12.07.2015 Views

Vuosaaren satama ja ympäristö - Helsingin Satama

Vuosaaren satama ja ympäristö - Helsingin Satama

Vuosaaren satama ja ympäristö - Helsingin Satama

SHOW MORE
SHOW LESS

You also want an ePaper? Increase the reach of your titles

YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.

Esipuhe<strong>Vuosaaren</strong> <strong>satama</strong>hanke on maamme historian mittavimpia yhdyskuntarakentamisenhankkeita. Kerralla toteutettuna on se myös kautta aikain suurin <strong>satama</strong>hankeSuomessa. <strong>Helsingin</strong> <strong>Satama</strong>n tavara<strong>satama</strong>toimintojen keskittämisellä Vuosaareensaavutetaan monia toiminnallisia etu<strong>ja</strong>. Hanke on yhteiskuntatalouden <strong>ja</strong> <strong>Helsingin</strong>kaupungin talouden kannalta kannattava. Se noudattaa myös kestävän kehityksenmukaisia periaatteita. Tämä korostuu erityisesti nyt, kun liikenteen päästöjä pyritäänvähentämään osana ilmastonmuutosta hillitseviä toimenpiteitä.<strong>Helsingin</strong> nykyisten tavarasatamien si<strong>ja</strong>inti on kuljetusten kannalta erittäin huono,koska <strong>satama</strong>t toimivat keskusta-alueella ha<strong>ja</strong>utettuna. Nykyisten satamien kapasiteettion riittämätön <strong>ja</strong> <strong>satama</strong>toimintojen edelleen ha<strong>ja</strong>uttaminen epätaloudellista.<strong>Satama</strong>n rakentaminen Vuosaareen vähentää ympäristölle aiheutuvia haitto<strong>ja</strong>.Kuljetusten aiheuttama riski ympäristölle vähenee. <strong>Satama</strong>n <strong>ja</strong> sen liikenteen aiheuttamamelu kohdistuu alueille, joilla on vähemmän asukkaita kuin nykyisten satamien<strong>ja</strong> sinne johtavien liikenneyhteyksien varrella. Junien kilpailuasetelma tavaraliikenteessäparanee. Nykyisille <strong>satama</strong>-alueille kantakaupunkiin voidaan rakentaa asunto<strong>ja</strong>sekä liike- <strong>ja</strong> toimistotilo<strong>ja</strong>. Tämä tasapainottaa yhdyskuntarakennetta <strong>ja</strong> vähentääsiten myös liikennemääriä <strong>ja</strong> liikenteen aiheuttamia päästöjä.<strong>Satama</strong>n rakentaminen arvokkaan luontoalueen viereen asetti suunnittelulle <strong>ja</strong>rakentamiselle korkeat laatuvaatimukset. Erityisen haastavaksi hankkeen käsittelyssämuodostuivat <strong>satama</strong>n vaikutukset lähellä si<strong>ja</strong>itsevaan Natura 2000 -alueeseen.Hankkeen menestyksellinen toteuttaminen edellytti ympäristövastuullisuutta <strong>ja</strong>ympäristönäkökohtien huomioonottamista laa<strong>ja</strong>-alaisesti hankkeen kaikissa vaiheissa.Tässä työssä on onnistuttu hyvin.Hankkeen suunnittelun, alueen kaavoituksen <strong>ja</strong> vaikutusten arvioinnin yhteydessätiivistyi eri osapuolten välinen yhteistyö. Samo<strong>ja</strong> selvityksiä voitiin käyttää hyväksieri suunnitteluvaiheissa.Yhteistyöstä muodostui poikkeuksellisen tiivistä myös hankkeen toteuttajien kesken.Valtion <strong>ja</strong> <strong>Helsingin</strong> kaupungin kesken allekirjoitettiin 30. 12. 2002 sopimus <strong>Vuosaaren</strong><strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksien toteuttamisesta. Tavoitteena oli muun muassaalentaa kustannuksia, kehittää uusia ratkaisutapo<strong>ja</strong> <strong>ja</strong> ottaa ympäristö kokonaisvaltaisestihuomioon. Valtion puolella tämän sopimuksen toteuttamisesta on vastannutTiehallinto <strong>ja</strong> kaupungin puolella <strong>Helsingin</strong> <strong>Satama</strong>. Hanke on erittäin hyvä esimerkkihallintora<strong>ja</strong>t ylittävästä yhteistyöstä.Kir<strong>ja</strong>n kirjoittamisesta ovat vastanneet Mauri Heikkonen, Heikki Metsäranta,Pirkko Pulkkinen, Kari Marttinen, Katri Erroll, Ronald Westermark, Pekka Kontiala,Olli Holm, Antti Mäkinen, Lauri Jääskeläinen, Ari Piispanen, Kari Koponen, Ahti Lappi,Veli-Pekka Suhonen <strong>ja</strong> Riitta Rämä. Kir<strong>ja</strong>n päätoimitta<strong>ja</strong>na on toiminut Mauri Heikkonen.Kir<strong>ja</strong>ssa kerrotut <strong>Vuosaaren</strong> <strong>satama</strong>hanketta koskevat käsittelyt, päätökset <strong>ja</strong> lupamenettelytovat kokonaisuutena tarkastellen kuvaava esimerkki monentasoisistahaasteista <strong>ja</strong> tavoitteista, joita ympäristölainsäädäntömme asettaa suurten infrastruktuurihankkeidentoteuttamiselle. Toivon, että tässä kerrotut kokemukset <strong>ja</strong> ratkaisutavatvoivat auttaa myös muiden suurten hankkeiden suunnittelua <strong>ja</strong> rakentamistaSuomessa. Samalla haluan kiittää hyvästä lopputuloksesta kaikkia <strong>Vuosaaren</strong><strong>satama</strong>n suunnitteluun <strong>ja</strong> rakentamiseen osallistuneita.Helsingissä 3. 