30 to 5 p.m. / W067 Renaissance Ballroom West A 


Division and Community College Journalism 

Association 


Bringing Entrepreneurship into the Classroom: 

Challenges and Best Practices 



Panelists 



Carrie Brown, City University of New York 


Jeremy Gilbert, Director of Strategic Initiatives, 

The Washington Post 

3:30 to 5 p.m. / W068 Mount Vernon A 



Covering the Traumatic: News and Its 

Relationship with Trauma 



Understanding the Conflict Between Journalism 

Professionalism and Emotional Trauma 

Kenna Griffin, Oklahoma City University 

Journalism and Trauma: The Role of Education and 

Trauma Resources in Humanizing Newsrooms 

Natalee Seely, Ball State 

Reporting on Tragedy and Violence: Journalists’ 

Perspectives 


Routine Adjustments: How Journalists Framed the 

Charleston Shootings 

Bill Cassidy and Betty La France, Northern Illinois 

and Sam Babin, Iowa 

Discussant 


Discussant 

Joseph Russomanno, Arizona State


161 



3:30 to 5 p.m. / W069 Meeting Rooms 8-9 



Touching the (First Amendment) Third Rail: 

Techniques for Constructive Conversations 


Barbara McCormack, Newseum Education 

Panelists 

Al Cross, Institute for Rural Journalism 

and Community Issues 

Anna Kassinger, NewseumED 

Kristen Looney, Religious Freedom Center 



Beyond Swiping Left: Exploring How Dating App Use 

Affects College Students’ Abilities to Refuse Unwanted 

Dating and Sexual Activities 

Stacey Hust, Stephanie Gibbons, 

and Jiayu Li, Washington State 

and Nicole O’Donnell, Virginia Commonwealth 

Social Media Activism in Bangladesh: Understanding 

the #JusticeForTonu Movement from a Feminist 

Standpoint Theoretical Framework 

Umana Anjalin 

and Catherine Luther, Tennessee, Knoxville 

Hashtag Feminism Around the World: A Comparative 

Analysis of #MeToo Tweets 

Hyunjin Seo, Hong Tien Vu, Shola Aromona, 

Yuchen Liu, and Fatemeh Shayesteh, Kansas 

Women’s Responses to Online Harassment 

Kalyani Chadha, Linda Steiner, Jessica Vitak, 

and Zahra Ashktorab, Maryland 



Creative Projects 


Joe Gosen, Western Washington 

Winners: 

First Place 

Last Moments [Photo Essay] 

Ross Taylor, Colorado-Boulder 

Second Place 

Proud and Torn: A Visual Memoir of Hungarian 

History [Interactive Digital History Website] 

Betina Fabos, Dana Potter, Collin Cahill, 

Jacob Espenscheid, Isaac Campbell, 

Leslie Waters 

and Kristina Poznan, Northern Iowa 

Third Place 

The Club That No One Wants to Belong To: 

A Family Struggles and The Widow Bitch 

[Documentary Film] 

David Grewe, California State, Northridge 




Dating, Activism and Harassment in the 

#MeToo Era 



Misinformation Effects and Identification 


Sherice Gearhart, Texas Tech 

“Fake News Effect?” False Beliefs and Vote Choice in 

the 2016 Presidential Election 

Erik Nisbet, Kelly Garrett, 

Paul Beck, and Richard Gunther, Ohio State 

The (Non)Americans: Analyzing Russian Disinformation 

on Twitter 

Deen Freelon, North Carolina at Chapel Hill; 

Michael Bossetta, University of Copenhagen; 

Chris Wells, Wisconsin-Madison; 

Kirsten Adams, North Carolina at Chapel Hill; 

Yiping Xia, Wisconsin-Madison; 

and Josephine Lukito, Wisconsin-Madison 

A Citizen-Based Profile of Fake News Dissemination 

on Facebook 

Toby Hopp, Patrick Ferrucci, 

and Chris Vargo, Colorado-Boulder 

Correcting Misinformation at the Local Level? Potential 

for Local Media’s Fact-Checking on Local Issues 

Jianing Li, Wisconsin-Madison 

Unpacking Fake News: Understanding Partisan 

Consumption of Fake News During the 2016 US 

Presidential Election 

Ken Rogerson and Christopher Hill, Duke 

Wednesday 


Chelsea Reynolds, California State, Fullerton 

Discussant 

Emily Vraga, George Mason

162 




3:30 to 5 p.m. / W073 Renaissance Ballroom East 


and Electronic News Division 


Don’t Ask Me That: Using Compassion 

in Covering Religion Amid Conflict 


Mike Longinow, Biola 

Panelists 

Bill Silcock, Arizona State 

Andrea Scott, Military Times 

Kim Lawton, Religion & Ethics Newsweekly 

Kellie Stanfield, Salisbury 

Chad Curtis, Kansas 






Title 


Dean Kruckeberg, North Carolina Charlotte 

Panelists 

Kevin Cirilli, Chief Washington Correspondent, 

Bloomberg Television 

John Paluszek, Executive Editor, Business in Society 

Wendy Wyatt, Saint Thomas 

Patrick Plaisance, Pennsylvania State 

This panel will feature leading media ethics educators and 

representatives of major media organizations. Educators 

will discuss their goals in teaching ethical reasoning and 

decision-making for media professionals, whether in 

newsrooms, strategic communication agencies or communication 

units within corporations. During the panel, 

media professionals will learn what’s being taught in 

media ethics classes and can provide recommendations 

about how educators could better help prepare future 

media professionals. Educators will learn how media 

professionals and their organizations are approaching 

ethics and will explore ideas about how professional 

media organizations can build on classroom ethics 

instruction. Increased understanding and collaboration 

between educators and media professionals will help 

raise the ethical bar throughout the media landscape. 

3:30 to 5 p.m. / W075 Renaissance Ballroom West B 


Communication Journalism & Communication 

Monographs 


Editorial Committee Meeting 


Linda Steiner, editor, J&CM; Maryland 


Cronkite School, Arizona State University 


News Co/Lab: Experiments in News Literacy 


Kristy Roschke, Cronkite School, Arizona State 

Panelists 

Eric Newton, Cronkite School, Arizona State 

Dan Gillmor, Cronkite School, Arizona State 

The News Co/Lab works with newsrooms to improve the 

“demand side” of the supply-demand equation. This session 

focuses on what journalism schools can do to promote 

the better understanding and engagement of news 

and information. 


Dow Jones News Fund and American University 

Workshop Session 

Urban Journalism Workshop After 50 Years 



Panelists 

Thomas E. Engleman, retired executive director, 

Dow Jones News Fund 

Linda Shockley, managing director, Dow Jones 

News Fund 

Fifty years ago, the Dow Jones News Fund partnered 

with Washington media to start an Urban Journalism 

Workshop at American University. This session looks 

at how this increased racial diversity, launched media 

careers and the lessons it offers today.


163 



3:30 to 5 p.m. / W078 Mount Vernon B 



From Disaster to Dynamic: Tales from the 

Classroom and Tips for Better Teaching 


Sheri Broyles, recipient, 2017 Scripps Howard 

Teacher of the Year; North Texas 

Panelists 

Sheri Broyles, North Texas 

Kathleen Culver, Wisconsin 

Mike McKean, Missouri 

5 to 6:30 p.m. / W080 Hotel Lobby 




AEJMC Fun Run 



The 2018 Fun Run will leave from the conference hotel 

lobby at 5 p.m. Pre-registration is required. 


Are you new to the classroom looking for some tips? Or 

are you a seasoned professor searching for advice for a 

specific problem? Or maybe you want to hear some juicy 

disaster stories and how that led to better teaching. This 

session will be part idea session and part therapy – the 

good kind. This is your opportunity to hear from awardwinning 

professors. We’re here to tell you the good, the 

bad and the ugly. You’ll learn some tips that have worked 

in the past. More importantly, we’ll take questions and 

have a conversation to help you think through issues or to 

help you evolve your teaching. And if you’re just looking 

for a new idea or three, you might find those gems too. 

Come join us for a thought-provoking and motivating 

conversation. 


South Asia Communication Association 


The State of South Asia Communication Research 


Rauf Arif, Texas Tech 

Panelists 

Pallavi Guha, SACA 


Jordan Stalker, SACA 



The Best of the Best: Top Papers in the 




Another Super Bowl Study: An Exploratory Research on 

the Impacts of Ad Effectiveness Factors on Consumer 

Engagement on Social Media* 

Gawon Kim, Ian Skupski 

and Yongick Jeong, Louisiana State 

Ethnic Diversity as a Solution to the Advertising 

Industry’s Creative Problem** 

Robin Spring 

and Fang (Faye) Yang, Grand Valley State 

Expectations v. Reality: Comparing Perceptions of the 

Advertising Industry Between Students and Professionals*** 

Sara Champlin and Sheri Broyles, North Texas 

Role of Immersive Characteristic, Emotional Engagement, 

and Consumer Responses in Virtual CSR Experiences: 

Drunk Driving Prevention 360 Degree Video by an Alcohol 

Company**** 

Yoon-Joo Lee and Wen Zhao, Washington State; 

and Huan Chen, Florida 

The Effect of Endorser Body Type on Attitudes and Emotional 

Responses Toward Weight Loss Advertisements***** 

Lindsay Bouchacourt, Florida 

Wednesday 

Led by the SACA Executive Committee, this business 

meeting will identify current and future initiatives for 

the association. A guest from the International Center 

for Journalists will identify how that organization can 

assist SACA members interested in possible teaching or 

research opportunities in the South Asia region. 

Discussant 


* Top Paper, Open Research Category 

** Top Paper, PF&R Category 

*** Top Paper, Advertising Teaching Category 

****Top Paper, Special Topics Category 

*****Top Paper, Student Research Category



Cronkite School 

New Programs 

The Cronkite School has launched 

four new programs that seek to 

advance the future of journalism. 

Knight Local TV News Innovation 

This initiative, supported by a grant from 

the John S. and James L. Knight Foundation, 

promotes innovation in local TV news, 

experimenting with formats and digital 

storytelling to inform and engage communities. 

News Co/Lab 

Part of the Facebook Journalism Project, 

the News Co/Lab at Cronkite works with 

news organizations across the country 

to advance news literacy and conducts 

experiments in how to promote public 

understanding and engagement. 

cronkite.asu.edu 

Regional Journalism Collaboration for 

Sustainability 

Arizona PBS, operated by the Cronkite School, 

is the lead station for this new initiative to 

enhance and expand coverage of sustainability 

issues. The reporting partnership, supported 

by the Corporation for Public Broadcasting, 

includes public radio and television stations 

in Denver, Los Angeles and Phoenix. 

Sports Knowledge Lab 

This new international sports research 

and knowledge center distributes curated 

and original content about the impact 

of sport on society, providing context 

for top sports headlines from around 

the world. It is part of ASU’s Global Sport 

Institute, an international sports research 

and knowledge enterprise.

Nfiw Dfigrfifis 


Tfififififififiwfififififififififififififififififififififififififi 

fififififififififififififijfibfifififififiwfififififijfififififififififi’fifi 

ffisfifisfi growing job fifilds.fi 

Mfisfifir of Sfiifinfifi in Businfiss Journfilism 

Tfififififififififififikfifiwfifififififififififififififififififififififififififi 

fifivfififififififififixfifififififififififififififififififififififififififibfifififi 

bfififififififififififififififififififififififififififififififi 

• 30-fififififififififififififififififififififififififififififififififififi 

jfifififififififififififififififififififififififififififififififififififififififi 

fifififififififififififififi 

• Ifififififififififififififififififififififififiwfifififijfififififififififififi 

fififififififififififififififififi:fiAfifififiwfiLfifikfiyfififififififififi 

fiyfififififififififififivfififififififififififififififififififififififi 

CNBCfififififififi;fiPfifififizfififiPfifizfi-wfifififififififi 

fifififififififififififififififiSfifivfifififififi;fififififiRfififififiHfifififififi 

fififififififififivfifififififififififififififififififiBETfiIfifififififififivfifi 

Lfifififififififififififififi 

fisuonlinfi.fisu.fidu/onlinfidfigrfifi-progrfims/grfidufififi/ 

mfisfifir-sfiifinfifi-businfiss-journfilism 

Onlinfi Digififil Audifinfifis Progrfims 

MS in Digififil Audifinfifi Sfirfififigyfi 

Gfifififififififififififififififififififififififififififififiyzfifififiwfifi 

fififififififififififififififififififiwfifififififififififififififififififififififififi 

fifififififififififififififififififififififibfifififififivfifififififififififi 

fifififififififififififififififififififififififififififififififififivfifibfifififififififi 

fibjfifififivfififi 

Digififil Audifinfifi Sfirfififigy Grfidufififi 

Cfirfiifififififififififififififififififififififififififififififififififififififififi 

fififififififififififififififififififififififififififififififififififififififififififififififi 

fififififififififififififififififiwfifififififififififififififififififififiwfifififi 

fifififififififififififififififififififififififififififififififififi 

BS in Digififil Audifinfifisfififi 

Ufififififififififififififififififififififififififififififififififififififi 

fifififififififififififififififififikfififififififififififififififififififififififiyfi 

fifivfifififififififififififififififififififififiyfifififififiSEOfififififiSEMfi 

fififififififififififififififififififififififififififififififififififififififififififififi 

fifififififififififififififififififififififi 

fironkififi.fisu.fidu




Diversity Award 

The Cronkite School is the recipient 

of the inaugural Catalyst Award, 

honoring individuals and groups who 

inspire inclusion and transformation 

at ASU and beyond. 

The Cronkite School has 

“demonstrated its 

commitment to fostering 

inclusion, promoting equity 

and increasing diversity 

at the school.” 

— ASU Committee 

for Campus Inclusion 

Cronkite School’s Diversity Principles 

• Actively seek out and encourage diverse 

populations to become productive members 

of the faculty, staff and student body. 

• Create and maintain a work, learning 

and social environment that is cognizant 

and supportive of a diversity of human 

differences and beliefs. 

• Incorporate within the formal content of 

the curriculum and in each course an 

affirmation of the core journalistic values 

of accuracy, fairness, ethical behavior and 

sensitivity when reflecting an increasingly 

multicultural world. 

• Foster and support a climate in which 

events and activities of the school reflect 

diversity of awareness, and sensitivity to 

and support for people of different origins, 

orientations and abilities. 

cronkitenoticias.azpbs.org 

cronkite.asu.edu

Ffillowships 

find Trfiining 

Thfisfifififififififififififififisfififififififisfififififisfi 

fififififivfifififibfifififififisfifififififisfififififififififififiyfi 

fifiross fihfi fiounfiry. 

Cfirnfigifi-Knighfi Nfiws21 

Afifififififiwshfififififififififififififififififififififififififififisfififi 

fififififififififififififififififififififififififififisfifififififisfififififi 

whfifihfifihfiyfifififififififififififififififififififififi-fifififih,fi 

fifififififififififififififififififisfififififissfifisfifififififififififififififi 

fifififififififififi.fiIfififivfifififififisfihfififisfifififififififififi 

fififififiwsfifififififihfififififififififififififififififivfififififififififififififi 

sfifififififi. 

nfiws21.fiom/jsfihools 

Cronkififi-Poynfifir Adjunfifi Trfiining 

Afifififififififififififififififififififififififififififififififififififififififi 

fifififififiyfififififififiwfififisfififififififisfififififihfifififififififififififisfifi 

fifififififififififififififififififififififisfis.fiFfivfifisfififi-fifififififififi,fi 

fififififififififivfifififififififisfififivfifififivfifiyfihfififififififififi 

bfifififififififififisyfififibfisfififififififififififififiyfififififififissfififififi 

fififififififififififififisfifififififis.fiOfifififififififihfifififihfi 

Pfiyfifififi’sfiNfiwsfiUfifivfifisfifiy. 

nfiwsu.org/fioursfis/fidjunfifi-fifirfiifififififi 

Rfiynolds Cfinfifir for Businfiss Journfilism 

Mfififififififisfififififififififififififififififififififififififififififisfififi 

fifififififiyfiwhfifiwfififififififififififififififififibfisfififissfififififi 

fifififififififififififishfifififififififififififisfififififififihfififififififissfis.fi 

VfisfifififihfifiDfifififififiW.fiRfiyfifififisfiNfifififififififiCfifififififi 

fifififiBfisfififissfiJfififififififisfifiwfibsfififififififififififi 

fifiwfifififififibfififibfisfififissfibfisfifisfihfififibfifik,fi 

fififififififififivfifififisfififififififififi. 

businfissjournfilism.org 

fironkififi.fisu.fidu




Student Awards 

Cronkite students win 100-plus awards 

in national and regional competitions 

Cronkite students collected major awards for 

their reporting, videography, photography and 

digital skills during the past year: 

Pulitzer Prize in in Explanatory Reporting 

These six Cronkite students were part of a 

team at The Arizona Republic that won the 

2018 Pulitzer Prize in Explanatory Reporting. 

They helped map every mile of the 

U.S.-Mexico border and provided 

research support for the 

USA Today Network project, 

“The Wall.” 

• Okechi Apakama 

• Nicole Gimpl 

• Robert Gundran 

• Ryan Santistevan 

• Brendan Walker 

• Gregory Walsh 

Pulitzer Prize 

“The Wall” 

cronkite.asu.edu

SABEW’s Best in Business 

fififififififififiwfifififififififififififififififififififififififififififififififi 

AmfififififififiBfifififififififiEfififififififififififiWfifififififififi 

BfififififififiBfifififififififififififififififififififififififi 

fififififififififififififififififififififixfifififififififififififififififififififififi 

fifififififififififififiAfifizfifififififififififififififififififififififimfifi. 

The Webby Awards 

TfififiCfififififififi-KfifififififiNfiwfi21fi“Tfififibfifififi 

Wfifififi”fifififififififififififififififififififiWfibbfififififififififififififififififi 

FfifimfififififiVfifififi:fiPfibfifififififififififififififififififififi,fififififififi 

wfifififiCNN,fiTfififiGfififififififi,fiNfifififififififiGfifififififififififi 

fifififiTfififiMfifififififififiPfifijfififi. 

BEA Festival of Media Arts 

fifififififififififififikfififimfifi11fifiwfifififi,fifififififififififififi 

fifififififiwfififififi,fifififififififiBfififififififififiEfifififififififififi 

Afifififififififififi’fifiFfififififififififififiMfififififiAfififififi 

fifimfifififififififi,fimfififififififififififififififififififififififififififi 

fififififififififififififi.fi 

Rocky Mountain Emmys 

fififififififififiwfififimfifififififififififififiPfifififififififififi 

AwfififififififififififififififikfifiMfifififififififiEmmfifififififififi 

fifififififififififififififififififififififififififififififififi,fififififififififififififififi 

fififififififi14fifififififibfifififiwfifififi. 

Native American Journalists Association 

Media Awards 

NfiwfiMfifififififififififififififififififififiEfifififififififififififififififi 

Lfibfififififififififififififikfififififififififififififififififififififififififififi 

Cfifififififififi–fiTVfififififififififififififififififififififififififififi-fifififififififi 

fixfififififififififififififififififififi360-fifififififififififififififififi 

fififiwfifififififififififififififififififififififififififiPfififififixfifififififififi 

fifififififi. 

IRE Awards 

Cfififififififi-KfifififififiNfiwfi21’fifi“TfififibfifififiWfifififi”fi 

fifififififififififififififififififififififi“Hfifikfifififix:fiFfifimfi 

PfififififififififififififififiAfifififififififi”fififififimfifififififififi 

fififififififififififififififififififififififififififififififififififififififififififififi 

&fiEfififififififiAwfifififififififififififififififififififififififififififi–fifi 

Lfififififififififififififi. 

Data Journalism Awards 2018 Shortlist 

fifififififififiAfififififiPfifififififififififififififififififixfifififififififififi 

fifififififififififififififififififififififififififiYfififififiDfififififi 

JfififififififififififififififififiYfifififififififififififiwfifikfifififififififi 

Cfififififififi-KfifififififiNfiwfi21fifififijfifififi“Tfififibfifififi 

Wfifififi.” 

cronkite.asu.edu




New Faculty 

The Cronkite School welcomes 

these new faculty: 

Karen Bordeleau 

The former executive editor of 

The Providence Journal in Rhode Island 

is the Edith Kinney Gaylord Visiting 

Professor in Journalism Ethics. 

Syed Ali Hussain 

A Fulbright Scholar who has led 

communications campaigns for major 

nonprofits, Hussain is an assistant 

professor of audience engagement and 

analytics. 

Kathy Kudravi 

Kudravi, who has led news 

teams at ESPN and CNN, is the executive editor 

of the Sports Knowledge Lab, a new international 

sports research and knowledge hub at the school. 

cronkite.asu.edu

Jacob Nelson 

An award-winning scholar in audience 

behavior, engagement and analytics, Nelson 

is an assistant professor of audience 

engagement and analytics. 

Mi-Ai Parrish 

The former publisher of The Arizona 

Republic joins the Cronkite School as the 

inaugural Sue Clark-Johnson Professor in 

Media Innovation and Leadership. 

Walter V. Robinson 

The investigative journalist who led The Boston 

Globe’s Pulitzer Prize-winning Spotlight team 

is back as the Donald W. Reynolds Visiting 

Professor of Business Journalism. 

Tracy Wahl 

The former 

NPR executive producer is enhancing 

and expanding coverage of sustainability 

issues as executive editor of the Regional 

Journalism Collaboration for Sustainability. 

cronkite.asu.edu

172 






Risk Division 


ComSHER Top Papers 


Kajsa Dalrymple, Iowa 

In the Crosshairs: The Perils of Environmental Journalism 

Eric Freedman, Michigan State 

Exploring Public Perception of Depression: The Interplay 

Between Attribution of Cause and Narrative Persuasion 

Nanlan Zhang and Taylor Jing Wen, South Carolina 

Social Media and Concerns about Global Climate 

Change: News Use and Political Ideology 

in 20 Countries 

Trevor Diehl, Brigitte Huber, 

Homero Gil de Zúñiga, University of Vienna 


The Role of Counterfactual Thinking in Narrative 

Persuasion: Its Impact on Patients’ Adherence to 

Treatment Regimen 

Timothy Fung, Hong Kong Baptist University 

Parachuting into a Hurricane: Twitter Interactions 

between Government Entities and the Public During 

Hurricane Irma 

Jeremy Shermak, Texas at Austin 




Best of CT&M 


Jennifer Hoewe, Purdue 

Journalism History, Web Archives, and New Methods 

for Understanding the Evolution of Digital Journalism* 

Matthew Weber, Rutgers and Phil Napoli, Duke 

Expression and the Political Self: How Political 

Expression on Social Media Can Strengthen Political 

Self-concepts** 

Daniel Lane, Slgi Lee, Fan Liang, Dam Hee Kim, 

Liwei Shen, Brian Weeks and Nojin Kwak, Michigan 

The Effects of Modality, English Language Proficiency, 

and Length of Stay on Immigrants’ Learning from 

American News About Politics*** 

Yulia Medvedeva, Zayed 

and Glenn Leshner, Oklahoma 

Emotional Flow and Order Effects: Anger, Compassion 

and Moderating Effects of Perceived Interest**** 

Hang Lu, Cornell 

Discussant 

Wayne Wanta, Florida 

* First Place Faculty Paper; Top Method Paper 


*** Top Theory Paper 

**** First Place Student Paper 




Gender and Sexuality in a Changing 

Media Environment 



The Symbolic Annihilation of Wendy Davis in the 2014 

Texas Gubernatorial Election** 

Jordon Brown, Texas State 

Imagining the Other: Transnational Documentaries & 

the Politics of Sexuality* 

Shehram Mokhtar, Oregon 

“Without Women There Is No Revolution:” A Feminist 

CDA of Ni Una Menos’s Twitter Communications 

Ayleen Cabas, Missouri 

Resilience, Positive Psychology, and Subjectivity in 

K-pop Female Idols: Evolution of Girls’ Generation from 

“Into the New World” (2007) to “All Night” (2017)*** 

Gooyong Kim, Cheyney University of Pennsylvania 

Discussant 

Ana Garner, Marquette 

* Top Student Paper, First Place 

** Top Student Paper, Second Place 

*** Top Faculty Paper, Third Place 

5:15 to 6:45 p.m. / W085 Congressional Hall C 



History Division High-Density Session 


Cayce Myers, Virginia Tech


173 



Winning Women’s Votes: Dotty Lynch and the Gender 

Gap in American Politics, 1972-1984* 


The Delphian Society and Its Publications: A Historical 

and Cultural Analysis of a Primer for Middle-Class 

Women’s Education 

Sheila Webb, Western Washington 

Pulpit and Press Pioneer: Samuel E. Cornish, the 

Minister, Before Founding Freedom’s Journal 

Kenneth Campbell, South Carolina 

Discussant 

Lisa Burns, Quinnipiac 

Panelists: 

Donald Shaw, North Carolina 

David Weaver, Indiana 

Salma Ghanem, DePaul 

Sharon Meraz, Illinois at Chicago 

Wayne Wanta, Florida 

5:15 to 6:45 p.m. / W087 City Tap Penn Quarter 


Off-site Public Relations Graduate Student Happy Hour 

“We Matter”: The Launching of a Counter-Narrative 

Black Public Affairs Program in Columbia, S.C.** 

Kelli Boling, South Carolina 

Elmer Davis and His Anti-McCarthyism Broadcasts 

on ABC Radio 

Ray Begovich, Franklin College 

“Your Paper Saved Seattle”: E.W. Scripps, a Man 

of Contradictions, Responds to the Star’s Coverage 

of the General Strike of 1919 


Discussant 

William (Bill) Davie, Louisiana at Lafayette 

(Re)covering Disabled Veterans in Civil War 

Newspapers: Creating Heroic Disability 

Ronald J. Zboray 

and Mary Saracino Zboray, Pittsburgh 

Constructing (“Typhoid”) Mary Mallon: How Public 

Health and Journalism Criminalized the Healthy Carrier 

Katie Foss, Middle Tennessee State 

The Rationales for Public Relations: The Engineering 

of Human Interactions 

Burton St. John, Old Dominion 

Hosting 


and Tyler Page, Mississippi 

Meet at City Tap Penn Quarter at 901 9th Street NW. 




Panel of Professionals 


Phil Loubere, Middle Tennessee State 

Discussants 

Javier Zarracina, graphics editor, Vox 

Chiqui Estaban, graphics director, Washington Post 

Monica Serrano, senior graphics editor, National 

Geographic 

Alberto Quadra, managing editor for graphics, 

Science Magazine 

Wednesday 

Discussant 

Thomas Bivins, Oregon 

* Third-Place Faculty Paper 

** Third-Place Student Paper 





50 Years of Agenda Setting 


Chris Vargo, Colorado 




Functions and Goals of Community/ 

Local Journalism 


Monica Chadha, Arizona State 

Bringing the Community to Journalism: A Comparative 

Analysis of Hearken-Driven and Traditional News at 

Four NPR Stations* 

Mark Poepsel, Southern Illinois, Edwardsville 

and Jennifer Cox, Salisbury

174 




Exploring Options to Build Trust Between Journalists 

and Audiences in Collegiate Community Journalism 

Education 

Melanie Wilderman, Oklahoma 

Assessing Local Journalism: News Deserts, Journalism 

Divides, and the Determinants 

of the Robustness of Local News 

Phil Napoli, Duke; Matthew Weber, Rutgers; 

Katie McCullough, Augustana 

and Qun Wang, Rutgers 

Pursuing Civic Capital: Journalistic, Economic 

and Political Goals at a City Magazine 


Discussant 

Marcus Funk, Sam Houston State 

* First-Place Faculty Paper 




Top Papers in Entertainment Studies Interest Group 


Gwen Nisbet, North Texas 

Binge-Watching as a Predictor of Narrative Transportation* 

Stephen Warren, Massachusetts-Amherst 

Pervasive Pokémon: Location-Based Augmented Reality 

Game Enjoyment and Place Attachment** 

Shaojung Sharon Wang 

and Chih-Ting Hsieh, National Sun Yat-sen University 

Reading Between the Lines: A Content Analysis 

of Vinyl Records’ Run-out Groove Etchings*** 

Waleed Rashidi, California State, Fullerton 

Exploring Character Development as a Central Mechanism 

in Viewer Responses to Morally Ambiguous Characters 

Serena Daalmans 

and Mariska Kleemans, Radbound University 

Allison Eden, Michigan State; 

and Addy Weijers, Radboud University 

Discussant 

Gregory Adamo, Morgan State 

* First Place Paper 

** Second Place Paper 

*** Third Place Paper 




Connecting Social Media Platforms with 

the Real World 


Burton Speakman, Kennesaw State 

Score! How Female Hockey Players Around 

the World Score More Likes on Instagram 

Tanja Eisenschmid, North Dakota 

How Motives for Political Information Seeking 

Online Influence Political Discussion Offline 

Sangwon Lee, Wisconsin-Madison 

Risky Business: A Case Study of a Leader’s Framing 

of News Coverage of Organizational Risk-Taking 

Josh Watson, Oklahoma 

Enjoying Crime: Examining Disposition Theory 

in the True Crime Podcast Audience 

Kelli Boling, South Carolina 

Discussant 



Lesbian, Gay, Bisexual, Transgender and Queer 

Interest Group 


LGBTQ IG Top Paper Session 


Robert (Robby) Byrd, Memphis 

The Rise of Transgender and Gender Non-Conforming 

Representation in the Media: Impacts on the Population 

Robyn King 

and Richard Mocarski, Nebraska at Kearney; 

Natalie Holt, Nebraska-Lincoln; 

William (Sim) Butler, Alabama; 

Debra Hope, Nebraska Lincoln; 

Heather Meyer, Kansas; 

and Nathan Woodruff, Trans Collaborations 

No Men in Women’s Bathrooms: Encoding/Decoding 

in Activist Strategic Communication 


Media Representation of Transgender Civil Rights Issues: 

A Quantitative Content Analysis on Media Coverage of 

the “Bathroom Bill” Controversy 

Minjie Li, Louisiana State


175 



The Digital Couch: The Therapeutic Potential of a “Gay 

Hookup App 

Robert Huesca, Trinity 

Discussant 

Joseph Cabosky, North Carolina at Chapel Hill 

5:15 to 6:45 p.m. / W093 Congressional Hall A 

7 to 8:30 p.m. / W096 Meeting Room 02 






Online News Association 

Social 

Challenge Fund for Innovation in Journalism 

Education 

Hosting 

Jennifer Mizgata, Online News Association 

Join the Online News Association as we toast the newest 

winners of the Challenge Fund for Innovation in 

Journalism Education. The goal of the $1M Challenge 

Fund for Innovation in Journalism Education is to hack 

the journalism curriculum using customized versions 

of the teaching hospital model. The fund supports universities 

with micro-grants of up to $35,000 to partner 

with local news organizations and explore new ways of 

providing information to their communities. Learn more: 

https://journalists.org/programs/challenge-fund/ 

7 to 8:30 p.m. / W094 Meeting Rooms 12-13 






Madeline Esch, Salve Regina 

7 to 8:30 p.m. / W098 Mount Vernon A 






Wednesday 





Kelty Logan, Colorado 

7 to 8:30 p.m. / W095 Mount Vernon B 


Risk Division 




Sol Hart, Michigan 






Julian Kilker, Nevada, Las Vegas; 


and Gabriel Tait, Arkansas State 






Michael Clay Carey, Samford

176 









Gwen Nisbett, North Texas 












Erica Clarke Tachoir, Pennsylvania State, 

Greater Allegheny 


Lesbian, Gay, Bisexual, Transgender and Queer Interest 

Group 




Joe Cabosky, North Carolina at Chapel Hill 



7 to 8:30 p.m. / W106 Renaissance Ballroom West A 

Greenlee School of Journalism and Communication, 

Iowa State University; Reed College of Media, West 

Virginia University and Texas Tech University College 

of Media and Communication 

Social 

Hosting 

Angela Powers, Iowa State; 

Maryanne Reed, West Virginia 

and David Perlmutter, Texas Tech 

7 to 8:30 p.m. / W107 Renaissance Ballroom West B 

Klein College of Media and Communication Temple 

University 

Social 

Hosting 

David Boardman, dean, Klein 

7 to 8:30 p.m. / W108 Acadiana 

S.I. Newhouse School of Public Communications 

Syracuse University 


Hosting 

Lorraine Branham, dean, Newhouse School 

of Public Communications, Syracuse 

Social to be held at Acadiana, 901 New York Ave., NW. 

8:30 p.m. to 11 p.m. / W109 Renaissance Ballroom 

East 

University of Missouri School of Journalism 

Social 

Hosting 

David Kurpius, dean, Missouri School of Journalism 





and Greg Perreault, Appalachian State


177 



8:45 to 10:15 p.m. / W110 City Tap House Penn 

Quarter 


Off-site Divisional Social 

Hosting 

Washington Media Scholars Foundation, 

Washington, DC; 


Members will walk together from the business meeting to 

City Tap House, which is one block from the conference 

hotel, 901 9th Street, NW Washington, DC 20001. 

8:45 to 10:15 p.m. / W111 Busboys & Poets 







Edson Tandoc, Nanyang Technological 

University Singapore 

8:45 to 10:15 p.m. / W114 Brasserie Beck 



Hosting 

Michael Clay Carey, Samford 


Divisional Social at Busboys and Poets 

Hosting 

Madeleine Esch, Salve Regina 

Members will walk together from the business meeting to 

Busyboys & Poets, 5th & K, 1025 5th Street, NW. 

Join members of the Community Journalism Interest 

Group at the Brasserie Beck, located at 1101 K Street, 

NW. Attendees may walk over together following the 

members’ meeting. 

Wednesday 

8:45 to 10:15 p.m. / W112 City Tap House 

Penn Station 


and Commission on the Status of Minorities 


Lionel Barrow Scholarship Soiree 

Hosting 


City Tap House Penn Station, 901 9th Street NW. 

Proceeds go to support the Lee Barrow Minority Doctoral 

Scholarship. Pre-registration is required.

Welcome 

New Faculty! 

FALL 2018 

Ioana Coman, Ph.D. 

Assistant Professor – 


Jung Wong Chun 

Visiting Assistant Professor – 


Deborah Davis, Ph.D. 

Assistant Professor of Practice – 


Mary Norman 

Assistant Professor of Practice – 


Hector Rendon Gomez, Ph.D. 

Assistant Professor – 

Journalism & Creative 

Media Industries 

COMING SOON! 

Assistant Professor of Practice 

(Professional Communication) 

COMING SOON! 


(Communication Studies) 

COMING SOON! 


(Health Science Communication) 

comc.ttu.edu/faculty

Our graduates find employment with all 

types of organizations across the nation 

and around the world. Plan a visit to our 

campus located in the foothills of the Great 

Smoky Mountains and experience the 

Volunteer difference for yourself! 

Interdisciplinary 

Master’s & PhD Programs 

Advertising | Communication Studies | Information Sciences 

Journalism & Electronic Media | Public Relations 

World-Class Faculty & State-of-the-Art Facilities 

Adam Brown Social Media 

Command Center 

Nonlinear Digital Video 

Editing Lab 

Converged Newsroom Lab 

Scripps Convergence Lab 

Digital Photo Lab 

Message Effects Lab 

Public Speaking Center 

User Experience Lab 

www.cci.utk.edu 865-974-6651 mpalench@utk.edu

University of Minnesota Hubbard School of Journalism and 

Mass Communication welcomes five new faculty members. 

Matt Carlson 

Mark Jenson 

Regina McCombs 

Amelia Reigstad 

Matthew Weber 

Matt Carlson 

(Ph.D., University of 

Pennsylvania) is an 

Associate Professor in 

Journalism Studies. His 

work examines public 

discourse surrounding 

journalistic norms and 

practices, including how 

individuals and groups 

struggle over the 

definition of what 

journalism is, who is 

a journalist, and what 

direction journalism 

should take. This 

research is highlighted 

in his most recent 

book, Journalistic 

Authority: Legitimizing 

News in the Digital 

Era (Columbia University 

Press, 2017). 

Mark Jenson (M.A., 

Northwestern) is a 

Lecturer in Strategic 

Communication, joining 

HSJMC after 35 years 

of building brands at 

ad agencies in Chicago 

and Minneapolis. He 

has led marketing 

communication 

efforts for an all-star 

list of companies like 

Andersen Windows, 

ConAgra, General Mills, 

Land O’ Lakes, Kraft, 

Pillsbury and Tropicana. 

He most recently served 

as VP-Account Director 

at Preston Kelly in 

Minneapolis. 

Regina McCombs (M.A., 

University of Minnesota) 

is a Lecturer in Visual 

Journalism after working 

at Minnesota Public 

Radio (MPR) as senior 

editor for visual news 

since 2013. Prior to 

that, she was a faculty 

member at the Poynter 

Institute, teaching 

multimedia, mobile and 

social media. McCombs 

has won numerous Best 

of Photojournalism and 

Pictures of the Year 

International awards for 

multimedia storytelling, 

as well as Emmys for 

her video work. 

Amelia Reigstad 

(M.A., University 

of Leicester) is a 

Lecturer in Strategic 

Communication after 

teaching marketing 

communications 

at University of 

Wisconsin, River 

Falls since 2013. She 

developed Crosspoint 

Communications, a 

full-service consultancy 

agency from a 

grassroots level in 2007 

and taught a variety 

of public relations 

and communications 

courses at Kwantlen 

Polytechnic University, 

the University of Victoria 

and the British Columbia 

Institute of Technology. 

Matthew Weber (Ph.D., 

University of Southern 

California) is an 

Associate Professor and 

the Cowles Endowed 

Fellow of Media 

Management. Weber’s 

research examines 

organizational change 

in relation to the use 

of new information 

communication 

technologies, focusing 

specifically on the 

ongoing transformation 

of news media 

industries. Weber’s work 

is supported by funding 

from the National 

Science Foundation, 

the Institute for Museum 

and Library Services, 

the William T. Grant 

Foundation, Democracy 

Fund, and the Knight 

Foundation. 

These new faces join the Hubbard School’s 26 full-time faculty: Colin Agur, Betsy Anderson, Sid Bedingfield, Valerie Belair-Gagnon, 

Elisia Cohen (Director), Diane Cormany, Giovanna Dell’Orto, Kenneth Doyle, Gayle Golden, Kathleen Hansen, 

Jisu Huh (Mithun Endowed Chair & Director of Graduate Studies), Chris Ison (Director of Undergraduate Studies), 

Stacey Kanihan (Academic Director, Professional MA in Strategic Communication), Sherri Jean Katz, Jane Kirtley, Scott Libin, 

Susan LoRusso, Len Mitsch, Rebekah Nagler, Amy O’Connor, Hyejoon Rim, Claire Segijn, Christopher Terry, Benjamin Toff, 

Steve Wehrenberg (Director, Professional MA in Strategic Communication) and Marco Yzer.

Welcome, 

New Endowed Chairs 

Ruby 

Bailey 

Missouri 

Community 

Newspaper 

Management 

Chair 

Kathy 

Kiely 

Lee Hills 

Chair in 

Free-Press 

Studies 

Ruby will work with 

community newspapers 

across Missouri to help 

improve their coverage 

and operations. 

Kathy will work to 

increase ordinary citizens’ 

understanding of the value 

of free expression to 

democratic societies. 

Damon 

Kiesow 

Shuhua 

Zhou 

Knight Chair 

in Digital 

Editing and 

Producing 

Damon will stimulate 

innovations in teaching and 

research on editing. 

Shuhua will develop research 

programs and educate 

communities through local 

broadcast stations. 

Leonard H. 

Goldenson 

Endowed 

Chair in 

Radio and 

Television 

Journalism 

Journalism.missouri.edu 

/mujschool @mujschool /mujschool

On the move 

with the Mayborn 

Talented and award-winning faculty 

With focus on print & digital news, broadcast, 

photojournalism, advertising and public relations, our 

world-class faculty brings many hundreds of years of 

experience to the classroom every day. 

Thorne Anderson 

Mayborn Endowed 

Chair 

Todd Bennett 

Visiting Lecturer, 

Photojournalism 

Dr. Sheri Broyles 

Scripps-Howard 

National Teacher 

of the Year 

Our nationally renowned Mayborn Literary Nonfiction 

Conference keeps the focus on storytelling, bringing 

together the nation’s top writers, journalists, agents and 

authors – providing our students the passion to excel. 

Ready to move yourself to the forefront of journalism? 

Move ahead with the Mayborn. Follow our momentum 

throughout the year or check out our industry-leading 

academic programs. 

Connect with the Mayborn today: 

@MaybornUNT 

Jacqueline Fellows 

Visiting Lecturer, 

Broadcast/Digital 

Kim Keller 

Lecturer, Public 

Relations 

Dr. Newly Paul 

Assistant Professor, 

Digital/Print 

The Frank W. and Sue Mayborn School of Journalism 

and the Frank W. Mayborn Graduate Institute of 

Journalism are in motion – working hard to prepare 

more than 1,200 students for the demands of today’s 

fast-changing world of journalism. 

@MaybornUNT 

@Mayborn.UNT 

For more information, call 940.565.2205 

or visit www.journalism.unt.edu. 

Your Story Starts Here 

The Frank W. and Sue Mayborn School of Journalism is fully accredited by the ACEJMC. The Frank W. Mayborn Graduate Institute of Journalism is the only professionally accredited 

master’s program in a four-state region.

Thursday Sessions 

185 



7 am to 9 a.m. / R001 Congressional Hall C 




2018-19 Council of Divisions Meeting 


Heloiza Herscovitz, California State-Long Beach, 

Council of Divisions Chair 

7 am to 8 a.m. / R002 Meeting Room 02 

Korean American Communication Association 

Business/Research Paper Session 

Executive Committee Meeting/Research 

Paper Session 


Gi Woong Yun, Nevada-Reno 

Eye-Catching and Unforgettable: The Role of Ad 

Creativity in Online Video Ads Featuring Augmented 

Reality Technology 

Yang Feng, San Diego State and Quan Xie, Bradley 

Effects of Visual Strategies and Personal Relevance on 

Young Users’ Responses to Brand Content on Instagram 

Lijie Zhou, Southern Utah 

and Fei Xue, Southern Mississippi 

Healthy Living and The Companies That Pay for It: 

A Qualitative Exploration of Health Native Advertising 

on BuzzFeed and the Huffington Post 

Chris Noland, Jo-Yun Queenie Li 

and Taylor Jing Wen, South Carolina 

Examining the Personality Traits and Motives That 

Predict Attitudes Toward and Engagement with Sponsored 

Content in Snapchat 

Tiany Sousa and William Kinnally, Central Florida 

Discussant 

Karen Mallia, South Carolina 

9:15 to 10:45 a.m. / R004 Mount Vernon A 

Social Media Posts on Samsung Galaxy Note 7 

Explosion: A Content Analysis of Framing 

and Sentiments in the U.S, Australia, and South Korea 

Seok Kang, Texas at San Antonio; 

KyuJin Shim, Melbourne, and Jiyoun Kim, Maryland 

Social Media as a Platform for Alternative Framing: 

Exploring the #Metoo Movement in South Korea 

and the United States 

Soo Young Bae, Massachusetts-Amherst 

The Tipping Point: A Comparative Study of U.S. 

and Korean Social Media Users on Decisions 

to Switch to New Platforms 

Klive (Soo-Kwang) Oh, Pepperdine; 

Seoyeon Hong, Rowan, 

and Hee Sun Park, Korea 

The Korean Wave, How This Was Possible?: A Macro 

Approach Explaining the Causes of the Legend 

Shin Dong Kim, Hallym University 




Practical, Theoretical and Ethical Challenges 

and Strategies of Teaching Digital Analytics 


YoungAh Lee, Ball State 

Panelists 

Itai Himelboim, Georgia 

Lance Porter, Louisiana State 

Robin Blom, Ball State 

Laeeq Khan, Ohio 

9:15 to 10:45 a.m. / R005 Meeting Room 15 

Thursday 

9:15 to 10:45 a.m. / R003 Mount Vernon B 



Creative Content in the Worlds of Online 

and Social Media 


Scott Hamula, Ithaca 



Media in Mental and Physical Health 


Daniel Sude, Ohio State 

Media Use and Depression in the General Population: 

Evidence for a Non-Linear Relationship* 

Sebastian Scherr, University of Leuven

186 




News and Informational Media Usage, and Vaccination 

Behaviors: The Mediating Role of Perceived Vaccine 

Efficacy and Perceived Vaccine Safety 

Juwon Hwang, Wisconsin-Madison 

Does Natural Mean Healthy? How Natural Label 

Contributes to Nutritional Self-Betrayal Among Health- 

Conscious Consumers 

Donghee Lee, Florida 

The Secret Parents and Health Campaigners Want to 

Know: How Social Appeals Influence the Information 

Processing of Healthy Foods 

Lelia Samson and Moniek Buijzen, Radboud 

Discussant 


* Third Place Faculty Paper 

Jenn McKay, Virginia Tech 

Toni Albertson, Mt. San Antonio 




Training Session 

Incoming Heads 


Heloiza Herscovitz, chair, Council of Divisions; 


Mohammed Al-Azdee, Bridgeport 



AEJMC Council of Affiliates (College Media Association) 


Issues Facing the Campus Press 



The Trump Effect on Modern Political Discourse: 

A Case Study 

Brittany Fleming, Mark Zeltner 

and Cody Nespor, Slippery Rock 

Posting, Tweeting, Instagramming: Examining the Social 

Media Linking College Media to Home 

Carol Terracina-Hartman, Lock Haven 

and Robert G. Nulph, Missouri Western 


Community College Journalism 

Association and Magazine Media Division 


10 Ways to Teach Students How to Engage 

and Impact Their Audience 



Panelists 

Carrie Brown Smith, City University of New York 

Ed Madison, Oregon 

Brian Steffan, Simpson 





Professional Freedom & Responsibility Chairs 


Dean Kruckeberg, North Carolina-Charlotte 

9:15 to 10:45 a.m. / R010 Congressional Hall C 




Vice Heads (Program Chairs) 


Katie Foss, vice chair, Council of Divisions, 


Phil Loubere, Middle Tennessee State 

John Wirtz, Illinois at Urbana-Champaign 





Research Chairs 


Richard D. Waters, San Francisco

A new generation 

of great thinkers 

CMCI’s faculty–leading scholars 

and industry experts from across 

the fields of media, communication 

and information–bring 

an interdisciplinary, hands-on 

approach to teaching. 

Incoming CMCI 2018–19 faculty 

CMCI 

Roshanna Sylvester 

Scholar in Residence | PhD, Yale University 

Advertising, Public Relations and Media Design 

Krishnamurthy Sriramesh 

Professor | PhD, University of Maryland, College Park 

Burton St. John III 

Professor | PhD, St. Louis University 

Michael Stoner 

Visiting Professor | AB, Kenyon College 

Critical Media Practices 

Jorge Perez-Gallego 

Scholar in Residence | PhD, University of 

Florida, Gainesville 

Teri Rueb 

Professor | DDes, Harvard University 

Graduate School of Design 

Information Science 

Robin Burke 

Professor | PhD, Northwestern University 

Jason Zietz 

Instructor | PhD (expected 2018), 

University of Colorado Boulder 

Journalism 

Jared Browsh 

Scholar in Residence | PhD, University of 

Colorado Boulder 

Chuck Plunkett 

Instructor | MFA, University of Pittsburgh 

University of Colorado Boulder

188 








Teaching Chairs 


Amanda Sturgill, Elon 


International Association for Literary Journalism Studies 

Research Panel Session I 

Literary Journalism and Truth: Odd Bedfellows 


Holly E. Schreiber, Maine 

Panelists 

What Do We Mean When We Talk about Truth? 

Lindsay Morton, Avondale College of Higher 

Education, Australia 

Ethical and Methodological Transparency 

in Literary Journalism 

Bruce Gillespie, Wilfrid Laurier University, 

Canada 

Transparency and Truth in Literary Journalism 

Patrick Walters, Kutztown 

“The Superman of Their Texts”: The Unreliable 

Narrator in Literary Journalism 

Rachael Hanel, Minnesota State, Mankato 

This session explores the position of literary journalism 

in a “post-truth” era. Panelists engage the topic from 

theoretical, professional, and pedagogical perspectives. 

10:45 a.m. to 4 p.m. / R014 Penn Quarter 




AEJMC Board of Directors 



2018-19 AEJMC President 

11 a.m. to 12:30 p.m. / R015 Meeting Room 15 

Communicating Science, Environmental Health 

Risk Division 


Unspoken Issues in Health Communication 


Jeanine Guidry, Virginia Commonwealth 

We Drink So We Are: Effects of Perceived Similarity 

with a Drinker on Observational Learning 

Mira Mayrhofer and Jörg Matthes, Vienna 

Smart Device Proficiency and Use, Loneliness, and Ego 

Integrity: An Examination of Older Adult Smartphone 

Users in South Korea 

Kisun Kim, Bowling Green State; 

Sung-Yeon Park, Nevada, Reno, 

and Hyung-Cheol Kang, Sookmyung Women’s 

University 

Spotlight on Suicide: A Content Analysis of Online 

News Coverageof Celebrity Suicide Death, 2012-2017 

Susan LoRusso, Minnesota 

Breaking the Silence: Extending Theory to Address the 

Underutilization of Mental Health Services Among 

Chinese Immigrants in the United States 

Jo-Yun Queenie Li, South Carolina 

The Effects of Media-Induced Nostalgia After a Celebrity 

Death on Social Sharing and Prosocial Behavior 

Jessica Myrick, Pennsylvania State 

and Jessica Willoughby, Washington State 

11 a.m. to 12:30 p.m. / R016 Mount Vernon A 




Displaced and Marginalized: The Implications 

of Digital Literacy, Digital Technology and Social 

Media Use by Immigrants and Refugees 


Hee Jun Kim, diplomatic correspondent 

to Washington D.C. for YTN 

Panelists 

Social Media and Digital Technology in the 

Acculturation of Minorities 

Dilshad Dayani, Columbia 

Social Adjustment as the Effects of Increasing 

Digital Technology Use and Digital Literacy 

Hong Vu, Kansas

Partnering 

with pros 

Chuck Plunkett, who holds 

an MFA in creative writing, 

sits beside a statue of Robert 

Frost on CU Boulder’s campus. 

Plunkett will bring decades 

of newsroom experience to CU 

News Corps as its new director. 

CU News Corps, an investigative and explanatory student news 

program in the Department of Journalism at CMCI, is expanding to 

become the capstone course for all undergraduate journalism students 

and a required course for master’s students. Incoming CU News 

Corps Director Chuck Plunkett, the former editorial page editor of The 

Denver Post, brings decades of newsroom experience to the practicebased 

course. Plunkett resigned after an executive refused to approve 

an editorial critical of hedge-fund owner Alden Global Capital and amid 

rumors of further cuts to the already bare-bones staff. 

The course focuses on in-depth reporting projects in partnerships with 

regional media outlets. Students have worked with The Denver Post, 

9News, Public News Service and a local PBS affiliate to report on 

topics including politics, crime and the opioid crisis. 

CU News Corps is supported by Bill and Kathy Scripps, who 

established a $2.5 million endowment for the program in 2017. The 

program began in 2012 as a small team of students reporting on 

breaking news and working with local media. 


190 




Evaluations of Existing Programs Offered by NGOs 

in the Area of Immigrants’ Post-settlement and 

Recommendations for Media Literacy and 

Technology Education for Immigrants 

Bridget Weisenreder, Resources Development 

Manager for African Community Center, DC 

Metro at Ethiopian Community Development Center 

Trends in News Media and Social Media Use 

Among Immigrants in the U.S. 

Michael Barthel, Research Associate at Pew 

Research Center 

How Children of Immigrants Become Brokers 

of Digital Technology, Language, and Popular 

Culture in Immigrant Families 

Vikki Katz, Rutgers 

Discussant 

Hyunjin Seo, Kansas 




Shifting Trends in Association Media: Insights 

from D.C.-Based Experts 


Catherine M. Straub, Drake 

Panelists 

Joe Vallina, Association Media & Publishing 

José Sueiro, National Association of Hispanic 

Publications 

Beth Mirza, Society for Human Resource 

Management 

Andrew Peeling, Society for Human Resource 

Management 

Mary Warner, Academy of Pharmacy Practice and 

Management 

Julie Shoop, VP, American Society of Association 

Executives 


Media Ethics 



10 Cool Ideas You Can Use RIGHT NOW to Teach 

Ethics, Fake News (and Maybe Even Organize 

Your Life) 


Jan Leach, Kent State 

Panelists: 

Alyssa Appelman, Northern Kentucky 

Christina Smith, Georgia College 

Katy Bartzen Culver, Wisconsin-Madison 

Nicole Kraft, Ohio State 





Audience Engagement Strategies for Television 

and Social Media 


Marcus Funk, Sam Houston State 

Examining Cord-Cutting Media Consumers: Usage, 

Perceptions, Motivations, and Segments 

Hun Kim, Sungkyunkwan University; 

Kyung-Ho Hwang, Kyungnam University; 

Sylvia Chan-Olmsted, Florida; 

and Byeng-Hee Chang, Sungkyunkwan University 

Comparing Online and Offline Media Engagement: A 

Triangular Measurement Approach 

Lisa-Charlotte Wolter, Florida/Hamburg Media 

School 

and Sylvia Chan-Olmsted, Florida, 

and Daniel McDuff, Microsoft 

The Digital Linchpin for Mobile Startup? Exploring the 

Social Media Knowledge and Managerial Skills 

of Mobile Entrepreneurs 

Gejun Huang, Wenhong Chen, 

and Bryan Stephens, Texas at Austin 

Discussant 

Mike Wirth, Tennessee-Knoxville 

11 a.m. to 12:30 p.m. / R020 Congressional Hall C 


and Community Journalism Interest Group 


Journalists in the Hot Seat: Staying Safe 

in a Hostile Political Climate 


Dianne Bragg, Alabama

Journalism 

entrepreneurship 

MA means business 

The new online MA degree offers 

students the flexibility to work 

remotely while gaining print and 

multimedia skills for careers 

at media outlets and in the 

freelance market. 

The new online MA prepares beginning and veteran journalists to 

thrive in a rapidly changing media industry, in which both business and 

journalism skills are essential. The program offers: 

• Online format 

• A flexible degree that can be earned in as little as one year 

• Tools to navigate the ins and outs of a successful freelance career 

• Classes on the freelance market, current trends in journalism markets, data 

journalism, coding, video newsgathering, multimedia storytelling and more 

Join us in the Department of Journalism at the College of Media, 

Communication and Information where, in addition to this online 

MA program, students may pursue a residency-based MA and a 

journalism studies PhD. 

Learn more and apply: colorado.edu/cmci/journalism/ma-entrepreneurship 


192 




Panelists: 

Al Cross, director, Institute for Rural Journalism 

and Community Issues 

Christi Parsons, White House reporter, Los Angeles 

Times and Chicago Tribune 

Leslie-Jean Thornton, Arizona State 

Mike Dorning, deputy White House editor, 

Bloomberg News 

Will Fitzgibbon, senior reporter, International 

Consortium of Investigative Journalists 

11 a.m. to 12:30 p.m. / R021 Mount Vernon B 


and Small Programs Interest Group 


The University Student-Run Public Relations 

Agency: Opportunities and Challenges 

for Academic Programs Large and Small 


Doug Swanson, California State, Fullerton 

Panelists 

John Hanc, New York Institute of Technology 

Carolyn Mae Kim, Biola 

Jeffrey Ranta, Coastal Carolina 

Janet Rose, Kansas 

Jason M. Shepard, California State, Fullerton 

Amy Struthers, Nebraska-Lincoln 





Teaching Code: Is it Still Relevant? 



Panelists: 

Bartosz Wojdynski, Georgia 

Jennifer George-Palilonis, Ball State 

Terence Oliver, North Carolina at Chapel Hill 

Byung Lee, Elon 


Yvonne Houy, Explore Learn Inspire 





Votes for Women: The Role of the Press 

in the Struggle for Suffrage 



Panelists: 

Jinx C. Broussard, Louisiana State 


Teri Finneman, Kansas 

Melony Shemberger, Murray State 




Film Audiences, Film Politics, Women and Gaming, 

and Out-Athletes 


Stephanie Schartel Dunn, Missouri Southern State 

Certified Fresh: Rotten Tomatoes, Gratifications, 

and Motivations for Cinema Attendance 


and Lindsey Maxwell, Southern Mississippi 

What Does it Mean to Be a Woman in “Indie” Game 

Storytelling? Narrative Framing in Independently- 

Developed Video Games 

Mimi Perreault, Andrea Suarez 

and Gregory Perreault, Appalachian 

Learning Politics from Political Films: Exploring the 

Effects of Fictional Political Entertainment 

Azmat Rasul, Valdosta State 

Out in Play: Openly Gay Athletes Navigate Media, 

Celebrity and Fandom 

Leigh Moscowitz, South Carolina 

and Andrew Billings, Alabama 

Discussant 

Jason Zenor, SUNY-Oswego

Another 25 years 

of environmental 

journalism 

Center for Environmental 

Journalism faculty and students 

have traveled as far away as 

Svalbard, Norway, in the high 

Arctic to report on important 

environmental issues. 

Last year the Center for Environmental Journalism celebrated its 25th 

anniversary, as well as the 20-year anniversary of the center’s Ted 

Scripps Fellowships in Environmental Journalism. Established in 1992, 

the CEJ enriches public understanding of environmental issues by 

elevating the quality, range and depth of coverage by journalists. 

The Ted Scripps Fellowships in Environmental Journalism have 

equipped more than 100 journalists with new knowledge and skills to 

help improve public knowledge of issues that affect our planet, our 

lives and our future. With generous support from the Scripps Howard 

Foundation, the CEJ is laying the groundwork for the next 25 years of 

vital environmental journalism. 

2018–19 Ted Scripps Fellows 

in Environmental Journalism 

Peter Brannen 

Chris Lett 

Stephen R. Miller 

Hillary Rosner 

Elizabeth Royte 


194 







Contemporary Issues in Religion and Media 



No Compassion for Muslims? How Terrorism News 

About Muslim Victims Influence Emotions and Policy 

Support 

Desiree Schmuck, Jörg Matthes 

and Christian von Sikorski, University of Vienna 

A Multi-method Approach to Examining Online Sermons 

from Religious Organizations 

Jordan Morehouse 

and Daniel Riffe, North Carolina at Chapel Hill 

Religion and the Media: A Study of Student Perception 

of Media Bias in Georgia 

Elizabeth Johnson-Young 

and Alexander Clegg, Washington 

and John Guidon, University of Mary Washington 

Framing the Death of Cardinal Law 

Giselle A. Auger, Rhode Island College 


International Association for Literary Journalism Studies 

Research Panel Session II 

Literary Journalism and Truth: Odd Bedfellows 


Lindsay Morton, Avondale College of Higher 

Education, Australia 

Panelists 

From Cinema-Verité to Movie Documentary: 

Instances of Literary Journalism on the Big Screen 

Isabel Soares, CAPP, ISCSP, Universidade de 

Lisboa, Portugal 

and Pedro Lopes, ISCTE-IUL, ISTAR-IUL, Portugal 

When a Picture is with 1,000 Words: Truth Claims of 

the New Digital Literary Journalism 

Jacqueline Marino, Kent State 

and Susan Jacobson, Florida International 

That Dangerous Appeal: How a Man Fooled a Dozen 

Journalists with an Improbable Story and Why They 

Fell for It 

Gonzalo Saavedra Vergara, Pontificia 

Universidad Católica de Chile 

All Pain is Anecdotal 

Ronald R. Rodgers, Florida 

12:45 to 2:15 p.m. / R027 Congressional Hall C 

Communicating Science, Health, Environment and Risk 

and International Communication Divisions 


Communicating Environment, Health, and Science 

Related Risks Across Sociocultural Contexts 


Timothy Fung, Hong Kong Baptist 

Panelists 

Dominique Brossard, Wisconsin 

Jianbin Jin, Tsinghua University, Beijing 


Francesca Dillman Carpentier, North Carolina 


12:45 to 2:15 p.m. / R028 Mount Vernon A 



The Future of Journalism in a Shifting Global Era 


Loren Coleman, Southern Mississippi 

The End of Ombudsmen? 21st-Century Journalism 

and Reader Representatives 

Patrick Ferrucci, Colorado-Boulder 

Taxi Drivers as Reporters: Studying the Distinctive 

Journalism of the UTCC Voice Newsletter 

Krishnan Vasudevan, Maryland 

Democratizing Online Journalism Labor: Freelance 

Journalists’ International Battles Over Digital Rights 

Errol Salamon, Pennsylvania 

The Discipline-Autonomy Paradox: How Journalism 

Textbooks Construct Reporters’ Freedom Just to Tear 

It Down 


Discussant 

Dan Berkowitz, Iowa 

12:45 to 2:15 p.m. / R029 Meeting Room 03 



News Audiences: Preferences and Personalization

Congratulations to 

our AEJMC award 

winners! 

Whether they’re on campus 

or roaming far and wide, 

CMCIs faculty, students and 

alumni are a proud part of 

our distinguished herd. 

Alumni winners 

Faculty winners 

2017 Scripps Howard Foundation Administrator 

of the Year (Announced in 2018) 

Don Heider (PhDComm’97) 

Dean of the School of Communication, 

Loyola University Chicago 

2018 Edward L. Bliss Award for Distinguished 

Broadcast Journalism Education 

Lee Hood (MJour’97, PhDComm’01) 

Associate Professor at the School of 

Communication at Loyola University Chicago 

2018 Tankard Book Award Finalist 

Burton St. John III (joining CU Boulder 

in fall 2018 from Old Dominion University) 

for Public Relations and the Corporate Persona: 

The Rise of the Affinitive Organization 

First Place, 2018 AEJMC Visual Communication 

Creative Projects Competition 

Ross Taylor, Assistant Professor, Journalism 

Photo essay Last Moments 

2017 Journalism and Mass Communication 

Quarterly Outstanding Article Award 

Chris Vargo, Assistant Professor, 

Advertising, Public Relations and Media Design 

“Networks, Big Data, and Intermedia Agenda Setting: 

An Analysis of Traditional, Partisan, and Emerging 

Online U.S. News.” Lei Guo of Boston University was 

the co-author. 


196 





Jae-Hwa Shin, Southern Mississippi 

Factors Motivating Customization and Echo Chamber 

Creation Within Digital News Environments 

Brooke Auxier and Jessica Vitak, Maryland 

Personalized News in the Age of Distraction 

Lisa Farman, Ithaca 

“I Know from Personal Experience”: Shared News 

Consumption and Citizen Knowledge Exchange on 

Reddit 

Corinne Dalelio 

and Wendy Weinhold, Coastal Carolina 

Discussant 

Hannah Dong, Iowa State 




Free Flow of Information 


Michael Martinez, Tennessee 

Requester’s Paradox: Acknowledging FOIA’s Defects, 

Moving toward Proactive Disclosure 

A.Jay Wagner, Bradley 

Transparency Reporting and Content Takedowns: Examining 

Internet Censorship in the United States and India* 

Enakshi Roy, Western Kentucky 

Seeking Clarity: European Press Rights at Peaceful 

Assemblies 

Jonathan Peters, Georgia 

The Internet of Platforms and Two-Sided Markets: 

Implications for Competition and Consumers 

Rob Frieden, Pennsylvania State 

Discussant 

Dean Smith, High Point 

* Top Debut Faculty Paper 



Division and Community Journalism Interest Group 


Working Conditions for Women 

in Digital Workplaces 


Daniela Dimitrova, Iowa State 

Panelists 

C. Ann Hollifield, Georgia 

Michelle Ferrier, Ohio 

Julia Wallace, Arizona State 



Elizabeth Green, Co-Founder, Chalkbeat.org 




Attitudes Towards Black Lives Matter 

& Representations of Ferguson 


Robbie Morganfield, Grambling State 

Media Effects and Marginalized Ideas: Relationships 

Among Media Consumption and Support for Black 

Lives Matter 

Danielle Kilgo, Indiana 

and Rachel Mourao, Michigan State 

More than a Black and White Issue: Racialized Identity 

Constructs and Support for the Black Lives Matter 

Movement 

Lanier Holt and Matthew Sweitzer, Ohio State 

Racially Framed: A Content Analysis of Media Frames 

in the Coverage of the Ferguson Controversy* 


To Ferguson, Love Palestine: Mediating Life Under 

Occupation 

Cristina Mislan and Sara Shaban, Missouri 

Discussant 

Brad Gorham, Syracuse 

* Second Place, Faculty Paper Competition 

12:45 to 2:15 p.m. / R033 Mount Vernon B 



Top Papers: Open Papers, Top Student Paper, 

and Newsom Award 


Lucinda Austin, North Carolina at Chapel Hill


197 



Tweeting to (Selectively) Engage: A Network Analysis of 

Government Organizations’ Stakeholder Management on 

Twitter During Hurricane Harvey* 

Wenlin Liu, Houston 

and Weiai (Wayne) Xu, Massachusetts 

Examining Efficiency and Effectiveness in Online 

Interactions Between United States Government Agencies 

and Their Publics** 

Jiun-Yi Tsai and Janice Sweeter, Northern Arizona; 

Elizabeth Candello, Washington State; 

and Kirsten Bagshaw, Northern Arizona 

Creating a Positive Emotional Culture: Effect of Strategic 

Internal Communication and its Impact on Employee 

Supportive Behaviors*** 

Rita Men and Cen April Yue, Florida 

Moderating Effects of Perceived Government 

Controllability Over Crisis Outcomes and Consumer 

Collective Efficacy on Responsibility Attribution 

and Demands for Regulatory Interventions**** 

Yingru Ji, The Chinese University of Hong Kong 

Being Bad Abroad: Effects of Stealing Thunder by Self- 

Disclosing Corporate FCPA Violations***** 

Julia Daisy Fraustino, Sang (Sammy) Lee 

and Ji Young Lee, West Virginia 

Discussant 

Nathan Gilkerson, Marquette 

* Top Open Competition Paper 

** Second Place Open Competition Paper 

*** Third Place Open Competition Paper 

**** Top Student Paper 

***** Newsom Award Winning Paper 




College Student Journalism: Insights for Educators 

and Practitioners 

Perceived Threats and Risks among Student Journalists: A 

Q Study of Self-Censorship 

Lee Farquhar, Butler 

and Michael Clay Carey, Samford 

College Writing Assignments on Mobile Devices: 

Comparing Students’ Attitudes and Flipping the 

Traditional Classroom: Is Flipping Really Better? 

Kelly Poniatowski, Elizabethtown 

Engagement Across Disciplines and Age 

Ronald Yaros, Maryland 

and John Misak, New York Institute of Technology 

Discussant 





Sex Trafficking, Violence and Trauma: Improving 

the Narrative in Media and Classrooms 


Jaime Loke, Texas Christian 

Framing Transgender Violence: Narratives within 

Mainstream News Coverage 


“Boyfriending In”: Violence and Romance in News 

Narratives about Sex Trafficking 

Anne Johnston 

and Barbara Friedman, North Carolina at Chapel Hill 

What Happens When They Can Find You?: Doxing, 

Privacy, and Feminist Theory 

Stine Eckert and Jade Metzger, Wayne State 

Developing a Trauma-Informed Approach to Public 

Relations Education 

Stephanie Madden, Pennsylvania State 

and Teri Del Rosso, Bridgewater State 

Thursday 


David Bulla, Augusta 

I am a Journalist: Understanding Communities of Practice 

in Student Newsrooms 

Elizabeth Smith, Pepperdine; 

Jean Norman, Weber State; 


and Lisa Lyon Payne, Virginia Wesleyan 

The Day Students Scooped the Established Media: 

The Extreme Experiential Learning in a Pop-Up 

Multiplatform Newsroom 

Alex Canner and Ivana Ebel, University of Derby 

2:45 to 4:30 p.m. / R035 Ketchum 


Off-site Ketchum Tour 


Christopher Wilson, Brigham Young 

Representatives from each of their four main business 

practices speak to us about their work: Public and corporate 

affairs, brand, health, and social marketing.

KACA 40 th Anniversary Conference 

August 9, 2018, Renaissance, Washington D.C. 

The me 

Renewed Role of the Press in Building, Transforming, 

and Restoring Democracy: Korea and Beyond 

Visit theKACA.org for more information! 

Keynote speaker 

Anniversary book launching 

Main programs 

Conference 

Congressional Hall A&B, 

Renaissance Hotel, 

9:00 am - 6:00 pm 

Gala reception 

Penn Quarter, 

Renaissance Hotel, 

6:00 pm - 8:00 pm 

Yongjin Kim, 

President of the Korea 

Center for Investigative 

Journalism, and Editorin-chief 

of Newstapa, an 

online news website that 

presents watchdog 

journalism in 

multimedia form. 


Digital Media, and 

Popular culture in 

Korea: Contemporary 

Research and Future 

Prospects edited by 

Drs. Dal Yong Jin 

and Nojin Kwak 

Korean 


Media, and Culture: 

An Annotated 

Bibliography edited 

by Drs. Kyu Ho 

Youm and Nojin 

Kwak 

For more information, 

contact Dr. Gi Woong 

Yun, VP, KACA, 

gyun@unr.edu 

We, Korean American Communication Association (KACA), have been facilitating academic, professional, 

and social exchange among Korean communication scholars and students in North America, Korea, and 

other countries since 1978. Today, we have over 500 members in the U.S., Asia, and Europe, who are 

dedicated to advance communication studies. We held research sessions, top papers awards, scholarships, 

graduate student awards, mentoring opportunities at AEJMC, ICA, and NCA. We welcome all researchers 

who share an interest in exchanging information and conduct research in communication focusing on 

topics related to Korea, Korean-Americans, and the Asian culture. At the 2018 AEJMC conference, 

Washington D.C., we celebrate our 40 th anniversary with special events. Join our events and visit our 

official website (www.thekaca.org) for further information. 

Official website 

www.thekaca.org

Congratulations, 

Dr. Kathleen McElroy 

New Director of the School of Journalism 

A former journalist with nearly three decades of newsroom experience and four years 

of academic experience, Dr. Kathleen McElroy served as the School of Journalism’s 

associate director for two years prior to being appointed director and professor. 

During her 20 years at the New York Times, McElroy held a variety of positions, 

including associate managing editor, deputy editor of the website, dining editor, 

and deputy sports editor. 

McElroy also worked at Newsday, the Austin American-Statesman, and Oklahoma 

State University, where she taught news reporting and sports media. McElroy earned 

a Ph.D. degree in journalism from UT-Austin, a Masters of Arts from NYU, and an 

undergraduate broadcast journalism degree from Texas A&M. 

One hundred and four years after the founding of the School of Journalism at the 

University of Texas at Austin, faculty, students and staff welcome Dr. Kathleen McElroy. 

Her leadership and vision are what’s needed to train the next generation of journalists 

and communication leaders and meet the challenges facing our field.

240,000 HOURS & COUNTING 

WHETHER IT HAPPENED 

30 YEARS 

AGO 

or 

30 

MINUTES 

AGO… 

FIND IT ALL IN 

C-SPAN’s 

VIDEO LIBRARY 

Start exploring in the search bar at c-span.org for an online library of 

30 years of easily searchable public affairs video. It’s all available for free 

as a public service of C-SPAN’s cable and satellite television affiliates. 

The c-span.org video library is a significant catalogue of 

America’s contemporary political dialogue. 

.ORG 

CREATED BY CABLE 

V075 AEJMC ad.indd 1 

5/30/18 9:57 AM

BOWLING GREEN STATE UNIVERSITY 

SCHOOL OF 

MEDIA AND COMMUNICATION 

OFFERING A DOCTORATE IN MEDIA AND COMMUNICATION 

Emphasis areas: 

• Global Communication and Social Change 

• Interpersonal Communication 

• Media Audiences and Processes 

We also offer a generalist Master’s Degree in Communication, as well as 

specializations in International and Intercultural Communication, Social 

and Interactive Media, and Strategic Communication. 

Contact Dr. Joshua D. Atkinson, Graduate Coordinator, jatkins@bgsu.edu 

or visit us at bgsu.edu/smc for more information. 

Our outstanding faculty 

Paul Wesley Alday 

Emily Anzicek 

Joshua D. Atkinson 

Phil Beskid 

Katherine Bradshaw 

Rick Busselle 

Jose Cardenas 

Catherine Cassara 

Chris Cavera 

Lynda Dixon 

John Dowd 

Sandra Faulkner 

Jim Foust 

Radhika Gajjala 

Ken Garland 

Alberto Gonzalez 

Ellen Gorsevski 

Louisa Ha 

Julie Hagenbuch 

Lisa Hanasono 

Ilyoung Ju 

Lara Lengel 

Lori Liggett 

Yanqin Lu 

Thomas Mascaro 

Srinavas Melkote 

Claudia Y. Owens 

Terry Rentner 

Clayton Rosati 

Ewart Skinner 

Laura Stafford 

Kelly Taylor 

Media and 

Communication 

18AS7643

C 

AEJMC 2018 Research Scholars 

ongratulations 

2018 Senior Scholars 

W. Joseph Campbell, American University 

“When Polls Go Bad: The Wary Interplay of Journalism and Survey Research” 

Emily T. Metzgar, Indiana University 

“The American Narrative: U.S. Information Diplomacy Since World War II” 

Kim Walsh-Childers, University of Florida 

“Developing Criteria for Assessing the Quality of News Coverage of Health Policy: 

Toward Improving Coverage to Better Inform Citizens and Policy-makers” 

2018 Emerging Scholars 

Suzannah Evans Comfort, Indiana University 

“Responsibility, Vulnerability, and Climate Change: 

Toward a Model of Influences on Climate Journalism in Developing Countries” 

Julia Daisy Fraustino, West Virginia University 

and Amanda K. Kennedy, St. Mary's University 

“Care in Action: Disaster Communication Ethics and Preparedness 

in Vulnerable Communities” 

Summer Harlow, University of Houston and Danielle Kilgo, Indiana University 

“Disrupting the Protest Paradigm: Toward a Model of the Sociological Effects, 

Routines and Norms Influencing Journalistic Coverage of U.S. Protests” 

Candi S. Carter Olson, Utah State University 

“Act Like a Lady: Women's Press Clubs 

and the Rise of the Twentieth Century Newswoman”

and 

aejmc 

Congratulate 

the winner of the 

2018 Gene Burd Urban Journalism Award 

BRIAN LEHRER 

Radio Talk Show Host 

The Brian Lehrer Show, Produced by WNYC 

Award panel on Tuesday, August 7 at 3:15 p.m. 

The Gene Burd Urban Journalism Award seeks to improve the practice and study of journalism in the urban environment 

by recognizing high quality urban media reporting, critical analysis, and research relevant to that content 

and its communication about city problems, programs, policies, and public priorities in urban life and culture. Awards 

are for individuals with a distinguished record of accomplished works in urban journalism. 

For more information about the award, contact 

Gary Gumpert of the Urban Communication Foundation at listra@optionline.net 

or Jennifer McGill of AEJMC at jennifer@aejmc.org

Congratulations 

Awardees of the Texas Tech University President’s Excellence Awards! 

President’s Excellence in Gender Equity Awardee, David D. Perlmutter, Ph.D. (center, 

Professor and Dean, TTU College of Media & Communication), stands with some of 

the award nominators (left to right) Amy Koerber, Ph.D., Kimberly Wagner, Snowball, 

Miglena Sternadori, Ph.D. and Erin Collopy, Ph.D. 

President’s Excellence in Advising Awardees, TTU College of Media & Communication 

Undergraduate Advisers (left to right) Rose Cruz, Kim Bergan, Carly Carthel and Donald Ellis. 

comc.ttu.edu

WELCOME 

Rochelle L. Ford 

Ford joined Elon in June as the new dean of its 

School of Communications. She was chair of the 

public relations department of Syracuse University’s 

SI Newhouse School of Public Communications, as 

well as provost faculty fellow. Ford previously spent 

16 years in the School of Communications at Howard 

University in Washington, D.C. 

THANK YOU 

Paul Parsons, who joined Elon as the founding dean of the 

School of Communications in 2001, concluded his service as 

dean at the end of the 2017-18 academic year. Under his 

leadership, the school has developed innovative programs, 

recruited gifted students and a diverse faculty, and constructed 

state-of-the-art facilities. Following a yearlong sabbatical, 

Parsons will return to the faculty in fall 2019. 

DISTINCTIVES 

One of 18 private universities in the nation accredited by ACEJMC • More than 1,300 students and 60 full-time faculty members 

Undergraduate majors in Journalism, Strategic Communications, Cinema & Television Arts, Communication Design and Media Analytics 

A master’s program in Interactive Media • Pioneered the Elon in LA program

Conference Index 

207 

A 

Abdallah, J. C., 49 

Abitbol, Alan, 116 

Abitbol, Alan, 50 

Abrams, Katie, 45 

Abt, Marina, 88 

Adamo, Greg, 48, 109, 174 

Adams, Jay, 59, 107, 151, 163, 

177 

Adams, Kelsy-Ann, 70 

Adams, Kimberly, 49 

Adams, Kirsten, 159, 161 

Adams, Melissa, 98 

Adams, Tessa, 67 

Addie, Yewande, 70 

Adegbola, Oluseyi, 59 

Agbese, Aje-Ori, 104 

Aghazaden, Sarah, 155 

Agiesta, Jennifer, 135 

Ahern, Lee, 46, 88, 150 

Aikat, Deb, 26, 48, 54, 68, 96, 

151, 159 

Akerlof, Karen, 88, 93 

Akinfeleye, Ralph, 70 

Akpan, Nsikan, 96 

Al-Azdee, Mohammed, 28, 111, 

120, 122, 137, 186 

Al-Kandari, Ali, 159 

Al-Mohammadi, Bothayna, 147 

Albertson, Toni, 43, 72, 109, 123, 

138, 160, 186, 192 

Albishri, Osama, 66 

Alcorn, Jason, 153 

Aldoory, Linda, 92, 155 

Alex, Deepika Rose, 43 

Alhabash, Saleem, 76, 157 

Ali, Amal, 45, 147 

Alimbekova, Sayagul, 74 

Alkazemi, Mariam, 149, 159, 176, 

194 

Allam, Hannah, 49 

Allgayer, Sasha, 136 

Allison, Donnetrice, 109 

Alonso, Paul, 108 

Alpert, Jordan, 44 

Alston, Chuck, 69 

Alves, Rosental, 122 

Amado, Adriana, 73 

Anderson, Jenn, 70 

Anderson, Monica, 93 

Andornato, Anthony, 22 

Andrews, Michael, 137 

Anghelcev, George, 77, 155 

Anjalin, Umana, 161 

Ankuran, Dutta, 28 

Ao, Song, 117 

Appelman, Alyssa, 114, 152, 190 

Applegate, Brooks, 147 

Applequist, Janelle, 87 

Arceneaux, Phillip, 104 

Arendt, Florian, 158 

Arif, Rauf, 107, 163 

Armstrong, Cory, 76, 109 

Armstrong, John, 111 

Aromona, Shola, 161 

Ashktorab, Zahra, 161 

Assaf, Elise Anguizola, 49 

Assmann, Karin, 111 

Atkin, David, 97 

Atkins, Aaron, 22, 94, 173, 176 

Atwater, Tony, 73 

Atwood, Liz, 43, 72 

Augenstein, Neal, 22 

Auger, Giselle A., 23, 135, 194 

Auguste, Kendra, 147, 157 

Auman, Ann, 44, 52, 110 

Austin, Lucinda, 23, 46, 52, 75, 

156, 196 

Auxier, Brooke, 60, 196 

Avendano, Alberto, 92 

Aviles, José, 88 

Avtandilian, Martha, 110 

Axinn, Catherine, 42 

Azocar, Cristina, 44 

B 

Babin, Sam, 160 

Bae, Soo Young, 135, 185 

Bagshaw, Kirsten, 197 

Baijnauth, Ranjeeta, 150 

Baik, Jeeyun, 100 

Bailey, Erica, 88 

Bajalia, Alexis, 147 

Baker, Kim, 76 

Baker, Matthew, 88, 146 

Baker, Sean, 76 

Ball, Brett, 70 

Bane, Kaitlin, 43 

Banu, Nafida, 136 

Bard, Mitchell, 76, 107 

Barlybayeva, Saule, 74 

Barned-Smith, St. John, 54 

Barnes, Robert, 22 

Barnett, Brooke, 99 

Barnidge, Matthew, 73, 135 

Barthel, Michael, 190 

Bashir, Aqsa, 44, 98 

Batsell, Jake, 54, 77 

Batts, Battinto, 54 

Baugut, Philip, 67 

Baum, Michelle, 96 

Baumann, Sabine, 58, 107, 123, 

135, 160, 196 

Beaufort, Maren, 139 

Beck, Daniel, 73 

Beck, Paul, 161 

Becker, Amy, 120 

Beeson, Joel, 47 

Begovich, Ray, 173 

Bekken, John, 72, 146 

Belair-Gagnon, Valerie, 22, 52 

Belmas, Genelle, 22, 118, 148 

Benaza, M. Paisley, 136 

Benaza, Paisley M., 78 

Benedict, Catherine, 157 

Bent, Elizabeth, 104, 114 

Bentley, Joshua, 116 

Benz, Jennifer, 56 

Berg, Kati, 98 

Bergstrom, Andrea, 114 

Berke, Collin, 100 

Berkowitz, Dan, 194 

Berman, David, 77 

Bernhardt, Jay, 122 

Berube, David, 45 

Besley, John C., 46, 92, 96 

Bhalla, Nandini, 75, 106, 114, 

136, 155 

Bhat, Aditya Ravindra, 156 

Bhatia, Peter, 43, 137 

Bhavsar, Jaini, 87 

Bichard, Shannon, 139 

Bien-Aime, Steve, 49, 94 

Billings, Andrew, 49, 54, 97, 109, 

192 

Billinson, Jennifer, 109 

Birmingham, Branden, 67 

Birthisel, Jessica, 50 

Bissell, Kimberly, 76, 107, 139 

Bivins, Thomas, 173 

Index

208 Conference Index 

Blackistone, Kevin, 154 

Blackstone, Ginger, 41, 59 

Blad, Evie, 54 

Blaine, Mark, 46 

Bland, Dorothy, 26 

Blasingame, Dale, 21 

Blevins, Katie, 109 

Blom, Robin, 77, 185 

Bloyd-Peshkin, Sharon, 47, 59, 

120, 148 

Bluestein, Stephanie, 102 

Boardman, David, 79, 150, 176 

Boatwright, Brandon, 115 

Bobkowski, Peter, 99, 117, 158 

Bock, Mary, 78 

Bode, Leticia, 60, 74, 139 

Boehm, Fred, 67 

Boehm, Nicholas, 75 

Bogardus, Ben, 89 

Bogda, Natalie, 86 

Bok, Kang, 117 

Boling, Kelli, 173, 174 

Bondy, David, 71 

Borah, Porismita, 146 

Borden, Jonathan, 116 

Borton, Brett A., 48 

Bortree, Denise Sevick, 23, 75, 

106, 117 

Bossetta, Michael, 161 

Bouchacourt, Lindsay, 163 

Bouchillon, Brandon, 158 

Bowe, Brian J., 43, 54, 77 

Bowen, Candace Perkins, 99 

Bowman, Nicholas, 157 

Boyle, Kris, 73, 160, 196 

Boyle, Michael, 157 

Boyles, Jan Lauren, 22, 68, 77, 92, 

100, 153, 175, 186 

Braddock, Kurt, 69 

Bradford, Mary Beth, 156 

Bradshaw, Amanda, 147, 157 

Bragg, Dianne, 190 

Bramlett-Solomon, Sharon, 71, 73 

Branham, Lorraine, 99, 176 

Brannon, Jody, 89 

Bravo, Vanessa, 119 

Breaux, Elizabeth, 137 

Brennan, Tim, 70 

Brennen, Bonnie, 138 

Breslin, Jack, 119, 153 

Bressers, Bonnie, 71 

Breves, Priska, 45, 88, 155 

Brewer, Jerry, 154 

Bridges, Lauren, 76 

Britt, Brian, 70, 75 

Britt, Rebecca, 70 

Britten, Bob, 59 

Broersma, Marcel, 159 

Bronstein, Carolyn, 26, 98, 99 

Brooks, Dwight, 154 

Brooks, Mary Liz, 88, 139 

Brossard, Dominique, 194 

Brotman, Stuart, 86 

Broussard, Jinx C., 26, 192 

Broussard, Ryan, 49, 74, 77 

Brown-Devlin, Natalie, 49, 109, 

150 

Brown-Smith, Carrie, 109 

Brown, Carrie, 160 

Brown, David, 150 

Brown, Felicia Greenlee, 72 

Brown, Jordon, 59, 172 

Brown, Kenon, 49, 67, 75, 109 

Brown, Nina Iacono, 22, 94 

Brown, Vicki, 71 

Browning, Nicholas, 66 

Browning, Robert X, 96 

Broyles, Sheri, 79, 154, 163 

Brubaker, Pamela, 97, 155, 156 

Bruce, Michael, 139 

Bruhn, Kelly, 26 

Brummette, John, 106, 115 

Brunner, Brigitta, 23, 42 

Brunt, Jason, 117 

Buchanan, Carrie, 23 

Buckley, Christen, 117 

Buijzen, Moniek, 186 

Bulat, Beril, 66 

Bulla, David, 197 

Bunce, Mel, 104 

Buntain, Noah, 77 

Buozis, Michael, 153 

Burgess, G. Scott, 58, 97 

Burns, Alison, 108 

Burns, Lisa, 173 

burrough, xtine, 29, 78 

Burton, Rockell Brown, 70 

Bustamante, Celeste Gonzalez de, 

49, 108 

Butler, William (Sim), 147, 174 

Byerly, Carolyn M., 49, 94, 146 

Byrd, Robert (Robby), 79, 108, 174 

C 

Cabas, Ayleen, 172 

Cabosky, Joseph, 152, 175, 176 

Cacciatore, Michael, 73 

Cahill, Collin, 47, 161 

Cahill, Tiernan, 157 

Callahan, Chris, 149 

Calvert, Clay, 47, 148 

Camaj, Lindita, 89, 137, 152 

Campbell, Angela, 47 

Campbell, Isaac, 47, 161 

Campbell, Joel, 71 

Campbell, Kenneth, 173 

Campbell, Scott, 102 

Campbell, W. Joseph, 54, 69, 93, 

139, 153 

Candello, Elizabeth, 197 

Canner, Alex, 197 

Canuelas-Torres, Laura, 76 

Cao, Mengling, 86 

Carey, Anna Grace, 94 

Carey, Michael Clay, 72, 175, 177, 

197 

Carlson, Caitlin, 114 

Carpenter, Serena, 95 

Carpentier, Francesca Dillman, 

194 

Carr, D. Jasun, 76, 107 

Carrie, 186 

Carroll, Fred, 72 

Carter, Liz, 79 

Cassara, Catherine, 152 

Cassidy, Bill, 66, 76, 147, 160 

Cassilo, David, 139 

Castaneda, Laura, 26, 99 

Cela, Erlis, 28 

Ceppos, Jerry, 119 

Cereijo, Bryan, 47 

Cha, Jiyoung, 21, 153 

Chacón, Lourdes Cueva, 59 

Chadha, Kalyani, 60, 108, 161 

Chadha, Monica, 173 

Champlin, Sara, 46, 77, 163 

Chan-Olmsted, Sylvia, 58, 68, 

115, 190 

Chan, Michael, 106 

Chancellor, Cristal Williams, 138

dowjonesnewsfund.org 

We offer college juniors, 

seniors and graduate students 

paid, prestigious internships at 

leading news organizations. 

Interns attend one-week 

pre-internship training 

programs to prepare for their 

newsrooms. 

SUMMER 2019 APPLICATIONS 

DUE NOV. 1 

INTERNSHIP PROGRAMS 

BUSINESS REPORTING 

Interns practice covering the 

economy, local businesses, 

finance, banking, the stock 

market and more. 

DATA JOURNALISM 

Students learn how to use 

computer-assisted reporting to 

analyze and find compelling 

stories in data. 

DIGITAL MEDIA 

Training covers podcasting, 

video, data visualizations and 

use of other media to tell rich 

stories. 

MULTIPLATFORM EDITING 

Interns are challenged to design 

and produce news products on 

deadline while learning the finer 

points of editing.


Chang, Byeng-Hee, 190 

Chang, Li-jing, 48 

Chattoo, Caty Borum, 48, 117 

Chattopadhyay, Dhiman, 48 

Chattopadhyay, Sriya, 48 

Chavez, Manuel, 41, 74, 97 

Chen, Anne Cooper, 118 

Chen, Bin, 153 

Chen, Cheng, 156 

Chen, Huan, 44, 87, 163 

Chen, Junhan, 156 

Chen, Li, 45, 136, 159 

Chen, Peiqin, 68 

Chen, Victoria, 76, 102 

Chen, Weiyue, 74, 97 

Chen, Wen-wei, 45 

Chen, Wenhong, 190 

Chen, Xingang, 69 

Chen, Zifei, 116 

Cheng, Benjamin Ka Lun, 87 

Cheng, Hong, 48, 68, 119 

Cheng, Lihong, 69 

Cheng, Yang, 116 

Chengyuan, Shao, 114 

Cheong, Michelle, 117 

Chernin, Kelly, 69 

Chessher, Melissa, 47 

Chew, Fiona, 87 

Chia, Stella, 48 

Chikwendiu, Jahi, 149 

Childers, Courtney, 86, 96 

Chinn, Dana, 21 

Cho, Eugene, 148 

Cho, Moonhee, 45, 115 

Cho, Seonggyeol, 148 

Choi, Chang Won, 45 

Choi, Jinyoung, 148 

Choi, Minhee, 106, 115, 139, 147 

Choi, Yunmi, 147 

Choung, Hyesun, 45, 119 

Christensen, Spencer, 97 

Christiano, Ann, 23 

Chu, Haoran, 52, 147 

Chuang, Angie, 78 

Chun, Russell, 92 

Chung, Angie, 117 

Chung, Deborah, 89 

Chung, Jae Eun, 98 

Chung, Un Chae, 86 

Church, Scott, 97 

Churcher, Kalen, 23 

Cicchirillo, Vincent, 75 

Cirilli, Kevin, 162 

Ciszek, Erica, 23, 52, 115, 174 

Clancy, Richard, 117 

Clark, Meredith, 78, 99 

Clark, Naeemah, 48 

Clarke, Chris, 69 

Claussen, Dane, 22, 29 

Cleary, Johanna, 69 

Clegg, Alexander, 194 

Cloyd, Emily T., 88 

Cobb, Lona D., 54, 76, 108 

Cochran, John, 79 

Coco, Savannah, 116 

Coddington, Mark, 22, 49 

Cogar, Maggie, 99 

Cohen, Elisia, 124 

Cole, Harry, 47 

Cole, Hazel James, 42 

Coleman, Lillian, 93 

Coleman, Loren, 194 

Coleman, Renita, 75 

Collins, Morgan, 23 

Collins, Ronald K.L., 56 

Coman, Ioana, 73 

Comello, Maria Leonora, 117, 137 

Comfort, Ryan N., 92 

Comfort, Suzannah Evans, 139 

Conlin, Jeff, 46, 88, 106, 152 

Cooke, Sandra, 46 

Coombs, Danielle, 94, 119 

Cooney, Chris, 42 

Cooper, Caryl, 147, 151 

Cooper, Dana, 108 

Coppini, David, 58 

Corn-Revere, Robert, 47 

Cotten, Shelia, 44 

Cotter, Kelley, 110 

Cotton, Alfred, 42 

Covington, Emily, 48 

Cowart, Holly, 76 

Cox, Jennifer Brannock, 110 

Cox, Jennifer, 173 

Coyle, Erin, 111 

Coyne, Amy, 144 

Cozma, Raluca, 41, 66 

Craft, Stephanie, 89 

Craig, Clay, 114, 139 

Craig, Richard, 104 

Creech, Brian, 79 

Creeley, Will, 56 

Cretul, Matthew R., 147 

Crichlow, Marquitta, 47 

Criswell, Jeanne, 136 

Crooke, Ellen, 72 

Cross, Al, 161, 192 

Croteau, Maureen, 49 

Cruikshank, Sally Ann, 74 

Cruz, Richie, 78 

Cui, Xi, 97, 158 

Cullier, David, 60 

Culver, Kathleen, 52, 89, 163 

Culver, Katy Bartzen, 71, 190 

Cumming, Douglas, 69, 85, 111, 

120, 122 

Cumming, James, 67 

Cummings, Christopher, 45 

Cummings, Dean, 72, 104, 144, 

194 

Cummins, Glenn, 21, 68, 88, 147 

Curry, Alex, 77 

Curtain, Pat, 78, 95 

Curtis, Chad, 162 

D 

Daalmans, Serena, 136, 174 

Dade, Caroline, 114 

Dahlke, Ross, 146 

Dahmen, Nicole, 43, 59, 77, 110 

Dalelio, Corinne, 196 

Dalglish, Lucy A., 78, 119 

Dalrymple, Kajsa, 172 

Dardis, Frank, 88 

Dashiell, Eddith, 70 

Davenport, Lucinda, 77, 122 

Davie, William (Bill), 47, 89, 173 

Davis, Debbie, 26 

Davis, Jewell, 48 

Davis, Stefanie, 70 

Davis, Steve, 47 

Dawkins, Wayne, 78 

Daws, Laura Beth, 50 

Dayani, Dilshad, 188 

Deems, Rachel, 116 

DeFoster, Ruth, 107 

Delwiche, Aaron, 137 

DeMars, Tony, 50 

DeMars, Tony, 85, 97, 119 

Deng, Tao, 157


211 

Deng, Tao, 76 

Dennis, Everette E., 50 

DePalma, Sony, 149 

DeRienzo, Matt, 95 

Devault, Amy, 99 

Devlin, Michael B., 109 

Devlin, Michael B., 49 

Devlin, Natalie Brown, 107 

DeWalt, Christina Childs, 46 

Dey, Sreyoshi, 110 

Dickhaus, Joshua, 75 

Diddi, Pratiti, 106, 117 

Diddi, Pratiti, 75 

Diehl, Trevor, 158, 172 

Diep, Francie, 96 

Diepenbrock, George, 117 

Dimitrova, Daniela, 106, 196 

DiPalma, Sonya, 23, 26, 123 

DiStaso, Marcia, 85 

Do, Hung, 157 

Dockter, Ciera, 46 

Dodd, Melissa, 23, 115 

Dodel, Nicola, 155 

Dodoo, Naa Amponsah, 86 

Donegan, John, 157 

Dong, Chuqing, 106 

Dong, Hannah, 196 

Dooley, Benjamin, 28 

Dorning, Mike, 192 

Doroshenko, Larisa, 119 

Dow, Devon, 78 

Dowd, Michelle, 109, 138, 186 

Dowling, David, 97 

Drucker, Susan J., 110 

Duan, Ran, 44, 46 

Dudo, Anthony, 46 

Duffy, Andrew, 67, 71 

Duffy, Kevin, 44 

Duffy, Margaret, 48, 98, 147 

Duhé, Sonya Forte, 54, 106 

Dumdum, Omar, 66 

Dun, Susan, 45, 147 

Duncan, Megan, 52, 58, 76 

Dunn, Joshua, 47 

Dunn, Stephanie Schartel, 152, 

192 

Duong, Hue, 115 

Duvall, Spring-Serenity, 50 

Dworznik, Gretchen, 74 

Dwyer, Deborah, 41, 114 

E 

Ebel, Ivana, 197 

Eckert, Stine, 98, 111, 116, 138, 

197 

Eden, Allison, 136, 174 

Edenborg, Kate Roberts, 107 

Edgerly, Stephanie, 139 

Edmondson, Aimee, 104 

Edwards, Heidi Hatfield, 42, 86 

Edwards, William, 73, 159 

Edy, Jill, 160 

Egan, Beth, 87 

Eisenschmid, Tanja, 174 

Ejaz, Khadija, 102, 136 

Ekachai, Gee, 42 

Ekdale, Brian, 153 

Eko, Lyombe, 159 

Elberg, Jacob, 148 

Elias, Troy, 46, 73, 98 

Elizabeth, Jane, 95 

Emmons, Betsy, 60 

Engleman, Thomas E., 162 

Engstrom, Erika, 43 

Eosco, Gina M., 52 

Epstein, Michael, 22 

Eray, Tugce Ertem, 146 

Erlichman, Sara, 47, 48, 119 

Esch, Madeleine, 175, 177 

Espenscheid, Jacob, 47, 161 

Estaban, Chiqui, 173 

Evans, Nate, 96 

Everbach, Tracy, 26, 71, 77, 109, 

138 

Eyer, Joshua, 147 

Ezumah, Bellarmine, 104 

F 

Fabos, Betina, 47, 161 

Fahrenwald, Nancy, 70 

Fair, Lesley, 96 

Fallis, David, 71 

Falquero, Eric, 138 

Fan, Minghui, 43, 56 

Farias, Cristian, 152 

Farman, Lisa, 147, 196 

Farquhar, Lee, 60, 197 

Farrell, Mike, 22, 89 

Farrow, Ronan, 106 

Fattal, Alex, 158 

Fearn-Banks, Kathleen, 70 

Feldman, Lauren, 48 

Feng, Guangchao, 45 

Feng, Yang, 87, 185 

Ferchaud, Arienne, 75 

Ferguson, Douglas, 153 

Fernandes, Juliana, 119, 138 

Ferré, John, 146, 152 

Ferrier, Michelle, 49, 196 

Ferrucci, Patrick, 23, 43, 92, 115, 

146, 161, 194 

Fineman, Teri, 23 

Finneman, Teri, 118, 192 

Fischer, Laura, 88 

Fisher, Alyssa, 58 

Fisher, Melody, 70 

Fitzgibbon, Will, 192 

Fitzpatrick, Kathy, 44, 78 

Flamerich, Amanda, 68 

Fleming, Brittany, 186 

Flynn, Kathleen, 47 

Flynn, Mark, 114 

Foley, Jordan, 66 

Fondren, Elisabeth, 111 

Fontenot, Maria, 73, 89, 151 

Ford, Lani, 146 

Ford, Sam, 71 

Forde, Kathy Roberts, 54, 108 

Foss, Katie, 72, 173, 186 

Fowler, Brooke, 117, 122 

Fox, Kim, 22, 49, 66 

France, Betty La, 160 

Francis, Dalisay, 146 

Francis, Diane, 23, 46, 73, 137 

Francis, Maya, 109 

Franks, Suzanne, 49 

Fraustino, Julia Daisy, 23, 139, 

197 

Frazer, Rebecca, 47 

Freberg, Karen, 42, 78 

Freberg, Karen, 96, 107, 117 

Freedman, Eric, 172 

Freelon, Deen, 161 

Frieden, Rob, 196 

Friedman, Barbara, 197 

Frisby, Cynthia, 94 

Fröhlich, Valerie, 152 

Fuller, Brook, 144 

Fullerton, Jami A., 29, 44, 86, 100 

Fulton, Mike, 23 

Index


Funderburk, Reece, 97 

Fung, Timothy, 45, 172, 194 

Funk, Marcus, 174, 190 

G 

Gachau, James, 159 

Gan, Chen, 159 

Gao, Wenli, 152 

Gao, Xiaohong, 68 

García-Perdomo, Victor, 41, 111 

Garner, Ana C., 107, 124, 172 

Garrett, Kelly, 161 

Gaspard, Timothy, 48 

Gayle, Gina, 54 

Gearhart, Sherice, 59, 100, 118, 

161 

George-Palilonis, Jennifer, 192 

Germano, Sophia, 148 

Gesualdo, Nicole, 44 

Ghanem, Salma, 173 

Gibbons, Stephanie, 136, 161 

Gibson, Courtney, 88 

Gibson, Rhonda, 49 

Gilbert, Jeremy, 160 

Gilkerson, Nathan, 197 

Gillespie, Bruce, 188 

Gillmor, Dan, 162 

Gimbal, Ashley, 59, 94 

Glatter, Drake, 67 

Glennon, Joe, 79 

Golan, Guy, 87, 149 

Golombisky, Kim, 52 

Gomez, Jasmine, 47 

Gondwe, Gregory, 97 

Gong, Zijian, 147 

Goodman, Jasmin, 146 

Goodman, Mark, 60 

Gooley, Aryana, 102 

Gorbach, Julien, 102 

Gorham, Brad, 196 

Gosen, Joe, 161 

Gotlieb, Melissa, 21, 158, 175 

Grabe, Maria Elizabeth, 106 

Graffeo, Jonathan, 67 

Grantham, Susan, 108 

Grasso, Katherine, 159 

Gratson, Scott, 150 

Graybeal, Geoffrey, 120, 123, 160 

Green-Barber, Lindsay, 153 

Green, Elizabeth, 196 

Green, Nancy L., 54, 123 

Greenwood, Keith, 108, 118 

Greer, Jennifer D., 21, 54, 79, 100, 

144, 154 

Gregorian, Tamar, 43 

Gregory, Brittany-Rae, 94 

Gregory, Vanessa, 50, 59 

Grewe, David, 161 

Grieves, Kevin, 151 

Griffin, Kenna, 42, 160 

Grimm, Joe, 56 

Grimm, Josh, 102 

Grimshaw, Eean, 109 

Grizzle, Sarah, 59 

Grosswiler, Paul, 44 

Grove, Linsey, 75 

Grubbs, Mariea, 96 

Grubic, Adrianne, 76 

Grygiel, Jennifer M., 49 

Guha, Pallavi, 107, 151, 163 

Guidon, John, 194 

Guidry, Jeanine, 75, 156, 188 

Guilarte, Miguel, 138 

Gumpert, Gary, 110 

Gunther, Richard, 161 

Guo, Ke, 68 

Guo, Lei, 52, 75, 76, 151 

Guo, Sitong, 49, 115 

Guskin, Emily, 135 

Gustafson, Kristin, 108, 138 

H 

Ha, Louisa, 29, 95, 110, 150 

Habib, Sabrina, 100 

Hachtmann, Frauke, 68, 86 

Haenschen, Katherine, 67, 138 

Haim, Mario, 158 

Hale, Brent, 106 

Haley, Eric, 87 

Ham, Chang-Dae, 87, 116, 155 

Hamilton, David, 48 

Hamilton, Kristy, 86 

Hamilton, Mark, 155 

Hampton, Ashton, 148 

Hamula, Scott, 185 

Han, Jeong-Yeob, 46 

Han, Ji Yoon (Karen), 87 

Han, Jiangxue, 69 

Han, Karen, 153 

Hanc, John, 47, 192 

Hanel, Rachael, 188 

Hanson, Ralph, 72 

Hanzlik, Brittany, 147 

Hao, Xiaoming, 88 

Haratonik, Peter, 110 

Harbert, Laura, 118 

Hardin, Marie, 41, 72, 99, 144, 

145, 188 

Hardy, Bruce, 93 

Harker, Jennifer, 139 

Harlow, Summer, 41, 76, 100, 

111, 115, 139, 144, 159 

Harming, Shana, 70 

Harris, Brandon, 46 

Harris, Felicia, 79 

Harris, Hadar, 152 

Harrison, Guy, 59, 70 

Harrison, Kathryn, 100 

Harrison, Ray, 75 

Harrison, Virginia, 95, 106, 119, 

152, 155, 173 

Hart, Sol, 175 

Hassan, Naeemul, 77 

Hathaway, Julia, 88 

Haught, Matthew J., 60 

Haun, Danial, 67, 114 

Hawkins, Lauren, 94 

Haydel, Sheryl Kennedy, 146 

Hayes, Jameson, 87 

Haygood, Daniel, 151 

Haynes, Karima, 102 

Hayt, Teri, 78 

Heath, Erin, 88 

Heckman, Meg, 77, 118 

Heflin, Kristen, 108 

Heider, Don, 79 

Heim, Kyle, 60 

Hellmueller, Lea, 41, 74, 76, 159, 

196 

Henderson, Jennifer, 149 

Henderson, Keren, 46 

Hendricks, Marina, 58, 99, 118 

Hendrickson, Elizabeth, 89 

Henson, Lori, 50 

Herfort, Melanie, 98 

Herman, Burt, 95 

Hernandez, Miriam, 67, 146 

Hernandez, Robert, 59 

Hernandez, Terri, 68 

Herscovitz, Heloiza, 28, 48, 58,

Conference Index 213 

68, 97, 185, 186 

Hettinga, Kirstie, 92, 114, 186, 

197 

Higgins, Samantha, 72 

Hill, Christopher, 161 

Hill, Marc Lamont, 150 

Himelboim, Itai, 107, 146, 185 

Hines, Barbara, 148 

Hinnant, Amanda, 104 

Hinsley, Amber, 52, 115, 144, 145 

Ho, Shirley S., 88, 144 

Hoefges, Michael, 96 

Hoewe, Jennifer, 43, 87, 172 

Holan, Angie Drobnic, 92 

Holden, Benjamin, 22, 160 

Holiday, Steven, 147 

Hollerbach, Karie, 50 

Hollifield, C. Ann, 107, 196 

Holmes, Tim, 47 

Holmes, Todd, 98, 107 

Holt, Lanier, 196 

Holt, Natalie, 147, 174 

Holton, Avery, 23, 41, 52, 74, 76, 

77, 107, 157 

Hon, Linda, 69 

Hong, Cheng, 116 

Hong, Dahyun, 87 

Hong, Seoyeon, 115, 156, 157, 

185 

Hong, Sookyeong, 87 

Hope, Debra, 147, 174 

Hopkins, W. Wat, 29, 117, 160 

Hopkinson, Natalie, 66, 94 

Hopp, Toby, 146, 161 

Horning, Michael, 60 

Horning, Mike, 157 

Horrell, Lindsey, 157 

Horst, Morgan van der, 148 

Horvit, Beverly J., 86, 100 

Hossain, Delwar, 74, 160 

Hotter, Jessica, 152, 158 

Hou, Jue, 146 

Houston, Brant, 50, 52 

Houston, Brian, 93 

Houy, Yvonne, 192 

Hove, Harrison, 73 

Hrach, Thomas, 148 

Hsieh, Chih-Ting, 174 

Hu, An, 153 

Hu, Dingyu, 118 

Hu, Lingshu, 146 

Huang, Alice, 67, 71 

Huang, Gejun, 190 

Huang, Guanxiong, 45 

Huang, Jian, 86 

Huang, Lei Vincent, 56 

Huang, Qian, 158 

Huang, Tim, 156 

Hubbard, Glenn, 87 

Huber, Brigitte, 157, 158, 172 

Huddleston, Patricia, 118 

Hudson, David L., 56 

Huemmer, Jennifer, 79, 146 

Huesca, Robert, 175 

Huffman, Keith, 43 

Hughes, Ceri, 43, 66 

Huh, Jisu, 147 

Hull, Kevin, 94, 109, 114, 118, 

139, 147 

Hull, Shawnika, 147 

Humam, Muhammad, 147 

Humanes, María Luisa, 73 

Hume, Janice, 160 

Humphries, Zachary, 139 

Hursting, Laurie, 137 

Hussain, Sana, 147 

Hussain, Syed Ali, 76 

Hust, Stacey, 136, 161 

Hutchins, Amber L., 42 

Hwang, Juwon, 156, 186 

Hwang, Kyung-Ho, 115, 190 

Hyun, Daiwon, 136 

Hyun, Ki Deuk, 158 

Hyunjin Seo, 159 

I 

Igielnik, Ruth, 135 

Incollingo, Jackie, 102 

Ing, Lance, 72 

Innermann, Ina, 52 

Isa, Daud, 146 

Islam, Md Rezwan, 75 

Ismail, Ismaharif, 97 

Italiano, Rachel, 76 

Ivory, James D., 156, 158 

J 

Jackson, Cathy, 70, 71 

Jacobson, Susan, 194 

Jahng, Mi, 71 

Jahng, Rosie, 139 

Jain, Parul, 42 

Jaisle, Alyssa, 44 

Jakubowski, Max, 47 

James-Decruise, Elise, 150 

James, Thomas, 48 

Jamison-Koenig, Edgar, 48 

Jamison, Jeniece, 42 

Jang, Kyungeun, 148 

Jankowski, Stacie Meihaus, 50 

Janoske, Melissa, 42, 99, 108 

Jayakar, Krishna, 75 

Jefferson, Brittany, 117 

Jeffre, Jennifer, 60 

Jenkins, Daren, 78 

Jenkins, Joy, 98, 174, 192 

Jenkins, Mandy, 110 

Jenkins, Will, 117 

Jenks, John, 54 

Jennings, Marcel, 21, 68, 88 

Jeong, Hyun Ju, 115 

Jeong, Yongick, 163 

Ji, Hong, 42, 118 

Ji, Yi (Grace), 116 

Ji, Yingru, 155, 158, 197 

Jia, Hepeng, 56 

Jiang, Hua, 117 

Jiang, Ke, 42, 96 

Jiang, Liefu, 158 

Jiang, Mengtian (Montina), 88 

Jiang, Ruochen, 87 

Jin, Eunjoo, 88 

Jin, Jianbin, 194 

Jin, Yan, 46 

Joa, Claire Youngnyo, 60 

John, Burton St., 73, 173 

Johnson-Young, Elizabeth, 194 

Johnson, Benjamin, 136 

Johnson, Brett, 114 

Johnson, Cherlyn, 106 

Johnson, Courtney, 76 

Johnson, Erika, 156, 157 

Johnson, Jared, 41 

Johnson, Martin, 96 

Johnson, Melissa, 98 

Johnson, Nia, 60 

Johnson, Owen V., 151 

Johnson, Rich, 49 

Johnson, Richard, 46 

Johnson, Thomas J., 138 

Index


Johnson, Tom, 59 

Johnston, Anne, 197 

Jones, Jackie, 47 

Jones, Robert, 42 

Jones, Valerie, 155 

Joo, Eunsin, 44 

Joo, Yeon Kyoung, 118 

Jorgensen-Earp, Cheryl, 46 

Jorgensen, Darwin, 46 

Josephson, Sheree, 117 

Joshi, Apoorva, 44 

Joshi, Kartik, 87 

Joyce, Vanessa Higgins, 159 

Jun, Hyoyeun, 117 

Jun, Jong Woo, 87, 117 

K 

Kabah, Stephen, 146 

Kalika, Angelica, 67 

Kalyango, Yusuf, 26, 28, 41, 68, 

104 

Kamau, Gichuhi, 109 

Kamenchuk, Olga, 159 

Kananovich, Volha, 66, 158 

Kang, Ashley, 47 

Kang, Hyung-Cheol, 188 

Kang, Hyunjin, 148, 157 

Kang, Jin-Ae, 87 

Kang, Jin, 88, 148 

Kang, Seok, 185 

Kang, Soojung, 136 

Kang, Yowei, 156 

Kanthawala, Shaheen, 44 

Kantono, Rehema, 67 

Kantor, Jodi, 106 

Kappeler, Colleen, 137 

Karlis, Jack, 48, 54, 78, 156, 157 

Karsay, Kathrin, 152 

Kasadha, Juma, 67 

Kassinger, Anna, 161 

Kastrinos, Amanda, 67, 147 

Katz, Vikki, 190 

Kaufhold, William “Kelly”, 48, 76, 

98, 160 

Kaye, Barbara, 75, 156, 157 

Kaye, Valdovinos, 71 

Kearney, Mike, 146 

Kebbel, Gary, 50 

Keefe, Brendan, 72 

Keib, Katherine, 117 

Keith, Susan, 108 

Kelley, Debra, 70 

Kelling, Kimberly, 52, 104 

Kelly, James, 59 

Kendrick, Alice, 44, 100 

Kennan, William, 115 

Kennedy, Amanda K., 89, 139 

Kennedy, Karla, 78, 120, 148 

Kenyon, Sharlene, 102 

Ketterer, Stan, 70 

Khalitova, Liudmila, 66, 74 

Khamis, Sahar Mohamed, 149 

Khamis, Sahar, 138 

Khan, Abraham, 154 

Khan, Laeeq, 185 

Khan, Pervez, 28 

Khanjani, Mehrnaz, 66 

Khatib, Dima, 50 

Ki, Eyun-Jung, 45, 116 

Ki, Soojung, 68 

Kian, Ted, 147 

Kilgo, Danielle, 76, 100, 111, 139, 

196 

Kilker, Julian, 59, 78, 117, 175 

Kim, Bumsoo, 146 

Kim, Carolyn Mae, 42, 192 

Kim, Dam Hee, 139, 172 

Kim, Dong Hoo, 150 

Kim, Eunice, 88 

Kim, Eunyi, 87 

Kim, Gawon, 163 

Kim, Gooyong, 172 

Kim, Hanyoung, 46 

Kim, Hee Jun, 188 

Kim, Hongsuk, 136 

Kim, Hun, 190 

Kim, Hye Kyung, 157 

Kim, Hyosun, 156 

Kim, Hyunjung, 45, 156 

Kim, Jeesun, 116 

Kim, Jisu, 106 

Kim, Jiyoun, 45, 76, 185 

Kim, Joon Kyoung, 45, 58, 106, 

114, 139 

Kim, Joon Kyoung, 45, 58 

Kim, Junga, 87 

Kim, Ken, 119 

Kim, Ki Joon, 148 

Kim, Kisun, 188 

Kim, Nuri, 67, 71 

Kim, Sang Jung, 119 

Kim, Seoyeon, 46, 156, 159 

Kim, Shin Dong, 185 

Kim, So Jung, 52 

Kim, Sojung, 46 

Kim, Soo-Yeon, 115 

Kim, Soojin, 88 

Kim, Soojung, 156 

Kim, Su Jung, 46, 58, 147, 155 

Kim, Taeyoung, 115 

Kim, WooJin, 88 

Kim, Yeon Joo, 117 

Kim, Yeuseung, 87, 106 

Kim, Yong-Chan, 150 

Kim, Young, 42, 87, 106 

Kim, Yung Soo, 89 

Kim, Yungwook, 145 

King, Robyn, 147, 174 

Kinnall, William, 185 

Kinnally, William, 185 

Kinney, Lance, 68 

Kinsky, Emily S., 42 

Kiousis, Spiro, 66 

Kirtley, Jane, 60, 148 

Kitch, Carolyn, 160 

Kleemans, Mariska, 114, 174 

Kligler-Vilenchik, Neta, 52 

Kline, Karen, 136, 151 

Knight, Jennifer, 157 

Knobel, Beth, 77 

Knobloch-Westerwick, Silvia, 47, 

139, 158 

Knoll, Johannes, 158 

Koh, Hyeseung, 46 

Koliska, Michael, 108 

Kong, Sining, 44 

Kong, Wei Yi, 45 

Konieczna, Magda, 144, 153 

Kononova, Anastasia, 44, 157 

Kopenhaver, Lillian Lodge, 26, 28 

Kor, Ryan, 77 

Korn, Jenny Ungbha, 78 

Kotcher, John, 46 

Kothari, Ammina, 41, 111 

Kozman, Claudia, 41 

Kraeplin, Camille, 94 

Kraft, Nicole, 109, 190 

Kremmer, Christopher, 52 

Krishna, Arunima, 116, 155 

Kristensen, Nete, 29

CONGRATULATIONS! 

Mariea Hoy 

Inaugural DeForrest Jackson 

Endowed Professor 

WELCOME! 

Assistant Professor Sifan Xu 

PhD 2018 

University of Maryland 


Director & Professor Maureen Taylor 

2018 International Communication 

Association Fellow

216 


Kroll, Andy, 50 

Kruckeberg, Dean, 85, 115, 162, 

186 

Krzyzaniak, Halli, 68 

Kuang, Keqing, 115 

Kubala, Alison, 136 

Kumble, Sushma, 46 

Kunz, Reinhard, 98 

Kunze, Annika, 88 

Kurpius, David, 176 

Kushin, Matthew, 146 

Kwak, Nojin, 139, 172 

Kwon, K. Hazel, 138 

L 

Labbe, Brett, 74 

Lacy, Stephen, 95 

LaGree, Danielle Myers, 48 

Lamb, Chris, 54 

Lambiase, Jacqueline, 108, 151 

Landreville, Kristen, 66 

Landrum, Asheley, 107 

Lane, Daniel, 139, 172 

Lanier, Madison, 158 

Lanosga, Gerry, 152 

LaPoe, Victoria, 44 

Larson, Jan, 56 

Lauffer, Kimberly, 41, 76, 172, 197 

Lavaccare, JA, 89 

Lawson-Borders, Gracie, 94, 99 

Lawton, Kim, 162 

Lazard, Allison, 157 

Leach, Jan, 190 

Leask, Jennifer, 118 

Leavey, Sean, 136 

Leckey, Andrew, 150 

Lee-Won, Roselyn, 118 

Lee, Angela, 76 

Lee, Byung, 192 

Lee, ByungGu, 45 

Lee, Chul-joo, 44 

Lee, Chunsik, 87 

Lee, Claire Shinhea, 109, 159 

Lee, Donghee, 186 

Lee, Ejae, 115 

Lee, Eun Jeong, 110 

Lee, Hojeong, 150 

Lee, Hoon, 102 

Lee, Hyunmin, 145 

Lee, Jayeon (Janey), 66 

Lee, Ji Young, 197 

Lee, Jinhee, 86 

Lee, Jiyoung, 145 

Lee, Joonghwa, 156 

Lee, Kwang-Suk, 150 

Lee, Nicole, 59 

Lee, Sang (Sammy), 197 

Lee, Sangwon, 174 

Lee, Seow Ting, 45, 116 

Lee, SeoYoon, 86 

Lee, Seungae, 87 

Lee, Slgi, 172 

Lee, Sooyoung, 136 

Lee, Suman, 117 

Lee, Sun Young, 87, 106 

Lee, Sungkyu, 150 

Lee, Susanna, 88 

Lee, Tien-Tsung, 117 

Lee, Yen-I, 46, 117 

Lee, Yoon-Joo, 163 

Lee, YoungAh, 111, 185 

Lee, Yu Hao, 44 

Lehrer, Brian, 110, 144 

Lemos, Maria Carmen, 88 

Len-Ríos, María E., 70, 92, 116, 

147 

Leng, Shuang, 69 

Lepre, Carolyn Ringer, 48 

Lerner, Kevin, 47 

Leshner, Glenn, 172 

Leung, Louis, 156 

Levine, Grace F., 49 

Lewis, Norman, 77 

Lewis, Seth, 77 

Lewton, Kathleen Larey, 95 

Li, Cong, 157 

Li, Jianing, 66, 161 

Li, Jiayu, 161 

Li, Jo-Yun Queenie, 45, 106, 185 

Li, Lin, 114, 156 

Li, Minjie, 158, 174 

Li, Qin, 146 

Li, Ruobing, 87 

Li, Wenzhu, 44 

Li, Xigen, 74 

Li, You, 71, 77 

Li, Zheng, 76 

Li, Zhi, 68 

Li, Zongchao Cathy, 116 

Liang, Fan, 172 

Liang, Limin, 102, 160 

Liao, Menqi, 117 

Lieberman, David, 110 

Liebers, Nicole, 88, 153 

Lightman, Andrew, 138 

Lim, Darren, 60 

Lim, Joon Soo, 87 

Lim, Jungkyu Rhys, 115 

Lin, Carolyn, 50 

Lin, Zhiliang, 45 

Ling, Rich, 67, 71 

Liseblad, Madeleine, 111 

Littau, Jeremy, 52 

Liu, Bingjie, 75 

Liu, Brooke Fisher, 46, 116 

Liu, James H., 157, 158, 172 

Liu, Jiangmen, 157 

Liu, Jiawei, 45, 152 

Liu, Sixiao, 147 

Liu, Weidong, 69 

Liu, Weizi, 86 

Liu, Wenlin, 159, 197 

Liu, Yu, 118 

Liu, Yuchen, 157, 161 

Lo, Chen, 68 

Lo, Wai Han, 87 

Lodato, Mark, 154 

Logan, Kelty, 87, 135, 175 

Loke, Jaime, 197 

LoMonte, Frank, 60 

Longinow, Michael A., 54, 72, 162 

Loo, Boon Thau, 102 

Loof, Travis, 136 

Looney, Kristen, 161 

Lopes, Pedro, 194 

LoRusso, Susan, 188 

Loubere, Philip, 118, 173, 175, 

186, 192 

Lough, Kyser, 118 

Love, Brad, 157 

Lovric, Bruno, 136 

Lowe, Mira, 73 

Lowrey, Wilson, 74, 77 

Lu, Hang, 172 

Lu, Hang, 45 

Lu, Xinyu, 147, 155 

Lubbers, Charles, 42, 49 

Lubbers, Charles, 96 

Lubbers, Chuck, 29 

Luchsinge, Alex, 136


Lucshinger, Alex, 94 

Lueck, Therese, 102 

Luisi, Monique L. R., 137 

Luisi, Tim, 137 

Lukito, Josephine, 67, 119, 161 

Luo, Yi, 117 

Lutes, Thomas N., 78 

Luther, Catherine, 161 

Luttrell, Regina, 42 

Luviano, Janette, 92 

Lynch, Kristen, 157 

Lynn, Nyan, 111 

Lynnes, Jenny, 41 

M 

Ma, Liang (Lindsay), 116 

Ma, Yanni, 45 

Ma, Yingying, 67 

Ma, Zexin, 47 

Mabry-Flynn, Amanda, 46 

Macafee, Timothy, 67, 72 

Maciejewski, Jeffrey, 41 

Mackay, Jenn, 109, 114 

Madden, Stephanie, 42, 99, 116, 

197 

Maddox, Jessica Hennenfent, 59, 

93 

Madison, Ed, 186 

Madison, T. Phillip, 48 

Mahin, Stephanie, 23, 99 

Maibach, Ed, 104 

Maibach, Edward, 46 

Mak, Angela, 117 

Malakoff, David, 96 

Mallia, Karen, 185 

Malson, Jennifer, 117 

Mammadov, Rashad, 151 

Maresh-Fuehrer, Michelle, 96 

Mari, Will, 102 

Marino, Jacqueline, 59, 194 

Marken, Stephanie, 135 

Markin, Karen, 139 

Marquart, Franziska, 67, 158 

Marshall, Adam A., 71 

Marshall, Laura, 137 

Marshall, Stephen, 107 

Martin, Justin D., 50, 77, 85, 120, 

122, 159 

Martin, Vivian, 76 

Martinez, Michael, 110, 196 

Martins, Ralph, 159 

Martucci, Maria Clara, 97 

Máruqez-Ramírez, Mireya, 73 

Maslowska, Ewa, 155 

Mason, Debra, 149 

Mason, Everdeen, 89 

Mason, Nia, 46 

Matthes, Jörg, 66, 67, 88, 106, 

152, 158, 188, 194 

Mattingly, Justin, 47 

Mauro, Tony, 22 

Maxwell, Lindsey, 136, 192 

Maye, Carmen, 160 

Mayrhofer, Mira, 88, 188 

Mays, Kate, 157 

Mazandarani, Farnosh, 67 

Mazzeo, Christina, 107 

McBride, Kelly, 54 

McBride, Scott, 52 

McCaffrey, Raymond, 70 

McCarthy, Kate, 138 

McClaran, Nikki, 137 

McCluskey, Michael, 76, 77 

McCollough, Chris, 42, 155 

McConnell, Patrick, 68 

McCormack, Barbara, 161 

McCullough, Katie, 174 

McCutcheon, Chuck, 23 

McDuff, Daniel, 190 

McElroy, Kathleen, 99, 122 

McGeeney, Kyley, 135 

McGhee-Hilt, Felicia, 98 

McGregor, Shannon, 75 

McIntyre, Karen, 76 

McKay, Jenn, 186 

McKean, Mike, 163 

McKeever, Brooke Weberling, 75, 

92, 104, 155 

McKeever, Robert, 45, 58, 104, 

148 

McLaughlin, Bryan, 47, 119 

McLeod, Douglas, 45, 52, 152 

McMenamin, Dave, 78 

McMillan, Sally, 86 

McMorris, Crystal, 138 

McNealy, Jasmine, 23, 78, 94, 158 

Medvedeva, Yulia, 172 

Melillo, Wendy, 69, 100, 173 

Mellado, Claudia, 73 

Meltzer, Kimberly, 149 

Men, Rita, 116, 197 

Mena, Paul, 52 

Mendehall, Doug, 137 

Mendenhall, Doug, 146 

Mendenhall, Doug, 43 

Mendoza, Samantha, 47 

Meng, Juan, 45 

Meraz, Sharon, 173 

Mergerson, Christoph, 58 

Merlino, Sean, 147 

Messenger, Ashley, 153 

Messenger, Ashley, 22 

Metzgar, Emily T., 139 

Metzgar, Emily, 137 

Metzger-Riftkin, Jade, 98 

Metzger, Jade, 197 

Metzler, Meredith, 58, 75 

Meyer, Hans, 89 

Meyer, Heather, 174 

Meyer, Michaela, 109 

Meyers, Courtney, 88 

Michael, V. Michelle, 146 

Mick, Jacques, 73 

Midberry, Jennifer, 92 

Mielczarek, Natalia, 117, 159 

Miller, Barbara, 23 

Miller, Karen, 95 

Miller, Patrick, 117 

Mills, Brandale, 70 

Mindich, David T.Z., 79, 108, 150 

Mirer, Michael, 119, 154 

Mirza, Beth, 190 

Misak, John, 197 

Mishra, Suman, 102, 108, 135 

Mislan, Cristina, 196 

Mizgata, Jennifer, 175 

Mocarski, Richard, 147, 174 

Mohamed, Ali, 114 

Mohan, Chilukuri, 87 

Mokhtar, Shehram, 172 

Molina, Maria D., 52, 67, 148 

Molleda, Juan-Carlos, 41, 99 

Molyneux, Logan, 77 

Monicken, Hannah, 71 

Monroe, Bryan, 150 

Montero, Francisco, 92 

Montez, Daniel, 97 

Moody-Ramirez, Mia, 98, 104, 

135, 144, 148, 154, 177 

Moon, Bitt Beach, 45 

Index

218 


Moon, Ruth, 67, 74 

Moon, Won-ki, 106 

Moon, Young Eun, 71 

Moore, Rick, 21 

Moore, Tom, 94, 138 

Morales, Nikoleta, 109 

Morehouse, Jordan, 194 

Moretti, Anthony, 28, 29, 107, 

135, 163 

Morey, Alyssa, 158 

Morganfield, Robbie, 70, 196 

Morgoch, Meredith, 71 

Morris, David, 136 

Morrison, Deborah, 46 

Mortman, Howard, 54, 79, 96 

Morton, Lindsay, 188, 194 

Moscowitz, David, 136 

Moscowitz, Leigh, 102, 114, 159, 

192 

Mothes, Cornelia, 73 

Mourao, Rachel, 52, 97, 196 

Moy, Patricia, 70, 96, 110, 135 

Moya, Maria De, 119 

Muchangwe, Roberta, 28 

Mueller, Thomas, 136 

Mundel, Juan, 42, 87, 118, 157 

Munno, Greg, 77 

Musah, Zakaria Tanko, 104 

Mwangi, Samuel, 71 

Myers, Cayce, 78, 172 

Myers, Melina, 117 

Myers, Taryn, 98, 102 

Myrick, Jessica, 88, 93, 152, 188 

Myslik, Barbara, 66 

Myssayeva, Karlyga, 74 

N 

Naderer, Brigitte, 88, 158 

Naff, Kevin, 138 

Nah, Seungahn, 71 

Naland, Lucy, 47 

Nam, Siho, 150, 159 

Namkoong, Kang, 45 

Napoli, Phil, 172, 174 

Naqvi, S. Shageaa, 50, 77, 159 

Nastasia, Diana, 89 

Neill, Marlene, 115, 155 

Nekmat, Elmie, 97 

Nelson, Selena, 46, 88 

Neo, Rachel, 66 

Nespor, Cody, 186 

Netzley, Sara, 68 

Neumann, Dominik, 97 

Newell, Jay, 87 

Newton, Eric, 162 

Newton, Julianne H., 43, 108 

Ng, Margaret Yee Man, 96, 111 

Nguyen, Huyen, 42 

Nguyen, Nhung, 115 

Nguyen, Tham, 117 

Nicholson, June, 148 

Nielsen, Carolyn, 108 

Nieves, Yadira, 41 

Nikoulina, Anastasia, 48 

Nisbet, Erik, 159, 161 

Nisbett, Gwendelyn, 77, 174, 176 

Nissen, Shawn, 41 

Noland, Chris, 185 

Norman, Jean, 197 

Northup, Temple, 99 

Nulph, Robert G., 186 

O 

O’Boyle, Jane, 114, 136 

O’Connell, Michael, 89 

O’Donnell, Nicole, 44, 136, 161 

O’Hara, Kathryn, 46 

Oeldorf-Hirsch, Anne, 156 

Ofori-Parku, S. Senyo, 87 

Oh, Hyun Jee, 116 

Oh, Klive (Soo-Kwang), 156, 185 

Oketa, Kizito De-Paito, 28 

Oliver, Mary Beth, 152 

Oliver, Terence, 192 

Olivera, Dasniel, 73 

Olso, Lauren, 42 

Olson, Candi Carter, 71, 109, 120, 

123, 139, 192 

Olson, Kathy, 94 

Olson, Lauren, 42 

Onwumechili, Chuka, 117 

Onyebadi, Uche, 41 

Oquendo, Jacqueline, 42 

Orabi, Ahmed, 70 

Orloff, Katherine, 26 

Orme, Stephanie, 88 

Ortiz, Monica, 68 

Ortiz, Rebecca, 44, 152, 163 

Ou, Wanhua, 45 

Overton, Holly, 75, 104, 106, 122, 

139 

Oz, Mustafa, 157 

P 

Padovano, Cynthia Morton, 86 

Page, Janis, 66 

Page, Tyler, 95, 173 

Pain, Paromita, 102, 146 

Painter, Chad, 74, 120, 123 

Painter, David, 119, 136 

Palme, Griffin, 71 

Palmer, Erik, 108, 118 

Palmer, Linsday, 41, 104 

Palomba, Anthony, 48, 98 

Paluszek, John, 162 

Panagiotou, Nikos, 73 

Pande, Somava, 70 

Pang, Augustine, 117 

Pantic, Mirjana, 52 

Papper, Bob, 108 

Parameswaran, Radhika, 26, 89 

Parcells, Frank, 155 

Park, Chang Sup, 139, 156, 157 

Park, Chang Sup, 75, 76 

Park, Haseon, 156 

Park, Hee Sun, 185 

Park, Jaehee, 117 

Park, Keonyoung, 76, 155 

Park, Namkee, 148 

Park, Sanghee, 74, 136 

Park, Sun-Young, 87, 102 

Park, Sung Eun, 87 

Park, Sung Gwan, 118 

Park, Sung-Yeon, 188 

Park, Young Eun, 115 

Parks, Perry, 111, 145, 194 

Parrott, Scott, 43 

Parry, Pam, 26, 43, 137 

Parsloe, Sarah, 136 

Parsons, Christi, 79, 192 

Parsons, Patrick, 75 

Parsons, Paul, 54 

Passetti, Jeff, 47 

Pasti, Svetlana, 73 

Patnode, Randall, 119 

Patrow, Kristen, 111 

Patwardhan, Padmini, 100 

Patzer, Shaelyn, 46 

Paul, Subin, 43, 74, 97 

Pavlick, Kimberly, 60


Payne, Lisa Lyon, 197 

Pearson, George, 122, 153, 158 

Pearson, Kim, 108 

Peck, Abe, 160 

Pedersen, Jocelyn, 136 

Peeler, Lee, 98 

Peeling, Andrew, 190 

Pegoraro, Ann, 70 

Pei, Di, 46 

Peifer, Jason, 47, 66, 158 

Peko, Samantha, 146 

Pelled, Ayellet, 67, 119 

Pember, Sarah, 76 

Pena-y-Lillo, Macarena, 44 

Peng, Wei, 44, 158 

Penning, Tim, 117 

Pennington, Rosemary, 50 

Penny, Jay R., 147 

Perkins, Michelle, 70 

Perks, Ashley, 149 

Perlmutter, David D., 68, 118, 176 

Perreault, Gregory, 54, 75, 108, 

136, 149, 176, 192 

Perreault, Mimi, 146, 192 

Perry, Earnest L., 79, 95, 99, 138 

Perry, Stephen, 76 

Peruta, Adam, 47 

Peter, Christina, 66 

Peters, Jonathan, 22, 196 

Pettigrew, Justin, 50 

Peuchaud, Sheila, 56 

Pevehouse, Jon, 139 

Pfeiffer, Linda, 107 

Phalen, Patricia, 115 

Pham, Giang, 87, 155 

Phillips, Dara, 76 

Pitts, Gregory G., 153 

Pitts, Leonard, 151 

Pjesivac, Ivanka, 73 

Place, Katie, 42 

Plaisance, Patrick, 29, 50, 114, 

162 

Plowman, Kenneth, 117 

Poepsel, Mark, 115, 123, 173 

Poindexter, Paula, 93, 148 

Pollock, John, 114 

Pompper, Donnalyn, 137, 146 

Poniatowski, Kelly, 197 

Porter, Lance, 42, 96, 185 

Potter, Dana, 47, 161 

Potter, Robert, 48 

Potts, Lauren B, 139 

Powers, Angela, 68, 176 

Powers, Elia, 77, 153 

Powers, Shawn, 137 

Poznan, Kristina, 47, 161 

Pressgrove, Geah, 104, 116, 157 

Preston, Jennifer, 154 

Pribanic-Smith, Erika, 111 

Price, Gary, 96 

Prijatel, Frankie, 47 

Pritchard, Robert, 117 

Priyanka, Vidisha, 54 

Proffitt, Jennifer, 77 

Pruchniewska, Urszula, 109 

Punnett, Ian, 47 

Q 

Qin, Yufan, 116 

Quadra, Alberto, 173 

Quesenberry, Keith, 88 

Quint, Rachel, 87 

R 

Rada, James, 71, 147 

Radley, Elizabeth, 43 

Ragas, Matt, 78 

Rahmanian, Mona, 66 

Rakow, Lana, 89 

Ramaprasad, Jyotika, 74 

Randle, Quint, 41 

Rankin, Andrea, 68 

Ranta, Jeffrey, 192 

Rao, Aditi, 75 

Rashidi, Waleed, 174 

Rasmussen, Leslie, 42 

Rasul, Azmat, 192 

Rathbun-Grubb, Susan, 58 

Read, Glenna, 48 

Reavy, Matthew, 60 

Reed, Maryanne, 176 

Reed, Sada, 68 

Rego, Michelle, 155 

Rehman, Muhammad Muneeb Ur, 

147 

Reichert, Tom, 145 

Reid, Amanda, 94 

Reijven, Menno H., 109 

Reinardy, Scott, 110 

Relly, Jeannine, 137 

Renaud, Sally, 138 

Reuteman, Rob, 150 

Revers, Matthias, 74 

Reynolds, Amy, 22 

Reynolds, Chelsea, 152, 161 

Reynolds, Chelsea, 49, 98 

Reynolds, Christa, 108 

Rhodes, Nancy, 97 

Rhyne, Megan, 60 

Ri, Sung Yoon, 46 

Richard, Joby, 111 

Richards, Allen, 44 

Richardson, Allissa, 22 

Richardson, Finie, 98 

Rickard, Laura, 44 

Riffe, Daniel, 159, 194 

Rifon, Nora, 88 

Riley, Amy Henderson, 48 

Rim, Hyejoon, 106 

Ripka, Kevin, 46 

Risley, Ford, 29 

Rivas-Rodriquez, Maggie, 99, 148 

Roberts, Chris, 154 

Roberts, Shearon, 146 

Robertson, Bridgett, 106 

Robertson, Craig, 52 

Robinson, Katy, 67 

Robinson, Melissa, 47, 139 

Robinson, Sue, 71, 79, 102 

Rochadiat, Annisa Meirita, 47, 66 

Rodgers, Ronald R., 194 

Rodriguez, Clemencia, 150 

Rodriguez, Julian, 97 

Rodriguez, Nathian, 79, 99 

Roessner, Lori Amber, 146, 160 

Rogers, Dana, 155 

Rogerson, Ken, 161 

Rogus, Mary, 149 

Roguski, Randy, 54 

Rohn, Ulrike, 58 

Roman, Nataliya, 159 

Romney, Miles, 70 

Roncal, Rafael, 138 

Rong Wang, 159 

Rony, Md Main Uddin, 77 

Roschke, Kristy, 162 

Rose, Janet, 192 

Rosenstiel, Tom, 56 

Roskos, Joseph, 92 

Rosso, Teri Del, 197 

Index

The William Allen White School of Journalism 

and Mass Communications is proud to 

celebrate the 150th birth year of the namesake 

of our school. The foundation of our 

instruction is based on the skills, passion 

and integrity demonstrated throughout 

the career of William Allen White.


Rouse, Krista, 52 

Roush, Chris, 85, 149 

Rousselle, Hayley, 114 

Roy, Enakshi, 159, 196 

Royal, Cindy, 58 

Rush, Stephen, 67, 75, 87 

Russell, Frank, 157 

Russial, John, 77, 156 

Russomanno, Joseph, 47, 56 

Ryfe, David, 124 

Ryoo, Yuhosua, 88 

S 

Sachs, Tobias, 114 

Sadler, Jennifer, 56 

Saeed, Marium, 45 

Saffer, Adam, 157 

Sahly, Abdulsamad, 138 

Saks, Jeremy, 159 

Salahi, Lara, 26 

Salamon, Errol, 194 

Saldana, Magdalena, 114 

Saleh, Elamnira Samah, 28 

Salkin, Erica, 70 

Salmon, Charles, 74, 156 

Samson, Lelia, 186 

Sanders, Megan S., 48, 99 

Santana, Arthur, 77 

Santiago, Michael, 47 

Sar, Sela, 88, 155 

Sarabia-Panol, Zeny, 74 

Sarge, Melanie, 23, 85, 120, 123 

Sari, Miles, 138 

Saunders, Kyle, 73 

Sauter, Claire, 148 

Schaffer, Jan, 95 

Scharlott, Bradford, 146 

Schauster, Erin, 115 

Scherr, Sebastian, 158, 185 

Scherr, Sebastian, 67 

Schmierbach, Michael, 88, 157 

Schmuck, Desiree, 66, 158, 194 

Schneeweis, Adina, 67 

Schoenbach, Klaus, 45 

Schreiber, Holly E., 188 

Schroeder, Jared, 22, 94, 111 

Schultz, Cindy Price, 42 

Schutz, Emily, 47 

Schwalbe, Carol, 59, 149 

Schwartz, Brad, 108 

Schwartz, Joseph, 102 

Schwartz, Lauren, 109 

Scott, Andrea, 162 

Scott, Andrew P., 149 

Scott, David, 22, 43, 50 

Scott, Glenn, 151 

Seely, Natalee, 76, 160, 197 

Seethaler, Josef, 139 

Segijn, Claire, 157 

Self, Charles, 110 

Semati, Mehdi, 66 

Seo, Hyunjin, 157, 161, 190 

Seo, Mihye, 158 

Seroka, Laura, 75 

Serrano, Monica, 173 

Sewell, John, 136 

Sha, Bey-Ling, 29, 85, 92 

Shaban, Sara, 136, 196 

Shafer, Jack, 153 

Shafi, Ashik, 66, 146, 158 

Shah, Dhavan, 67, 139 

Shah, Hemant, 124 

Shahin, Saif, 75 

Shao, Chun, 67, 136, 138 

Shao, Ruosi, 88, 110 

Shaw, Donald, 173 

Shay, Ronen, 58, 92, 148 

Shayesteh, Fatemeh, 161 

Sheehan, Kim, 48 

Shelton, Summer, 88, 147, 157 

Shemberger, Melony, 146, 192 

Shen, Cuihua, 156 

Shen, Fei, 67 

Shen, Fuyuan, 97, 137, 158 

Shen, Hongmei, 116, 117 

Shen, Jie (Doreen), 50, 155 

Shen, Liwei, 172 

Shepard, Jason M., 148, 152, 192 

Shepherd, Alicia, 109 

Shermak, Jeremy, 52, 172 

Sherrick, Brett, 87 

Sherrill, Lindsey, 74, 77 

Shi, Jian, 56 

Shi, Lin, 56 

Shiau, Hong-Chi, 102 

Shih, Ching (Jina), 97 

Shih, Tsung-Jen, 44, 45 

Shim, KyuJin, 115, 185 

Shin, Jae-Hwa, 196 

Shin, Soo Young, 52 

Shin, Sumin, 45 

Shin, Wonsun, 88 

Shockley, Linda, 162 

Shogren, Elizabeth, 96 

Shoop, Julie, 190 

Shrader, John, 94 

Siegel, Paul, 114 

Sikorski, Christian von, 66, 67, 

158, 194 

Silcock, Bill, 162 

Silimeno, Debra, 23 

Silke, Henry, 73 

Silva, David, 110 

Silver, Derigan, 98 

Silverman, Deborah, 26 

Simmons, Jazmyne, 158 

Simmons, Tracy, 79 

Simon-Roberts, Sharifa, 94 

Simpson, Edgar, 104 

Sindik, Amy, 118 

Singer, Jane B., 52, 159 

Sipes, Carrie, 26 

Sisco, Hilary, 115 

Sisson, Diana, 42, 116 

Sites, Joshua, 48 

Skupski, Ian, 163 

Slater, Jan, 26, 49 

Slater, Michael, 124 

Smalls, Morgan, 94 

Smethers, Steven, 71 

Smith-Frigerio, Sarah, 145 

Smith, Brooke, 155 

Smith, Carrie Brown, 186 

Smith, Christin, 70 

Smith, Christina, 138, 190 

Smith, David, 47 

Smith, Dean, 196 

Smith, Elizabeth, 197 

Smith, Jessica, 85, 97, 119 

Smith, Laura, 41, 94, 137 

Smith, Marquita, 43, 71, 123 

Smith, Michael, 26 

Smolla, Rodney, 152 

Snyder, Rebecca, 60 

Soares, Isabel, 194 

Sobel, Meghan, 159 

Sofiya, Tarasevich, 66 

Sohn, Youngju (YJ), 86 

Solomon, Jon, 94 

Solomon, Stephen, 56 

Index

222 


Somani, Indira, 66 

Song, Yunya, 88 

Sousa, Tiany, 185 

Sparks, Colin, 74 

Speakman, Burton, 66, 174 

Spencer, Larisa, 147 

Spring, Robin, 163 

Springer, Nina, 52 

Srinivasan, Preeti, 156 

Srivastava, Jatin, 73, 137 

Stalker, Jordan, 107, 163 

Stamm, Jason, 68 

Stanfield, Kellie, 162 

Stanley, Samantha, 45 

Staub, Catherine M., 47, 59, 108, 

114 

Steffan, Brian, 72, 109, 186 

Steiner, Linda, 49, 89, 138, 161, 

162 

Steinhardt, Joseph, 137 

Steinke, Jocelyn, 147 

Stephens, Bryan, 190 

Stepinska, Agnieszka, 74 

Sternadori, Miglena, 47, 50, 59, 

116, 118 

Stevens, Renée, 47 

Steward, Mizell, 78 

Stewart, Daxton “Chip”, 78, 111 

Stewart, James, 73 

Stewart, Margaret, 159 

Stewart, Mizell, 69, 106 

Stewart, Sam, 26 

Stilwell, Matthew, 67, 114 

Stoker, Kevin, 92, 102 

Stokes, Ethan, 67 

Stoldt, Ryan, 153 

Storlie, Brandon, 146 

Storm, Colin, 146 

Stoycheff, Elizabeth, 66, 79, 97 

Straub, Catherine M., 190 

Strode, Tom, 71 

Strong, Bruce, 47 

Strong, Catherine, 118 

Struthers, Amy, 192 

Stur, Heloisa Aruth, 59 

Sturgill, Amanda, 56 

Su, Linsen, 74 

Su, Min-Hsin, 119 

Su, Xianglin, 45 

Su, Yan, 89 

Suarez, Andrea, 192 

Subervi, Federico, 70, 73, 138 

Sude, Daniel, 139, 158, 185 

Sueiro, José, 190 

Suk, Jiyoun, 119, 139 

Sun, Qiusi, 156 

Sun, Ruoyu, 45 

Sundar, S. Shyam, 52 

Supa, Dustin, 145 

Suresh, Sushanth, 87 

Susca, Margot, 77 

Swain, Bethany, 72 

Swanson, Doug, 192 

Sweeter, Janice, 197 

Sweitzer, Matthew, 196 

Szabo, Gabriella, 74 

T 

Tachoir, Erica Clarke, 176 

Tait, Gabriel, 42, 92, 108, 149, 

175 

Takahashi, Bruno, 41, 44, 46 

Tallapragada, Meghnaa, 93 

Tallent, Rebecca, 44 

Tamaddoni, Ali, 155 

Tamboer, Sanne, 118 

Tamul, Daniel, 152, 158 

Tandoc, Edson C., 22, 52, 60, 67, 

71, 74, 115, 156, 177 

Taneja, Harsh, 58 

Tang, Lipei, 157 

Tang, Ning, 68 

Tang, Shuo, 56 

Tanikawa, Miki, 74, 136 

Tanner, Andrea, 145 

Tao, Weiting, 116 

Tarasevic, Sofiya, 74 

Tatge, Mark, 58 

Taylor, Rob, 54 

Taylor, Ron, 47 

Taylor, Ross, 43, 161 

Tebben, Susan, 74 

Tefertiller, Alec, 48, 75, 136, 174, 

192 

Telhami, Shibley, 50 

Tenenboim, Ori, 52 

Terracina-Hartman, Carol, 186 

Terry, Christopher, 70 

Texidor, Michael, 150 

Tham, Samuel M., 75, 76, 147 

Thelen, Patrick, 67, 155 

Thevney, Karen, 28, 49, 106 

Thomas-Lee, Laurie, 70 

Thomas, Clarence W., 48 

Thomas, Etan, 154 

Thomas, Ryan, 104 

Thompson, Pat, 43 

Thomson, T.J., 118 

Thornton, Leslie-Jean, 192 

Thornton, Matthew, 138 

Thorson, Esther, 66, 74, 147, 160 

Thorson, Kjerstin, 89, 97, 139 

Timm, Kristin, 88, 104 

Tindall, Natalie T.J., 79, 104 

Tobin, Chuck, 22 

Tomasovic, Susan, 106 

Toth, Elizabeth L., 95 

Townsend, Katie, 22 

Trammell, Jim Y., 146 

Treaster, Joseph, 23 

Treise, Debbie, 147, 157 

Trotochaud, Marc, 46 

Trumpbour, Bob, 102, 151 

Truong, Elite, 69 

Tsai, Jiun-Yi, 197 

Tsai, Wanhsiu Sunny, 116 

Tu, Caixie, 48 

Tu, Lingbo, 68 

Tully, Melissa, 60, 153 

Turcotte, Jason, 157 

Turner, John, 153 

Turner, Karen, 66, 149, 150 

Twohey, Megan, 106 

U 

Ugland, Erik, 98, 160 

Umejei, Emeka, 102 

Urch, Kakie, 89 

Usher, Nikki, 23, 50, 60, 72 

Utt, Sandra, 29, 77 

Uysal, Nur, 42 

V 

Vafeiadis, Michail, 87, 106, 117 

Valdivia, Angharad, 89 

Valenzano, Joseph, 43 

Vallina, Joe, 190 

Vancour, Vanessa, 89 

Vardeman-Winter, Jen, 52 

Vargo, Chris, 146, 161, 173


Vasudevan, Krishnan, 194 

Vedak, Anuj, 69 

Veenstra, Aaron S., 97, 119 

Velez, John, 47 

Venger, Olesya, 111 

Venrooij, Iris Van, 114 

Vergara, Gonzalo Saavedra, 194 

Veto, Matt, 59 

Victoria Knight, 73 

Vincent, Cindy, 60, 102 

Vincent, Hal, 21, 50, 150 

Vining, Austin, 148 

Vitak, Jessica, 161, 196 

Voakes, Paul S., 54, 110 

Volz, Yong, 56, 104, 151 

Vos, Tim, 52, 72, 104, 108 

Vraga, Emily, 60, 139, 161 

Vu, Hong Tien, 115, 157, 159, 

161, 188 

Vukasovich, Christian, 136 

W 

Waddell, Julia, 60 

Waddell, T. Franklin, 75, 152 

Wagler, Adam, 100 

Wagner, A.Jay, 196 

Wagner, Michael, 66 

Wagner, Phil, 137 

Waheed, Moniza, 74, 76 

Waisbord, Silvio R., 95 

Waite, Matt, 23 

Walcott, Carolyn, 102 

Walden, Justin, 29 

Walker, Tara, 44 

Wallace, Julia, 196 

Wallace, Ryan, 145 

Walsh-Childers, Kim, 139 

Walter, Mike, 72 

Walter, Patrick, 188 

Wan, Anan, 155, 159 

Wang, Bryan, 158 

Wang, Dapeng, 56 

Wang, Haiyan, 74 

Wang, Jingwen, 69 

Wang, Jinping, 46, 148 

Wang, Luping, 89 

Wang, Meredith, 146 

Wang, Qun, 58, 148, 174 

Wang, Rang, 115 

Wang, Rui, 96 

Wang, Ruowen, 87 

Wang, Ruoxu, 60, 97 

Wang, Shaojung Sharon, 157, 174 

Wang, Song, 119 

Wang, Weirui, 118 

Wang, Yanyun, 88 

Wang, Ye, 87 

Wang, Yidong, 102 

Wanta, Wayne, 172, 173 

Ward, Jamie, 42 

Ward, Ken, 154 

Ward, Stephen, 44 

Warner, Anna, 117 

Warner, Mary, 190 

Warren, Jodie, 69 

Warren, Stephen, 109, 174 

Wasbotten, Thor, 73, 106 

Wasike, Ben, 138 

Waters, Leslie, 47, 161 

Waters, Richard D., 86, 137, 163, 

186 

Waters, Stephenson, 50 

Watson, Brendan, 114 

Watson, John C., 78, 153, 162 

Watson, Josh, 174 

Wayne, Leslie, 150 

Weaver, David, 173 

Webb, Amy, 43 

Webb, Sheila, 173 

Weber, Matthew, 44, 172, 174 

Weed, Amanda, 26, 42, 100 

Weeks, Brian, 139, 172 

Wei, Lewen, 75, 88, 148 

Weijers, Addy, 174 

Weinhold, Wendy, 196 

Weisenreder, Bridget, 190 

Weiss, Amy Schmitz, 68, 77, 152 

Weissman, Paula, 44 

Welker, Kristin, 79 

Wellman, Mariah, 153 

Wells, Chris, 119, 139, 161 

Wells, Rob, 102, 150 

Welter, Tamara, 117 

Wen, Nainan, 45 

Wen, Taylor Jing, 97, 155, 172, 

185 

Wenger, Deb, 26 

Wenger, Debora Rae, 108 

Wenzel, Andrea, 71 

Wesner, Kearston, 75 

Westerwick, Axel, 139 

Whang, Haesung (Claire), 147 

Whipple, Kelsey, 52, 136, 137, 

156 

Whitaker, Nicholas, 26, 43, 54, 

152 

White, Shawna, 59 

Whitenack, Stephanie, 46, 48, 111 

Whiteside, Erin, 68 

Wicks, Jan, 116 

Wihbey, John, 77 

Wilderman, Melanie, 118, 174 

Wilkins, Lee, 98, 104, 138 

Wilkinson, Kent, 92 

Williams-Hawkins, Maria, 97 

Williams, Miya, 66 

Williams, Reid, 89 

Williams, Sonja, 66 

Williams, Vern, 23 

Willis, Erin, 74 

Willis, Laura, 42 

Willnat, Lars, 56 

Willoughby, Jessica, 188 

Wilson, Bradley, 118 

Wilson, Christopher, 60, 155, 197 

Wilson, Mary, 148 

Wirth, Mike, 122, 190 

Wirtz, John, 155, 186 

Witsen, Anthony Van, 44 

Wojdynski, Bartosz, 77, 117, 148, 

192 

Wolf, Jordan, 158 

Wolfgang, David, 52 

Wollney, Easton, 118, 147, 157 

Wolter, Lisa-Charlotte, 58, 190 

Wong, Sara, 47 

Woodruff, Nathan, 147, 174 

Woods, Chelsea, 117 

Woong, Gi Yun, 136 

Workneh, Tewodros, 136 

Wright, Donald, 144 

Wright, Kaitlyn, 48 

Wright, Matthew, 23 

Wu, Angela Xiao, 158 

Wu, Denis, 75 

Wu, Linwan, 87, 97, 116, 155 

Wu, Shangyuan, 74, 156 

Wu, Tai-Yee, 97 

Wu, Yin, 119 

Wu, Yue, 56, 67 

Index

224 


Wulfemeyer, K. Tim, 147 

Wyatt, Wendy, 106, 162 

Wyke, Jill Van, 23, 47, 59 

X 

Xia, Chuanli, 67 

Xia, Yiping, 119, 161 

Xiao, Anli, 87, 117 

Xiao, Xizhu, 44 

Xie, Lei “Tommy”, 59 

Xie, Quan, 87, 185 

Xie, Wenjing, 97 

Xiong, Ying, 115 

Xu, Dongqing, 77 

Xu, Qian, 88 

Xu, Qingru, 49, 109 

Xu, Shan, 157 

Xu, Weiai (Wayne), 66, 197 

Xu, Xiaohan, 117 

Xu, Xiaowen, 97 

Xue, Fei, 88, 92, 185 

Y 

Yagatich, William, 104 

Yamamoto, Masahiro, 139, 146 

Yan, Lifeng, 68 

Yan, Yan, 136 

Yang, Aimei, 116, 159 

Yang, Fan, 60, 97, 158 

Yang, Fang (Faye), 163 

Yang, Guolan, 87 

Yang, Hyun, 110 

Yang, Janet, 52, 93, 147 

Yang, Jing, 87 

Yang, Junghwan, 67 

Yang, Kenneth C.C., 156 

Yang, Sung-Un, 45, 115 

Yang, Xiaodong, 88 

Yang, Xiaoxu, 146 

Yang, Yiyi, 76 

Yanity, Molly, 122, 154 

Yao, Shengjie, 77 

Yaros, Ronald, 89, 156, 197 

Yaschur, Carolyn, 59, 118 

Yeo, Jerome, 117 

Yeo, Sara, 106 

Yeo, Su Lin, 117 

Yook, Bora, 116 

Youm, Kyu Ho, 22, 154 

Youn, Seounmi, 88 

Young, Rachel, 92, 147, 186 

Youngnyo, Joa Claire, 136 

Yousuf, Mohammad, 77, 115 

Yu, Jay (Hyunjae), 150 

Yu, Nan, 75, 88 

Yu, Panfeng, 109 

Yuan, Shupei, 46, 88 

Yue, Cen April, 67, 153, 197 

Yun, Gi Woong, 60, 156, 185 

Z 

Zarracina, Javier, 173 

Zboray, Mary Saracino, 173 

Zboray, Ronald J., 173 

Zeltner, Mark, 186 

Zeng, Xiangmin, 68 

Zenner, Shannon, 92 

Zenor, Jason, 192 

Zhang, Ai, 78 

Zhang, Bingbing, 118 

Zhang, Congcong, 109 

Zhang, Guanjin, 157 

Zhang, Hongzhong, 56 

Zhang, Jun, 76 

Zhang, Nanlan, 106, 155, 172 

Zhang, Wanjiang, 136 

Zhang, Weiwu, 54, 100 

Zhang, Xiaochen, 116 

Zhang, Xiaoqun, 158 

Zhang, Xu, 56 

Zhang, Xueying, 76, 116 

Zhang, Yini, 119 

Zhang, Yiyan, 75 

Zhang, Yiyang, 56 

Zhang, Zhi’an, 56 

Zhao, Wen, 87, 163 

Zhao, Xin, 28 

Zhao, Yunze, 68 

Zheng, Pei, 41 

Zheng, Yanan, 68 

Zheng, Yue, 102 

Zhi, Li, 160 

Zhong, Bu, 56 

Zhong, Qiankun, 67 

Zhou, Enze, 45 

Zhou, Lijie, 92, 185 

Zhou, Shuhua, 56, 68 

Zhou, Ziyuan, 116 

Zhuang, Jun, 52 

Zibluk, Jack, 29 

Zimmerman, Mark, 71 

Zlaten, Rhema, 41 

Zúñiga, Homero Gil de, 75, 157, 

158, 172 

Zwickle, Adam, 46

CONGRATS TO 

OUR NEWLY 

TENURED 

FACULTY: 

Brian Ekdale 

Melissa Tully 

WELCOME: 

Jessica Moorman 

PhD Candidate, 

Michigan 

Happy Retirement to Professor 

Dan Berkowitz. 

Dan joined the School 

in 1988. 

He has held positions 

as Director of Graduate 

Studies and Associate 

Dean of Graduate 

Studies 

PHD/MA 

GRADUATES: 

David Tuwei 

Qi Ling 

Mariah Wellman 

2018 INCOMING 

PHD/MA 

STUDENTS: 

Mir Ashfaquzzaman 

Abby Rinaldi 

Omotola Abraham

Save the Date! 

read 

watch 

listen 

like 

tweet 

post 

comment 

link 

share 

discuss 

engage 

LET’S ENGAGE WITH NEWS! 

Celebrate News Engagement Day, 

Tuesday, Oct. 2, 2018. 

The Association for Education in 


founded News Engagement Day on 

Oct. 7, 2014. AEJMC is working with 

schools and universities; local, social, 

and national media; and civic, 

educational, and community groups to 

celebrate News Engagement Day. 

Help show current and future 

generations that being informed is 

empowering, enjoyable, and 

essential for a healthy democracy. 

For more information and to get 

involved, contact Paula Poindexter, 

News Engagement Day Chair, 

paula.poindexter@austin.utexas.edu. 

newsengagement.org

AT MEMPHIS, WE’RE 

DRIVEN BY DOING. 

DIVERSE. CONNECTED. URBAN. 

CUTTING EDGE. WORLD-TRAVELED. 

The University of Memphis embraces its metropolitan setting 

with connections to local Fortune 500 companies, St. Jude 

Children’s Research Hospital, local media, advertising and 

public relations agencies and community organizations. 

This year, we had two graduate students win 

university-wide awards for outstanding research. 

We have the largest enrollment in our history. We 

have two scholars working abroad this summer 

and two others producing a grant-funded 

documentary about Memphis and the Civil 

Rights Movement. 

We’re driven by doing, and we’re doing 

more to succeed every day. 

__________________________________________ 

Journalism major Jon Bell interviews new 

University of Memphis men’s basketball 

coach Penny Hardaway at the FedEx St. 

Jude Classic as part of his internship. 


to Journalism and 

Strategic Media 

assistant chair 

Dr. Sandra Utt on 

her retirement 

in May 2019 from 

the University of 

Memphis. 


to Dr. Melissa 

Janoske for 

winning UofM’s 

inaugural Linda & 

Steve Simon Family 


Fellowship. 

WELCOME! 

to Dr. Teri Del 

Rosso as an 

assistant professor 

of public relations. 

Dr. Del Rosso 

earned her Ph.D. 

from the University 

of Oregon in 2016. 

The University of Memphis is an Equal Opportunity/ 

Affirmative Action University. It is committed to 

education of a non-racially identifiable student body. 

Driven by doing.

Presidents 

229 

American Association of Teachers 

of Journalism 1912-1950 

1912 Willard G. Bleyer, Wisconsin 

1913 Talcott Williams, Columbia 

1914 Merle Thorpe, Kansas 

1915 Merle Thorpe, Kansas 

1916 James M. Lee, New York U. 

1917 Fred N. Scott, Michigan 

1918 Wartime, no convention 

1919 Wartime, no convention 

1920 H.F. Harrington, Northwestern 

1921 Willard G. Bleyer, Wisconsin 

1922 E.W. Smith, Stanford 

1923 F.W. Beckman, Iowa State 

1924 J.W. Piercy, Indiana 

1925 N.A. Crawford, Kansas State 

1926 M.G. Osborn, Louisiana State 

1927 F.J. Lazell, Iowa 

1928 Grant M. Hyde, Wisconsin 

1929 E. Marion Johnson, Minnesota 

1930 John E. Drewry, Georgia 

1931 Lawrence R. Murphy, Illinois 

1932 Ralph L. Crosman, Colorado 

1933 Ralph L. Crosman, Colorado 

1934 William L. Mapel, Washington & Lee 

1935 Kenneth E. Olson, Northwestern 

1936 C. Gayle Walker, Nebraska 

1937 Blair Converse, Iowa State 

1938 Edward N. Doan, Ohio State 

1939 Charles L. Allen, Northwestern 

1940 Charles L. Allen, Northwestern 

1941 Ralph O. Nafziger, Minnesota 

1942 Douglass W. Miller, Syracuse 

1943 Douglass W. Miller, Syracuse 

1944 Frederic E. Merwin, Rutgers 

1945 Frederic E. Merwin, Rutgers 

1946 Curtis D. MacDougall, Northwestern 

1947 Marcus M. Wilkerson, Louisiana State 

1948 Roland E. Wolseley, Syracuse 

1949 A. Gayle Waldrop, Colorado 

1950 Henry Ladd Smith, Wisconsin 


1951-1982 

1951 Ralph O. Nafziger, Wisconsin 

1952 J. Edward Gerald, Minnesota 

1953 Earl English, Missouri 

1954 George E. Simmons, Tulane 

1955 Roscoe Ellard, Columbia 

1956 Kenneth R. Marvin, Iowa State 

1957 Norval N. Luxon, North Carolina 

1958 Warren K. Agee, Texas Christian 

1959 Mitchell V. Charnley, Minnesota 

1960 Fred S. Siebert, Illinois 

1961 Charles T. Duncan, Oregon 

1962 Kenneth N. Stewart, California-Berkeley 

1963 Theodore E. Peterson, Illinois 

1964 William E. Porter, Michigan 

1965 Edward W. Barrett, Columbia 

1966 DeWitt C. Reddick, Texas 

1967 Harold L. Nelson, Wisconsin 

1968 Robert L. Jones, Minnesota 

1969 James W. Schwartz, Iowa State 

1970 William E. Ames, Washington 

1971 Wayne Danielson, Texas 

1972 Hillier Krieghbaum, New York U. 

1973 R. Neale Copple, Nebraska 

1974 Bruce H. Westley, Kentucky 

1975 Edwin Emery, Minnesota 

1976 Edward Bassett, Southern Cal 

1977 Kenneth Devol, California State, Northridge 

1978 James Carey, Iowa 

1979 Mary A. Gardner, Michigan State 

1980 Richard G. Gray, Indiana 

1981 Del Brinkman, Kansas 

1982 Kenneth Starck, Iowa 



1983- 

1983 Richard Cole, North Carolina 

1984 Everette Dennis, Oregon 

1985 Douglas Ann Newsom, Texas Christian 

1986 Dwight L. Teeter, Jr., Texas at Austin 

1987 Sharon M. Murphy, Marquette 

1988 David H. Weaver, Indiana 

1989 Thomas A. Bowers, North Carolina 

1990 MaryAnn Yodelis Smith, Wisconsin Centers 

1991 Ralph Lowenstein, Florida 

1992 Terry Hynes, California State, Fullerton 

1993 Tony Atwater, Rutgers 

1994 Maurine Beasley, Maryland 

1995 Judy VanSlyke Turk, South Carolina 

1996 Pamela J. Shoemaker, Syracuse 

1997 Alexis Tan, Washington State 

1998 Stephen R. Lacy, Michigan State 

1999 Lillian Lodge Kopenhaver, Florida International 

2000 Marilyn Kern-Foxworth, Texas A&M 

2001 Will Norton, Jr., Nebraska-Lincoln 

2002 Joe S. Foote, Arizona State 

2003 Theodore L. Glasser, Stanford 

2004 Jannette L. Dates, Howard 

2005 Mary Alice Shaver, Central Florida 

2006 Sharon Dunwoody, Wisconsin-Madison 

(continued on next page)

230 

Presidents (Continued) 

2007 Wayne Wanta, Missouri-Columbia 

2008 Charles C. Self, Oklahoma 

2009 Barbara B. Hines, Howard 

2010 Carol J. Pardun, South Carolina 

2011 Jan Slater, Illinois at Urbana 

2012 Linda Steiner, Maryland 

2013 Kyu Ho Youm, Oregon 

2014 Paula M. Poindexter, Texas at Austin 

2015 Elizabeth L. Toth, Maryland 

2016 Lori Bergen, Colorado-Boulder 

2017 Paul Voakes, Colorado-Boulder 

2018 Jennifer D. Greer, Alabama 

ANNOUNCING THE ISOJ 2019 CALL FOR RESEARCH 

Special Theme Issue for #ISOJ Journal: 

Digital Media and Democracy in the Americas 

Guest Edited by: 

Dr. Pablo Boczkowski, Northwestern University (USA) 

Dr. Eugenia Mitchelstein, Universidad de San Andres (Argentina) 

Extended Abstracts Due: August 15, 2018 | Full details of call at isoj.org/research

AEJMC Award Recipients 

231 

Krieghbaum Under-40 Award 

This award was created and funded by the late Hillier 

Krieghbaum, New York, a long-time AEJMC member and 

a past president, to honor AEJMC members under 40 

years of age who have shown outstanding achievement 

and effort in AEJMC’s three key areas: teaching, research 

and public service. Annual award. 

2018 Shirley S. Ho, Nanyang Technological 

2017 Jakob D. Jensen, Utah 

2016 Jörg Matthes, Vienna 

2015 Homero Gil de Zùñiga, Vienna 

2014 Yan Jin, Virginia Commonwealth 

2013 John Besley, Michigan State 

2012 Susan Robinson, Wisconsin-Madison 

2011 Sri Kalyanaraman, North Carolina at Chapel Hill 

2010 Dietram Scheufele, Wisconsin-Madison 

2009 Kimberly Bissell, Alabama 

2008 Patricia Moy, Washington 

2007 William P. Eveland, Jr., Ohio State 

2006 David S. Domke, Washington 

2005 Dhavan V. Shah, Wisconsin-Madison 

2004 Clay Calvert, Pennsylvania State 

2003 Julie Andsager, Washington State 

2002 David T.Z. Mindich, Saint Michael’s 

2001 Erica Weintraub Austin, Washington State 

2000 Carolyn Kitch, Temple 

1999 David Atkin, Cleveland State 

1998 Edward Adams, Angelo State 

1997 Annie Lang, Indiana 

1996 John Ferré, Louisville 

1995 Wayne Wanta, Oregon 

1994 Stephen D. Reese, Texas at Austin 

1993 Marilyn Kern-Foxworth, Texas A&M 

1992 Carroll Glynn, Cornell 

1991 Jeff Smith, Iowa 

1990 Pamela Shoemaker, Texas at Austin 

1989 Robert Drechsel, Wisconsin-Madison 

1988 Jane D. Brown, North Carolina 

1987 Theodore Glasser, Minnesota 


1985 Lee Becker, Ohio State 

1984 Ellen Wartella, Illinois 

1983 David Weaver, Indiana 

1982 Everette Dennis, Oregon 

1981 David Rubin, New York (first) 

Baskett Mosse Award for Faculty 

Development 

The Baskett Mosse Award was created by AEJMC 

and the Accrediting Council on Education in Journalism 

and Mass Communications in honor of the late Baskett 

Mosse, executive secretary of the Accrediting Committee 

for 26 years. The award recognizes an outstanding young 

or mid-career faculty member and helps fund a proposed 

enrichment activity. Not an annual award. 

2017 Janice Collins, Illinois 

2015 Kim Smith, North Carolina A&T 

2013 Homero Gil de Zuniga, Texas at Austin 

2011 Murgur Geana, Kansas 

2009 Barbara Friedman, North Carolina 

2005 Robert Kerr, Oklahoma 

2003 Sandra Chance, Florida 

2002 Laura Castañeda, Southern California 

2001 Andrew Mendelson, Temple 

2000 Jan LeBlanc Wicks, Arkansas-Fayetteville 

1999 Debashis Aikat, North Carolina 

1998 Lauren Tucker, South Carolina 

1996 Sue A. Lafky, Iowa 

1995 Kathleen Fearn-Banks, Washington 

1994 Laurence B. Alexander, Florida 

1993 Glen Cameron, Georgia 

1992 Joy Morrison, Alaska-Fairbanks 

1991 Lael Morgan, Alaska-Fairbanks 

1990 C. Zoe Smith, Marquette 

1989 Stephen R. Lacy, Michigan State 

Charles Salmon, Wisconsin-Madison 

1988 Terry Hynes, California State, Fullerton 

1987 Tony Atwater, Michigan State 

1986 Patrick S. Washburn, Ohio 

1985 Margaret Ann Blanchard, North Carolina 

1984 Donna Lee Dickerson, South Florida (first) 

AEJMC Presidential Award 

Given to dedicated and long-serving AEJMC members 

by the current AEJMC president. The award recognizes distinguished 

service to journalism and mass communication 

education. Presented on an as-appropriate basis. 


2016 Barbara Hines, Howard 

2015 Pam Bourland-Davis, Georgia Southern 

2014 Carolyn Stroman, Howard 

2013 Douglas Anderson, Pennsylvania State 

2012 David T.Z. Mindich, St. Michael’s 

2010 Suzette Heiman, Missouri 

2009 Candace Perkins Bowen, Kent State 

Alexis Tan, Washington State 

2008 Keith Sanders, Missouri 

Silvia Pellegrini, Pontificia Universidad 

Catolica de Chile, Santiago 

2007 Donald Shaw, North Carolina at Chapel Hill 

Maxwell McCombs, Texas at Austin 


Cleveland Wilhoit, Indiana 

2005 Kim Rotzell, Illinois (posthumously) 

2004 Lee Becker, Georgia 

Trevor Brown, Indiana

232 

AEJMC Award Recipients (Continued) 

2003 James Carey, Columbia 

Clifford Christians, Illinois 

2002 Terry Michael, Washington Center for Politics 

and Journalism 

Roberta Win, Voice of America 

2001 Susanne Shaw, Kansas 

David McHam, Houston 

2000 Karen Brown Dunlap, Poynter Institute 

Oscar Gandy, Pennsylvania 

1999 Mark Goodman, Student Press Law Center 

1998 Jennifer H. McGill, AEJMC/ASJMC 

1997 Lionel Barrow, Jr., Howard 

1996 Gerald M. Sass, The Freedom Forum 

Steven Chaffee, Stanford 


Harry Heintzen, Voice of America 

1994 Edwin Emery, Minnesota 

1993 Orlando Taylor, Howard 

Vernon Stone, Missouri 

1992 Sharon Brock, Ohio State 

Carol Reuss, North Carolina 

1991 Bill Taft, Missouri 

John Merrill, Louisiana State 

1990 Wilma Crumley, Nebraska 

1989 Hillier Krieghbaum, New York 

1988 Fred Zwahlen, Oregon State 

1987 Félix Gutiérrez, Southern California 

1985 Al Scroggins, South Carolina 

1984 Bill Chamberlin, North Carolina 

Gerald Stone, Memphis State 

Paul J. Deutschmann Award for Excellence in 

Research 

This award is named in honor of Paul J. Deutschmann, 

who was a central force in the movement to study journalism 

and mass communication scientifically. He helped 

establish and develop the College of Communication 

Arts at Michigan State University, and served as director 

of its Communications Research Center. This award is 

presented by the AEJMC Elected Standing Committee on 

Research. Not an annual award. 

2018 S. Shyam Sundar, Pennsylvania State 

2017 Steve Reese, Texas at Austin 

2015 Pamela Shoemaker, Syracuse 

2013 Lee Becker, Georgia 


2010 Stephen Lacy, Michigan State 


2007 Guido H. Stempell, III, Ohio 

2005 Donald L. Shaw, North Carolina 

2004 Clifford Christians, Illinois 

2003 Melvin DeFleur, Boston 

2001 Ivan Preston, Wisconsin-Madison 

2000 James Grunig, Maryland 

1999 Steven Chaffee, Stanford 

1998 Maxwell E. McCombs, Texas at Austin 

1997 Jack M. McLeod, Wisconsin-Madison 

1996 George Gerbner, Pennsylvania 

1995 Richard F. Carter, Washington 

1994 Phillip Tichenor, Minnesota 

George Donohue, Minnesota 

Clarice Olien, Minnesota 

1993 Wayne Danielson, Texas at Austin 

1991 Scott Cutlip, Georgia 

1985 Bruce Westley, Kentucky 

1981 Harold L. Nelson, Wisconsin-Madison 

1979 J. Edward Gerald, Minnesota 

1973 Wilbur Schramm, Iowa 

1972 Ralph O. Nafziger, Minnesota/Wisconsin- 

Madison 

1969 Chilton R. Bush, Stanford (first) 

Eleanor Blum Distinguished Service to Research 

Award 

This award was created by the AEJMC Elected 

Standing Committee on Research to recognize a person 

who has devoted a substantial part of his/her career to 

promoting research in mass communication. It is named 

in honor of the first recipient, Eleanor Blum, a communication 

librarian. Not an annual award. 

2017 Esther Thorson, Michigan State 

2016 Paula Poindexter, Texas at Austin 

2014 Daniel Riffe, North Carolina at Chapel Hill 

2008 Maurine Beasley, Maryland 

2007 Patrick Washburn, Ohio 

2006 James W. Tankard, Jr., Texas at Austin 

(posthumously) 

2005 Margaret Blanchard, North Carolina 

(posthumously) 

2004 Everette E. Dennis, Fordham 

2003 James A. Crook, Tennessee 

2001 Barbara Semouche, North Carolina 

1996 Frances Wilhoit, Indiana 

1989 Guido Stempel, III, Ohio 

1986 Ed Emery, Minnesota 

1983 Raymond B. Nixon, Minnesota 

1980 Eleanor Blum, Illinois (first) 

Nafziger-White-Salwen Dissertation Award 

This award is named for pioneering journalism 

and mass communication educators Ralph O. Nafziger 

and David Manning White, who donated the royalties 

from their book Introduction to Mass Communication 

Research to fund the award. The award recognizes and 

encourages outstanding dissertation research in journalism 

and mass communication. Michael Salwen’s name 

was added to the award in 2008. Salwen, who died in


233 

2007, was a co-author of “An Integrated Approach to 

Communication Theory and Research”, the royalties of 

which now help fund this award. Annual award. Year 

listed is year award was presented. 

2018 Brooks Fuller, Louisiana State University 

Adviser: name, North Carolina at Chapel Hill 

2017 Jieun Shin, Southern California 

Adviser: Lian Jian, Southern California 

2016 Rodrigo Zamith, Minnesota 

Adviser: Seth Lewis, Minnesota 

2015 Summer Harlow, Florida State 

Adviser: Mercedes de Uriarte and Tom Johnson, 


2014 Scott Parrott, North Carolina, Chapel Hill 

Adviser: Rhonda Gibson, North Carolina 


2013 Brendan Watson, North Carolina at Chapel Hill 

Adviser: Daniel Riffe, North Carolina at Chapel Hill 

2012 Dean Smith, North Carolina at Chapel Hill 

Adviser: Cathy Packer, North Carolina at Chapel Hill 

2011 Matthew W. Ragas, DePaul 

Adviser: Spiro Kiousis, Florida 

2010 Jeremy Littau, Lehigh 

Adviser: Esther Thorson, Missouri 

2009 Leigh Moscowitz, College of Charleston 

Adviser: Radhika Parameswaran, Indiana 

2008 Ronald J. “Noah” Arceneaux, San Diego State 

Adviser: Jay Hamilton, Georgia 

2007 David Cuillier, Washington State 

Adviser: Susan Denté Ross, Washington State 

2006 Kathy Roberts Forde, North Carolina 

Adviser: Ruth Walden, North Carolina 

2005 Young Mie Kim, Illinois 

Adviser: David Tewksbury, Illinois at 

Urbana-Champaign 

2004 Zala Voicic, Colorado at Boulder 

Adviser: Andrew Calabrese, Colorado at Boulder 

2003 Mark Avrom Feldstein, North Carolina 

Adviser: Margaret A. Blanchard, North Carolina 

2002 Carolyn Bronstein, DePaul 

Adviser: James L. Baughman, Wisconsin-Madison 

2001 Edward Alwood, North Carolina 

Adviser: Margaret A. Blanchard, North Carolina 

2000 Dhavan V. Shah, Wisconsin-Madison 

Adviser: Daniel B. Wackman, Minnesota 

1999 Barbara Zang, Missouri 

Adviser: David Nord, Indiana 

1998 Craig Trumbo, Cornell 

Adviser: Garrett O’Keefe, Wisconsin-Madison 

1997 David Scott Domke, Minnesota 

Adviser: Hazel F. Dicken-Garcia, Minnesota 

1996 Paul Voakes, Indiana 

Adviser: Robert Drechsel, Wisconsin-Madison 

1995 Karen S. Miller, Georgia 

Adviser: James L. Baughman, Wisconsin-Madison 

1994 Jane Rhodes, Indiana 

Adviser: Margaret Blanchard, North Carolina 

1993 Caroline Schooler, Stanford 

Adviser: Steven Chaffee, Stanford 

1992 Mark D. West, North Carolina 

Adviser: Jane Brown, North Carolina 

1991 Namjun Kang, Syracuse 

Adviser: George Comstock, Syracuse 

1990 Bob McChesney, Wisconsin-Madison 

Adviser: William Ames, Washington 

1989 Diane C. Mutz, Wisconsin-Madison, 

Adviser: Steven Chaffee, Stanford 

1988 Vincent Price, Michigan, 

Adviser: Donald F. Roberts, Stanford 

1987 John R. Finnegan, Jr., Minnesota, 

Adviser: Hazel Dicken-Garcia, Minnesota 

1986 Jeffery Smith, Wisconsin-Madison 

Adviser: Jim Baughman, Wisconsin-Madison 

1985 Richard Kielbowicz, Minnesota 

Advisers: Ed Emery, Minnesota; 

and Hazel F. Dicken-Garcia, Minnesota 

1984 Ron Tamborini, Indiana (first) 

Adviser: Dolf Zillmann, Indiana 

AEJMC First Amendment Award 

The AEJMC First Amendment Award recognizes professionals 

with a strong commitment to freedom of the 

press, and who practice courageous journalism. Created 

in 2006, the award is presented by the Professional 

Freedom & Responsibility Committee. Annual award. 

2018 Ronan Farrow, Jodi Kantor 

and Megan Twohey, The New York Times 

2017 The Pulitzer Prizes 

2016 Reporters Without Borders 

2015 Floyd Abrams, 1st Amendment Attorney 

2014 Joel Simon, Committee to Protect Journalists 

2013 First Amendment Center, Nashville, TN 

2012 Carole Simpson, Broadcaster 

2011 Michael Kirk, Frontline Filmmaker 

2010 Nat Hentoff, Syndicated Columnist 

2009 Seymour Hersh, The New Yorker 

2008 Clarence Page, Chicago Tribune 

2007 Helen Thomas, UPI, Hearst 

2006 Molly Ivins, Synidcated Columnist (first) 

AEJMC Tankard Book Award 

The Tankard Book Award was established to honor 

James W. Tankard, Jr. of Texas at Austin. A former editor 

of Journalism Monographs, the award recognizes his 

many contributions to the field of journalism and mass 

communication education. Award established in 2007. 

2017 — “Democracy’s Detectives: The Economics of

234 


Investigative Journalism” 

by James T. Hamilton, Stanford 

2016 — “Radical Media Ethics: A Global Approach” 

by Stephen Ward, Wisconsin-Madison 

2015 — “Making News at The New York Times” 

by Nikki Usher, George Washington 

2014 — “Shaping Immigration News: A French- 

American Comparison” 

by Rodney Benson, New York 

2013 — Into the Fray: How NBC’s Washington 

Documentary Unit Reinvented the News 

by Tom Mascaro, Bowling Green State 

2012 — Radio Utopia: Postwar Audio Documentary in 

the Public Interest by Matthew C. Ehrlich, Illinois 

2011 — About to Die: How News Images Move the 

Public by Barbie Zelizer, Pennsylvania 

2010 — Journalism’s Roving Eye: A History of American 

Foreign Reporting 

by John Maxwell Hamilton, Louisiana State 

2009 — The Environment and the Press: From 

Adventure Writing to Advocacy 

by Mark R. Neuzil, St. Thomas 

2008 — Dark Days in the Newsroom: McCarthyism 

Aimed at the Press 

by Edward M. Alwood, Quinnipiac 

2007 — The African-American Newspaper: Voice of 

Freedom by Patrick S. Washburn, Ohio (first) 

AEJMC Equity & Diversity Award 

The AEJMC Equity & Diversity Award recognizes 

Journalism and Mass Communication academic programs 

that are working toward, and have attained measurable 

success, in increasing equity & diversity within their units. 

Programs must display progress and innovation in racial, 

gender, and ethnic equity and diversity over the previous 

three-year period. Created in 2009. Annual award. 

2018 Klein College of Media & Communication 


2017 Walter Cronkite School of Journalism and Mass 

Communication at Arizona State University 

2016 Mayborn School of Journalism, University of 

North Texas 

2015 College of Communication and Information 

Sciences, University of Alabama 

2014 Greenlee School of Journalism 

and Communication, Iowa State University 

2013 College of Communications, 


2012 Annenberg School for Journalism, 

University of Southern California 

2011 School of Journalism & Mass Communication, 

Texas State University, San Marcos 

2010 School of Communications, Elon University 

2009 Manship School of Mass Communication 

at Louisiana State University (first) 


The Dorothy Bowles Public Service Award will 

recognize an AEJMC member who has a sustained and 

significant public-service record that has helped build 

bridges between academics and professionals in mass 

communications either nationally or locally, and, been 

actively engaged within the association. Created in 2012. 

Annual award. 

2018 Donald K. Wright, Boston 

2017 Sandra Utt, Memphis 

2016 Rosental Alves, Texas at Austin 

2015 W. Wat Hopkins, Virginia Tech 

2014 Don W. Stacks, Miami 

2013 Judy VanSlyke Turk, Virginia Commonwealth 

2012 Candace Perkins Bowen, Kent State (first) 

Outstanding Contribution to Journalism Education 

This award, presented by the Commission on the 

Status of Women in Journalism Education, recognizes a 

woman who has represented women well through personal 

excellence and high standards in journalism and 

mass communciation education. Not an annual award. 

2016 Mia Moody-Ramirez, Baylor 

2015 Julie Andsager, Tennessee 

2014 June Nicholson, Virginia Commonwealth 

2013 Geneva Overholser, Southern California 

2012 Barbara B. Hines, Howard 

2011 Linda Steiner, Maryland 

2010 Diane Borden, San Diego State 

2009 Lillian Lodge Kopenhaver, Florida International 

2008 Esther Thorson, Missouri 

2006 Judy VanSlyke Turk, Virginia Commonwealth 

2002 Wilma Crumley, Nebraska-Lincoln 

2000 Douglas Ann Newsom, Texas Christian 

1998 Jennifer H. McGill, AEJMC/ASJMC 

1997 Carol Oukrop, Kansas State 

1996 Carol Reuss, North Carolina 

1994 Maurine H. Beasley, Maryland 

1992 Jean Ward, Minnesota 

1991 MaryAnn Yodelis Smith, Wisconsin 

1990 Ramona Rush, Kentucky 

1989 Mary Gardner, Michigan State 

1988 Donna Allen, Women’s Institute for Freedom 

of the Press, Washington, DC 

1983 Cathy Covert, Syracuse 

1982 Marion Marzolf, Michigan (first) 

Robert Knight Multicultural Recruitment Award 

This award is presented annually by the Scholastic 

Journalism Division to organizations or individuals who 

have made outstanding efforts in attracting high school 

minority students into journalism and mass communica-


235 

tion. Created in 1987. 

2018 Acel Moore High School Journalism 

Workshop, The Philadelphia Media Network 

2016 Kimetris Baltrip, Kansas State 

2015 George Daniels, Alabama 

2014 Steve O’Donoghue, California Scholastic 

Journalism Initiative 

2013 Linda Florence Callahan, North Carolina 

A&T State 

2012 Illinois Press Foundation 

and Eastern Illinois University High School 

Journalism Workshop 

2011 Joseph Selden, Pennsylvania State 

2010 University of Arizona School of Journalism 

2009 Michael Days & Staff, Philadelphia Daily News 

2008 June O. Nicholson, Virginia Commonwealth 

2007 Ed Mullins, Alabama 

2006 name, affiliation 

2005 Linda Ximenes, Ximenes & Associates 

2004 Diana Mitsu Klos, American Society 

of Newspaper Editors 

2003 Vanessa Shelton, Iowa 

2002 Walt Swanston, Radio and Television 

News Directors Foundation 

2001 Doris Giago, South Dakota State 

2000 Linda Waller, Dow Jones Newspaper Fund 

1999 Marie Parsons, Alabama 

1998 Lucy Ganje, North Dakota 

1997 California Chicano News 

Media Association, San Diego Chapter 

1996 Barbara Hines, Howard 

1995 Diane Hall, Florida A&M 

1994 Mary Arnold, Iowa 

1993 Alice Bonner, The Freedom Forum 

1992 Richard Lee, South Dakota State 

1991 Thomas Engleman, Dow Jones 

Newspaper Fund 

1990 Robert Knight, Missouri 

1989 George Curry, The Chicago Tribune, 

Washington, DC, Bureau 

1988 Craig Trygstad, Youth Communication, Inc., 


1987 Pittsburgh Black Media Federation (first) 

MaryAnn Yodelis Smith Research Award 

This award was created in 1991 by the Commission 

on the Status of Women in honor and memory of 

MaryAnn Yodelis Smith of Minnesota and Wisconsin, 

1989-90 AEJMC president. 

2016 Tania Rosas-Moreno, Loyola-Maryland 

2015 Dustin Harp, Texas at Arlington 

2014 Stacey J.T. Hust, Washington State 

Kathleen Boyce Rodgers, Washington State 

2013 Cory Armstrong, Florida 

2012 Shayla Thiel-Stern, Minnesota 

2011 Marilyn Greenwald, Ohio 

2010 Sheila Webb, Western Washington 

2009 Elizabeth Skewes, Colorado 

2008 Margaretha Geertsema, Butler 

2007 Barbara Barnett, Kansas 

2006 Marie Hardin, Pennsylvania State 

2005 Jan Whitt, Colorado 

2004 Radhika Parameswaran, Indiana 

Kavitha Cardoza, Illinois at Springfield 

2003 Susan Henry, California State-Northridge 

2000 E-K Daufin, Alabama State 

1999 Marilyn Kern-Foxworth, Florida A&M 


1997 Kathleen Endres, Akron 

1996 Linda Steiner, Rutgers 

1995 Carolyn Stewart Dyer, Iowa (first) 

Lionel C. Barrow Jr. Award for Distinguished 

Achievement in Diversity Research 

Created in 2009, the award recognizes outstanding 

individual accomplishment and leadership in diversity 

efforts within the Journalism and Mass Communication 

discipline. Created by the AEJMC Minorities & 

Communication Division and the Commission on the 

Status of Minorities, the award honors Barrow’s lasting 

impact, and recognizes others who are making their 

mark in diversifying JMC education. 

2018 Mia Moody-Ramirez, Baylor 

2017 Loren Ghiglione, Northwestern 

2016 Joel Beeson, West Virginia 

2015 Alice Tait, Central Michigan 

2014 Marilyn Kern-Foxworth, Marketing and 

Media Consultant 

2013 Clint C. Wilson II, Howard 

2012 Federico Subervi, Texas State San Marcos 

2011 Félix Gutiérrez, Southern California 

2010 Robert M. Ruggles, Florida A&M 

2009 Paula M. Poindexter, Texas at Austin (first) 

Lee Barrow Doctoral Minority Student Scholarship 

Co-Sponsored by the Communication Theory and 

Methodology Division, the Minorities and Communication 

Division and the Commission on the Status of Minorities, 

the scholarship is named for Dr. Lionel C. Barrow, Jr., of 

Howard University in recognition of his pioneering efforts 

in support of minority education in journalism and mass 

communication. The scholarship assists a minority student 

enrolled in a doctoral program in journalism or mass 

communication. 

2018 Qun Wang, Rutgers 

2017 Osita Iroegbu, Virginia Commonwealth

236 


2016 Adrienne Muldrow, Washington State 

2015 Diane Francis, North Carolina at Chapel Hill 

2014 Jenny Korn, Harvard 

2013 Dominique Harrison, Howard 

2012 Rowena Briones, Maryland 

2011 Adrienne Chung, Ohio State 

2010 Eulalia Puig Abril, Wisconsin-Madison 

2009 Emily Elizabeth Acosta, Wisconsin-Madison 

2008 Troy Elias, Ohio State 

2007 Yusur Kalynago, Jr., Missouri 

2006 Omotayo Banjo, Pennsylvania State 

2005 Jeanetta Simms, Central Oklahoma 

2004 Susan Chang, Michigan State 

2003 T. Kenn Gaither, North Carolina 

2002 Mia Moody-Hall, Texas at Austin 

2001 George Daniels, Georgia 

2000 Maria E. Len-Rios, Missouri 

1999 Meredith Lee Ballmer, Washington 

1998 Osei Appiah 

1997 Alice Chan Plummer, Michigan State 

1996 Dwayne Proctor, Connecticut 

1995 Dhavan Shah, Minnesota 

1994 Qingnen Dong, Washington State 

1993 Shalini Venturelli, Colorado 

1991 Diana Rios, Texas at Austin 

1990 Jose Lozano 

1989 Jane Rhodes, North Carolina 

1987 James Sumner Lee, North Carolina 

1985 Barbara McBain Brown, Stanford 

1983 Dianne L. Cherry, North Carolina 

1982 Tony Atwater, Michigan State 

1981 Sharon Bramlett, Indiana 

1980 Federico Subervi, Wisconsin-Madison 

1979 Gillian Grannum, North Carolina 

1978 Paula Poindexter, Syracuse 

1977 John J. Johnson, Ohio 

1975 Norman W. Spaulding, Illinois 

1974 Rita Fujiki, Washington 

1973 William E. Berry, Illinois 

Clay Perry, Indiana 

Sherrie Lee Mazingo, Michigan State 

1972 Richard Allen, Wisconsin-Madison (first) 

Connect communities. 

Design solutions. 

Drive social change. 

Merge media practice with civic 

engagement. We turn media 

practitioners into civic leaders with 

a curriculum that emphasizes design 

thinking, experiential learning, and 

authentic community collaboration. 

MA IN CIVIC MEDIA 

COLUMBIA COLLEGE CHICAGO 

Classes begin January 2019 

LEARN MORE colum.edu/aejmc


in Journalism and Mass Communication 

Congratulates 

the finalists of the 

2018 James W. Tankard Book Award 

T e News Untold: Community Journ lism 

nd t e F ilure to Confront Poverty in App l c i 

Michael Clay Carey, Samford University 

[West Virginia University Press] 

Public Rel tions nd t e Corpor te Person : 

T e Rise of t e Affinitive Org niz tion 

Burton St. John III, Old Dominion University 

[Routledge] 

R ce News: Bl c Journ lists nd t e Fig t 

for R ci l Justice in t e Twentiet Century 

Fred Carroll, Kennesaw State University 

[University of Illinois Press]

238 Special Thanks to the AEJMC Council of Divisions 

Advertising 

Head: Kelty Logan, Colorado at 

Boulder; Vice-Head/Program Chair: 

John Wirtz, Illinois at Urbana- 

Champaign; Research Committee 

Chair: Karie Hollerbach, Southeast 

Missouri State. 

Communicating Science, 

Health, Environment and Risk 

Head: Sol Hart, Michigan; Vice- 

Head: Avery Holton, Utah; Research 

Committee Chair: Kajsa Dalrymple, 

Iowa. 


Head: Jessica Smith, Abilene Christian 

State; Vice Head/Program Chair:Pamela 

Brubaker, Brigham Young; Research 

Chair: Cindy Vincent, Salem State. 

Communication Theory and 

Methodology 

Head: Melissa Gotlieb, Texas Tech; 

Vice-head, Program Chair: Elizabeth 

Stoycheff, Wayne State; Research 

Chair: Jennifer Hoewe, Alabama. 


Head: Madeleine Esch, Salve Regina; 

Vice-Head: Suman Mishra, Southern 

Illinois-Edwardsville; Research Chair: 

Ruth DeFoster, St. Catherine University. 

Electronic News 

Head: Tony DeMars, Texas A&M; 

Vice-Head: Lindsey Conlin, Southern 

Mississippi; Research Committee 

Chair: Karen McIntyre, Virginia 

Commonwealth. 

History 

Head/Program Chair: Douglas 

Cumming, Washington & Lee; Vicehead/Research 

Chair: Erika Pribanic- 

Smith, Texas-Arlington. 


Head: Mohammed Al-Azdee, 

Bridgeporty; Vice-Head: Lindita 

Camaj, Houston; Research Chair: Jatin 

Srivastava, Ohio. 

Law and Policy 

Head: Jason Martin, DePaul; Vice- 

Head:Kearston Wesner; Research/Paper 

Competition Chair: Roy Gutterman, 

Syracuse. 

Magazine Media 

Head: Sharon Bloyd-Peshkin, 

Columbia-Chicago; Vice-Head and 

Program Chair: Pamela Hill Nettleton, 

Marquette; Research Chair: Catherine 

Staub, Drake. 

Mass Communication 

and Society 

Head: Melanie Sarge, Texas Tech; 

Vice-Head/Programming Chair: 

Jay Hmielowski, Washington State; 

Research Chair: Masahiro Yamamoto, 

Albany-SUNY. 

Media Ethics 

Head: Chad Painter Dayton; Vice- 

Head/Programming Chair: Erin 

Schauster, Colorado-Boulder; Research 

Chair: Marlene Neill, Baylor. 

Media Management, Economics 

and Entrepreneurship 

Chair: Geoffrey Graybeal, Georgia 

State; Vice-Chair/Program Chair: 

Sabine Baumann, Jade University; 

Research Chair/Paper Competition 

Chair: Ronen Shay, St. John Fisher 

College. 

Minorities and Communication 

Head: Mia Moody-Ramirez, Baylor; 

Vice-Head: George Daniels, Alabama; 

Faculty Research Chair: Riva Brown, 

Central Arkansas; Student Research 

Chair: Joseph Erba, Kansas. 


Head: Jan Lauren Boyles, Iowa 

State; Vice-Head: Edson C. Tandoc, 

Jr., Nanyang Technological; Senior 

Research Co-Chair: Kris Boyle, Brigham 

Young; Research Co-Chair: Matt 

Haught, Memphis. 


Head: Richard D. Waters, San 

Francisco; Vice-Head: Giselle A. 

Auger, Rhode Island; Research Chair: 

Nathan Gilkerson, Marquette. 

Scholastic Journalism 

Head: Karla Kennedy, Florida 

International; Vice-Head: Mark 

Goodman, Kent State; Research 

Committee Chair/Paper Competition 

Chair: Peter S. Bobkowski, Kansas. 


Head: Julian Kilker, Nevada-Las Vegas; 

Vice-Head: Philip Loubere, Middle 

Tennessee State; Research Chair: Erik 

Palmer, Southern Oregon. 

Community Journalism 

Head: M. Clay Carey, Jr., Samford; 

Vice-Head:Richard Johnson, Creighton; 

Research Committee Chair: Monica 

Chadha, Arizona State. 

Entertainment Studies 

Head: Gwen Nisbett, North Texas; 

Vice Head: Stephanie Schartel Dunn, 

Missouri Western State; Research 

Chair: Gregory Adamo, Morgan State. 

Graduate Student 

Head: George Pearson, Ohio State; 

Vice-Head: Aaron Atkins, Ohio; 

Research Chair: Miriam Hernandez, 

City University of Hong Kong. 

Internships and Careers 

Head: Erica Clarke Tachoir, 

Pennsylvania State Allegheny; Vice- 

Head: Karen C. Thevney, Pennsylvania 

State, Brandywine; Research 

Committee Chair/Paper Competition 

Chair: Deborah Halpem Wenger, 

Mississippi. 

Lesbian, Gay, Bisexual, 

Transgender and Queer 

Head: Joe Cabosky, North Carolina at 

Chapel Hill; Vice-Head: Robby Byrd, 

Memphis; Research Committee Chair: 

Nathian Shae Rodriguez, San Diego 

State. 

Participatory Journalism 

Head: Mark Poepsel, Southern 

Illinois-Edwardsville; Vice-Head: 

Mark Coddington, Washington & Lee; 

Research Chair: Jeremy Littau, Lehigh. 

Political Communication 

Head: Amy Bree Becker, Loyola- 

Maryland; Vice-Head: Bryan 

McLaughlin, Texas Tech; Research 

Chair: Aaron Veenstra, Southern Illinois 

University-Carbondale.

and 2017-18 Paper Competition Research Section Chairs Title 239 

239 

Religion and Media 

Head:Rick Clifton Moore, Boise 

State; Vice-Head: Greg Perreault, 

Appalachian State; Research Chair: 

Brian J. Bowe, Western Washington. 

Small Programs 

Head: Sonya DiPalma, North 

Carolina-Asheville; Vice Head: Carrie 

Sipes, Shippensburg State; Research 

Committee Co-Chair: Jackie Incollingo, 

Rider; Research Committee Co-Chair: 

Dave Madsen, Morningside College. 

Sports Communication 

Head: Molly K. Yanity, Quinnipiac; 

Vice-Head: John Carvalho, Auburn; 

Research Co-Chairs: Brian Moritz, 

SUNY - Oswego; Lauren Reichart 

Smith, Indiana. 

Council of Affiliates 

Chair: Nancy L. Green, Southern 

Newspaper Association. 

Commission on the Status 

of Minorities 

Head: Marquita Smith, John Brown; 

Vice-Head: Cathy M. Jackson, Norfolk 

State. 

Commission on the Status 

of Women 

Head: Candi Carter Olson, Utah State; 

Vice Head: Meredith Clark, Virginia; 

Research Committee Co-Chairs: 

Teri Finneman, South Dakota State; 

Paromita Pain, Texas at Austin. 

Meet us in Toronto, Canada in 2019 

August 7-10, 2019 

Sheraton Centre Toronto

MEDILL CONGRATULATES 

OUR 2018 HALL OF 

ACHIEVEMENT INDUCTEES 

MEDILL’S HIGHEST ALUMNI HONOR 

KEVIN 

BLACKISTONE 

(BSJ81) 

Sports Columnist, 

Journalism Professor 

and ESPN Commentator 

MERVIN BLOCK 

(MSJ59) 

Broadcast News Writer, 

Teacher, and Textbook 

Author 

PATRICIA 

CALLAHAN 

(BSJ93) 

Pulitzer Prize-Winning 

Reporter 

JOSE COSTA 

(IMC04) 

CEO North America 

at GrandVision, 

Former President 

of Maaco 

KAREN FERGUSON 

FUSON (BSJ92) 

Former West Group 

President – Gannett/USA 

Today Network 

GILLIAN FLYNN 

(MSJ97) 

Best-Selling Author 

and Screenwriter of 

“Gone Girl” 

JOHN SCHULIAN 

(MSJ68) 

Sports Columnist, 

Screenwriter, 

Co-creator of “Xena: 

Warrior Princess”

Fastest growing 

master’s program 

in TTU history. 

105 full-time students 

joined in year one. 

Online M.A. in Strategic 

Communication & Innovation 

This online program, designed with communication professionals in mind, grew to more 

than 100 students in its first two years. Students complete a 30-hour, asynchronous 

program that is 100% online with no residency requirement. The program offers 

flexibility so students can take as many or as few courses as they want each semester, 

depending on their individual work/life schedules and needs. 

testimonials from our students 

This program was so much more than readings, lectures, and papers. I was actually able to take the things I was 

learning in my classes and apply them in my job. I have always been a great communicator, but after only a few classes 

my superiors took note of my growth and began to turn to me as more of a communication expert. Ultimately, I was 

rewarded with the communications job I have always wanted. – April Chavez, Spring ‘17 

I loved being able to take the course material and go into work the next day and apply it directly to my job as a social media 

marketing manager. The classes allowed me to work full-time and complete my course requirements and the professors were 

all so great and understood that I was hours away and worked a full-time job! – Kaitlin Thogmartin, Spring ‘17 

The program provided me with a more in-depth understanding of the digital professional global environment and has 

better prepared me for my future career in London! – Madison Tatum, Fall ‘17 

Left to right, Assistant Graduate Director, Mark Gring, Ph.D., 

Associate Dean of Graduate Programs, Coy Callison, Ph.D., and 

Online M.A. Program Director, Kristi Gilmore, Ph.D. 

ttugrad.org

242 

AEJMC Historical Conference Sites 

2018 August 6 - 9 .................................... Washington, DC 

2017 August 9 - 12 .......................................... Chicago, IL 

2016 August 4 - 7 ................................... Minneapolis, MN 

2015 August 6 - 9 .................................. San Francisco, CA 

2014 August 6 - 9 .................................. Montréal, Canada 

2013 August 8 - 11 .................................. Washington, DC 

2012 August 9- 12 ........................................... Chicago, IL 

2011 August 10 - 13 ..................................... St. Louis, MO 

2010 August 4 - 7 ............................................. Denver, CO 

2009 August 5 - 8 ............................................. Boston, MA 

2008 August 6 - 9 ............................................. Chicago, IL 

2007 August 9 - 12 .................................... Washington, DC 

2006 August 2 - 5 ................................... San Francisco, CA 

2005 August 10 - 13 .................................. San Antonio, TX 

2004 August 4 - 7 ...................................... Toronto, Canada 

2003 July 30 - August 2 ............................. Kansas City, MO 

2002 August 7 - 10 ................................... Miami Beach, FL 

2001 August 5 - 8 ...................................... Washington, DC 

2000 August 9 - 12 .......................................... Phoenix, AZ 

1999 August 4 - 7 ..................................... New Orleans, LA 

1998 August 5 - 8 ......................................... Baltimore, MD 

1997 July 30 - August 2 ..................................... Chicago, IL 

1996 August 10 -13 ......................................... Anaheim, CA 

1995 August 9 - 12 .................................... Washington, DC 

1994 August 10 -13 ........................................... Atlanta, GA 

1993 August 11 - 14 ................................. Kansas City, MO 

1992 August 5 - 8 .................................... Montreal, Canada 

1991 August 7 - 10 ............................................ Boston, MA 

1990 August 9 - 12 ................................... Minneapolis, MN 

1989 August 10 - 13 .................................. Washington, DC 

1988 July 2 - 5 ............................................. Portland, OR 

1987 August 1 - 4 ......... Trinity University, San Antonio, TX 

1986 August 3 - 6 .......................... University of Oklahoma 

1985 August 3 - 6 ..................... Memphis State University 

1984 August 5 - 8 ............................. University of Florida 

1983 August 5 - 10 ..................... Oregon State University 

1982 July 25 - 28 .......................... Ohio University-Athens 

1981 August 8 - 11 .................. Michigan State University 

1980 August 10 - 13 ............................ Boston University 

1979 August 5 - 8 ........................... University of Houston 

1978 August 13 - 16 .... University of Washington-Seattle 

1977 August 21 - 24 ...... University of Wisconsin-Madison 

1976 July 31 - August 4 ............... University of Maryland 

1975 August 16 - 20 .. Carleton University, Ottawa, Canada 

1974 August 18 - 21 ................ San Diego State University 

1973 August 19 - 22 ............... Colorado State University 

1972 August 20 - 23 ... So. Illinois University at Carbondale 

1971 August 21 - 25 ............. University of South Carolina 

1970 August 16 - 20 . American University, Washington, DC 

1969 August 24 - 27 ....... University of California-Berkeley 

1968 August 25 - 29 ......................... University of Kansas 

1967 August 27 - 31 ......... University of Colorado-Boulder 

1966 August 28 - Sept 1 ........ University of Iowa-Iowa City 

1965 August 22 - 26 .......................... Syracuse University 

1964 August 26 - 30 ............. University of Texas at Austin 

1963 August 25 - 29 ...................... University of Nebraska 

1962 August 26 - 30 .............. University of North Carolina 

1961 August 27 - 31 ...... University of Michigan-Ann Arbor 

1960 August 29 - Sept 2 ........... Pennsylvania State University 

1959 August 25 - 29 ............ University of Oregon-Eugene 

1958 August 25 - 29 ....... University of Missouri-Columbia 

1957 August 26 - 30 .............................. Boston University 

1956 August 28 - 31 ........................ Northwestern University 

1955 August 22 - 26 ............ University of Colorado-Boulder 

1954 August 31 - Sept 2 ... Univ of New Mexico-Albuquerque 

1953 August 24 - 27 ........................ Michigan State College 

1952 August 25 - 29 ............................ Columbia University 

1951 August 27 - 29 ........................... University of Illinois 

1950 August 28 - 30 ......... University of Wisconsin-Madison 

1949 August 30 - September 1 ........ University of Minnesota 

1948 September 1 - 3 ...... University of Colorado at Boulder 

1947 December 29 - 31 ....................... Temple University 

1947 January 9 - 11 ........................................ Lexington, KY 

1946 January 24 - 26 ..... Ohio State University-Columbus 

1st joint AASDJ & AATJ convention since 1941 

1945 January 26 - 27 ....................................... Chicago, IL 

1944 January 14 - 15 ............................ Chicago-informal 

1943 January 8 - 9 ................................ Chicago-informal 

1942 ............................................................................. None 

1941 December 27 - 30 ............................ Des Moines, IA 

1940 December 27 - 29 Columbia & New York Universities 

1939 ............................................................................. None 

1938 December 27 - 29 .................................. Topeka, KS 

Constitution changed to biennial conventions 

1937 December 28 - 30 ..................... Ohio State University 

1936 December 30 - 31 .................................. St. Louis, MO 

1935 December 27 - 30 .............................. Washington, DC 

1934 December 27 - 29 ..................................... Chicago, IL 

1933 December 27 - 30 ...................................... Chicago, IL 

1932 ........................ Convention cancelled-Great Depression 

1931 December 27 - 28 ................. University of Minnesota 

1930 December 29 - 31 ............................ Boston University 

1929 December .......................................... Baton Rouge, LA 

1928 December ............................................. Ann Arbor, MI 

1927 December ................................................ Iowa City, IA 

1926 December ............................................ Columbus, OH 

1925 December ............................................. New York City 

1924 December .................................................. Chicago, IL 

1923 December .................................................. Chicago, IL 

1922 December ............................. Northwestern University 

1921 December .............................. University of Wisconsin 

1920 December ................................. University of Missouri 

1919 no convention held, WWI 

1918 no convention held, WWI 

1917 April .......................................................... Chicago, IL 

1916 April ............................................ University of Kansas 

1915 no convention held 

1914 December ................. Columbia University, New York 

1913 Nov 28-29 ............... University of Wisconsin-Madison 

1912 Founded November 30 in Chicago, Illinois

MEDILL 

WELCOMES 

NEW FACULTY 

CHRIS BENSON 

Benson, a journalist and lawyer, is an 

associate professor of journalism. 

Benson co-authored with Emmett Till’s 

mother “Death of Innocence: The Story 

of the Hate Crime That Changed America.” 

JIM LECINSKI 

Lecinski served for more than 10 

years at Google, most recently as vice 

president of U.S. sales and service. 

He is now an associate professor in 

Medill’s Integrated Marketing 

Communications program. 

PATTY LOEW 

Loew, a documentary producer and former 

broadcast journalist, is a professor of journalism 

and director of Northwestern University’s 

Center for Native American and Indigenous 

Research. She is the author of four books.

AEJMC 2018 Conference - 

Washington, D.C. has gone 

mobile! 

Get the app on your mobile device now, for free. 

https://guidebook.com/g/aejmc2018/ 

1 

Visit the above URL on your 

device 

2 

Tap the “download” button to 

get the free Guidebook app 

AEJMC 2018 Conference - 

August 05 - August 09, 2018 


Conference: General Information 

Conference Program 

3 Open Guidebook and look for 

the guide: 

AEJMC 2018 

Conference - 

Washington, D.C. 

Conference Website 

Inbox: Notifications from AEJMC 

Registration 

My Schedule 

To-do List 

Maps 

Job Hub

2018 Recipient 

of the Lionel C. Barrow Jr. Award for Distinguished 

Achievement in Diversity Research and Education 

MIA MOODY-RAMIREZ 

Baylor University 

Mia Moody-Ramirez, Ph.D. is the 

Director of Graduate Studies, 

Director of American Studies and 

a Professor of journalism, public 

relations and new media in the 

Baylor University College of Arts & 

Sciences. Her research emphasizes 

mass media representations of 

women, minorities and other 

underrepresented groups. 

The Lionel C. Barrow Jr. Award 

for Distinguished Achievement in Diversity Research and Education 

is jointly supported by the Minorities and Communication (MAC) Division 

and the Commission on the Status of Minorities (CSM) and recognizes outstanding individual 

accomplishment and leadership in diversity efforts for underrepresented groups 

by race and ethnicity, in Journalism and Mass Communication.

LOYOLA UNIVERSITY CHICAGO 

LOYOLA UNIVERSITY CHICAGO’S SCHOOL OF 

COMMUNICATION IS PROUD TO CONGRATULATE: 

LEE HOOD, the nation’s 

top professor in broadcast 

journalism for 2018. She was 

the unanimous choice for this 

year’s Edward L. Bliss Award for 

Distinguished Broadcast Journalism 

Education selected by 

the Electronic News Division. 

DON HEIDER, named the 



Administrator of 

the Year. This award honors 

an administrator who has 

provided vision and leadership 

for the field through creativity 

and excellence in administration. 

LEARN MORE • LUC.edu/SOC

The Department of Life Sciences Communication 

in the College of Agricultural & Life Sciences 

at the University of Wisconsin-Madison 

is happy to welcome our newest Assistant Professor 

Todd Newman 

Todd will be joining an internationally renowned faculty in 

science and environmental communication including: 

Professor and Chair Dominique Brossard 

John E. Ross Professor Dietram A. Scheufele 

Professor Larry Meiller 

Professor Shiela Reaves 

Associate Professor Bret Shaw 

Assistant Professor Neil Stenhouse 

and our distinguished staff of faculty associates. 

The Department of Life Sciences Communication is 

a research leader in science communication and offers several 

nationally-ranked academic and professional programs, including: 

A Bachelor of Science in Life Sciences Communication 

A Professional Masters in Science Communication 

A Masters of Science in Science Communication 

A Ph.D. in Mass Communications (administered jointly with the School of 

Journalism and Mass Communication) 

For more information, please visit http://lsc.wisc.edu

D e a n 

G r a c i e L a w s o n - B o r d e r s , P h D . 

A s s o c i a t e D e a n f o r R e s e a r c h a n d 

A c a d e m i c A f f a i r s 

W i l h e l m i n a W r i g h t - H a r p , P h D . 

A s s i s t a n t D e a n f o r S t u d e n t A f f a i r s a n d 

A s s e s s m e n t 

R o b i n T h o r n h i l l , D . M i n . 

A s s i s t a n t D e a n f o r M u l t i - m e d i a , 

Te c h n o l o g y a n d F a c i l i t i e s 

N i g e l M a r t i n 

C h a i r , C o m m u n i c a t i o n C u l t u r e a n d 

M e d i a S t u d i e s 

C a r o l y n B y e r l y, P h D . 

( 2 0 2 ) 8 0 6 - 5 1 2 1 

C h a i r , C o m m u n i c a t i o n S c i e n c e a n d 

D i s o r d e r s 

G l o r i a j e a n W a l l a c e , P h D . 

( 2 0 2 ) 8 0 6 - 6 9 9 0 

C h a i r , M e d i a , J o u r n a l i s m a n d F i l m 

Ya n i c k R i c e L a m b , M B A 

( 2 0 2 ) 8 0 6 - 7 9 2 7 

C h a i r , S t r a t e g i c , L e g a l a n d 

M a n a g e m e n t C o m m u n i c a t i o n 

K e h b u m a L a n g m i a , P h D . 

( 2 0 2 ) 8 0 6 - 6 7 11 

525 Bryant St. NW, Washington D.C. 20059 | (202) 806-7694 | communications.howard.edu

Renaissance Washington, DC Downtown Hotel Layout

Get Connected! 

@AEJMC 

Association for Education in Journalism and Mass Communication 

www.AEJMC.org | #AEJMC | AEJMC@aejmc.org

Become an AEJMC 

Graduate Student Member! 

“Stay Connected with the JMC Field” 

For the price of about 10 large cups of coffee, you can pay for your AEJMC 

Membership for an ENTIRE year!!!! 

AEJMC Membership Benefits Include: 

• Free Subscription to AEJMC Publications 

• Extensive Listing of Job Openings & On-Site Job Hub 

access at the Conference 

• AEJMC Annual Conference 

• Networking Opportunities 

• Opportunity for Divisional Membership 

Find out more at: 

http://www.aejmc.org/home/membership/

254 

Section Title 

2018 Conference Program 

A.Q. Miller School of Journalism and Mass Communications, Kansas State University, 36 

AEJMC Equity and Diversity, 131 

AEJMC Senior and Emerging Scholars, 202 

AEJMC/ASJMC Institute for Diverse Leadership in Journalism and Communication, 132 

Annenberg Public Policy Center, 19 

Arthur W. Page Society, 249 

Bellisario College of Communications, Pennsylvania State University, 90-91 

C-SPAN, 200 

Cathy Hughes School of Communications, Howard University, 35, 249 

College of Communication and Media Sciences, Zayed University, 15 

College of Communication, Boston University, IBC 

College of Communications, California State University, Fullerton, 39 

College of Information and Communications, University of South Carolina, 38, 133 

College of Journalism and Communications, University of Florida, 256 

College of Journalism and Mass Communications, University of Nebraska-Lincoln, 112-113 

College of Media and Communication, Texas Tech University, 127, 178, 205, 241 

College of Media, Communication and Information, University of Colorado Boulder, 187-197 

College of Media, University of Illinois at Urbana-Champaign, 37 

Columbia University Press, 16 

Department of Communication, Columbia College Chicago, 236 

Department of Journalism and Creative Media, The University of Alabama, 121, 181 

Department of Journalism and Strategic Media, University of Memphis, 228 

Dorothy Bowles Public Service Award, 61 

Dow Jones News Fund, 80, 209 

Gaylord College of Journalism and Mass Communication, University of Oklahoma, 8-9, 124 

Gene Burd Urban Journalism Award, 203 

Greenlee School of Journalism and Communication, Iowa State University, 125 

Henry W. Grady College of Journalism and Mass Communication, University of Georgia, 62-65 

Hubbard School of Journalism and Mass Communication, University of Minnesota, 182 

James W. Tankard Book Award, 237 

Korean American Communication Association, 198 

Lionel C. Barrow Jr. Award for Distinguished Achievement in Diversity Research and Education, 246 

Macmillan Learning, 11 

Manship School of Mass Communication, Louisiana State University, 20, 126, 179, 204, 244 

Mayborn School of Journalism, University of North Texas, 184 

Medill School of Journalism, Media, Integrated Marketing Communications, 

Northwestern University, 140-143, 240, 243 

Medill School of Journalism, Media, Integrated Marketing Communications, 

Northwestern University in Qatar, 27 

News Engagement Day, 226 

Nicholson School of Communication and Media, University of Central Florida, 7 

Nido R. Qubein School of Communication, High Point University, 32 

Peter Lang Publishing, 18 

Pulliam Journalism Fellowship, 31 

Reynolds School of Journalism, University of Nevada-Reno, IFC

Advertiser’s Index 

Section Title 255 

Richard T. Robertson School of Media and Culture, Virginia Commonwealth University, 40 

Rowman & Littlefield, 14 

S.I. Newhouse School of Public Communications, Syracuse University, 30 

School of Communication and Information, Rutgers University, BC 

School of Communication, American University, 81-84 

School of Communication, Emerson College, 24-25 

School of Communication, Loyola University Chicago, 247 

School of Communications, Brigham Young University, 12 

School of Communications, Elon University, 101, 103, 105, 206 

School of Communications, Florida State University, 10 

School of Journalism and Electronic Media, University of Tennessee Knoxville, 180, 215 

School of Journalism and Mass Communication, Kent State University, 51, 53, 55, 57 

School of Journalism and Mass Communication, Texas State University, 34 

School of Journalism and Mass Communication, The University of Iowa, 225 

School of Journalism and Mass Communication, University of Wisconsin-Madison, 243 

School of Journalism at Michigan State University, 130 

School of Journalism, Middle Tennessee State University, 33 

School of Journalism, University of Arizona, 128 

School of Journalism, University of Missouri, 183 

School of Journalism, University of Texas at Austin, 199 

School of Media and Communication, Bowling Green State University, 201 

Scripps College of Communication, Ohio University, 134 

The Media School, Indiana University, 227 

The Plank Center for Leadership in Public Relations, 129 

The Unvarnished Press, 17 

University of Illinois Press, 13 

Walter Cronkite School of Journalism and Mass Communication, Arizona State University, 164-171 

Washington Media Scholars Foundation, 2 

William Allen White School of Journalism and Mass Communications, University of Kansas, 220 

For over 100 years AEJMC has helped journalism and mass communication educators further their careers while 

enhancing JMC education. Advertising with AEJMC gives you the chance to reach a targeted group of educators, 

with the influence of our well established association. Choose from online ads, mailing labels, or the annual AEJMC 

Conference to reach your audience, or combine advertising avenues to increase your impact. For information 

regarding conference program advertising, please contact Samantha Higgins, AEJMC Public Relations Specialist at 

AEJMCpr@aol.com.

The University of Florida College of Journalism and 

Communications welcomes 15 new faculty members. 

Advertising Journalism Public Relations 

Dr. Benjamin Johnson 

Cynthia Barnett 

Natalie Asorey 

Benny Torres 

Moni Basu 

Dr. Myiah Hutchens 

Dr. Kasey Windels 

Ted Bridis 

Mickey Nall 

Joanna Hernandez 

Telecommunication 

The Agency 

Dr. Roxane Coche 

Jim Harrison 

Dr. Andrew Selepak 

Dr. Jieun Shin 

Iman Zawahry 

These professionals and scholars are joining one of the largest communication 

programs in the country and one of the pioneers of the “teaching hospital” 

method. Our research on effective storytelling combined with student experience 

in real-world venues is making a difference in academia, industry and society. 

• 3,000+ undergraduate and graduate 

students 

• 7 media properties, including local 

PBS, NPR and ESPN affiliates 

• 2 endowed programs focused on 

free speech and freedom of 

information 

• 2 unique centers focused on the 

science of communication 

• 12 immersion programs 

• 68 research/professional faculty 

• 20 teaching hospital professionals 

• 120+ academic presentations last year 

www.jou.ufl.edu

The Department of Journalism and Media Studies 

in the School of Communication and Information, 

Rutgers University-New Brunswick 

Celebrates 

the successes 

of our faculty 

and students 

JMS Assistant Professor 

Chenjerai Kumanyika received 

the 2018 Peabody Award for 

an episode of the podcast 

“Uncivil,” which he co-hosts and 

co-produces 

Professor Amy B. Jordan, 

co-editor of the Journal 

of Children and Media, 

joined JMS in January 

2018 

Film by JMS alumus Ben Peraria 

(’18, center right) was screened at the 

Cannes Film Festival this year 

Photo courtesy of Morgan Sanguedolce 

The Department of 

Journalism and Media 

Studies and School 

of Communication 

and Information are 

vibrant centers of 

learning. We are proud 

to prepare students for 

top careers in today’s 

digital environment. 

Department of Journalism and Media Studies faculty 

• 18 full-time tenured, tenure-track and professional faculty members 

Students 

• 550 undergraduates follow pathways in Journalism and Emerging 

Media, Creative Media Practice and Media and Society 

• Specializations in Sports Media and Global Media 

• 150 students in the Master’s in Communication and Media program, 

which has a Digital Media track for which JMS provides instruction 

• 88 students in an interdisciplinary Ph.D. program, about a third 

focused on media studies. Application deadline: Early January. 

Research 

• Topics include journalism studies, digital media, critical and cultural 

studies, political communication, media history, branding, children 

and media, and issues around gender, race, class and ethnicity 

School of Communication and Information 

• Three departments: Journalism and Media Studies, Communication, 

and Library and Information Science 

comminfo.rutgers.edu 

@RutgersCommInfo #RUSCI #RutgersCommInfo 

00784 SCI AEJMC AD FULLPG VRS#3.indd 1 7/2/2018 11:34:06 AM

2018 AEJMC Conference Program

Transform your PDFs into Flipbooks and boost your revenue!

Delete template?

Save as template ?