11. 2008Heikki Nissinen<strong>Satama</strong>johta<strong>ja</strong>ESIPUHE<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Sisällys1 Johdanto 102 Yhteiskuntataloudellinenkannattavuus 122.1 Yhteiskuntataloudellisen laskelmanlähtökohdat 122.2 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenyhteiskuntataloudelliset vaikutukset 132.2.1 Yleiskuvaus vaikutuksista 132.2.2 Investointikustannukset 142.2.3 Vaikutukset <strong>satama</strong>ntavaraliikenteen kustannuksiin 152.2.4 Vaikutukset yhdyskuntarakenteestajohtuviin liikennekustannuksiin 162.2.5 Vaikutukset <strong>satama</strong>n toiminnan <strong>ja</strong>liikenneväylien ylläpitokustannuksiin 162.3 Yhteiskuntataloudellinen laskelma 163 <strong>Satama</strong>nympäristövaikutukset 183.1 Johdanto 183.2 Alueen luontoarvojen <strong>ja</strong> <strong>satama</strong>nvaikutusten selvittäminen aiemmin 183.3 YVA-lain valmistelu <strong>ja</strong> ympäristövaikutustenarviointi Helsingissä 203.4 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointimenettely 213. 4.1 Arvioinnin järjestäminen 213.4.2 Arvioidut vaihtoehdot<strong>ja</strong> lisäselvitykset 223.4.3 Vaihtoehtojen vertailu 223.4.4 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen haittavaikutuksetYVA-selostuksen mukaan 233.4.5 Haitallisten vaikutustenlieventäminen 243.4.6 Myönteiset vaikutukset seudunyhdyskuntarakenteeseen 243.5 YVA-menettelyn hyödyt 253.6 YVA:n vaikutukset päätöksentekoon<strong>ja</strong> <strong>ja</strong>tkosuunnitteluun 264<strong>Vuosaaren</strong> <strong>satama</strong>hanke<strong>ja</strong> Natura 2000 284.1 Tausta 284.2 Yleistä Natura 2000 -alueidenvalinnasta Suomessa 294.3 Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet Natura 2000 -alueenvalintakriteerit 304.4 Valitukset <strong>ja</strong> niiden käsittely KHO:ssa 314.5 Natura-alueen <strong>ja</strong> -säännöstönmerkityksestä <strong>Vuosaaren</strong><strong>satama</strong>hankkeessa 324.5.1 Naturan laadintavaiheen pohdinto<strong>ja</strong><strong>ja</strong> suunnan valintaa 324.5.2 Natura-arviointi vuonna 1998 334.5.3 Luonnonarvojen heikentämiskielto<strong>ja</strong> asioiden käsittelyjärjestys 334.5.4 Seutukaavan vahvistaminenympäristöministeriössä 344.5.5 Seutukaava-asian käsittely KHO:ssa 344.5.6 Johtopäätös Natura 2000 -alueenmerkityksestä <strong>Vuosaaren</strong><strong>satama</strong>hankkeessa 345<strong>Satama</strong>n suunnitteluunliittyneet kaavat 365.1 Maankäytön suunnittelu<strong>satama</strong>hankkeen perustana 365.2 Taa<strong>ja</strong>maseutukaava 365.2.1 Kaavan sisältö 365.2.2 Kaavan käsittely 365.3 <strong>Helsingin</strong> Yleiskaava 1992 385.3.1 Kaavan sisältö 385.3.2 Kaavan käsittely 405.4 <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> senliikenneyhteyksiä koskeva seutukaava 405.4.1 Kaavan sisältö 405.4.2 Rakennuslain edellytyksetkaavan hyväksymiselle 405.4.3 Luonnonsuojelulain edellytyksetkaavan hyväksymiselle 415.4.4 Uudenmaan liiton hakemus luonnonsuojelulainheikentämiskiellosta 425.4.5 Uuden poikkeamispäätöksenvalmistelu 43SISÄLLYS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


5.4.6 Rakennuslain perusteellakaavaan kohdistuneet valitukset 445.4.7 Luonnonsuojelulain säännöstenvaikutus kaavan vahvistamiseen 455.4.8 Kaavan vahvistaminen 465.4.9 Valitusten käsittely korkeimmassahallinto-oikeudessa 475.4.10 Kantelujen <strong>ja</strong> vetoomuksenkäsittely EU:ssa 485.5 <strong>Vuosaaren</strong> <strong>satama</strong>n<strong>ja</strong> ympäristön asemakaava 495.5.1 Kaavan sisältö 495.5.2 Vaikutusten arviointi 525.5.3 Kaavan käsittely 525.6 Kaakkois-Vantaan osayleiskaava 545.6.1 Kaavan sisältö 545.6.2 Kaavan vaikutukset 545.6.3 Kaavan käsittely 546 Maaliikenneyhteyksiensuunnittelu 566.1 Suunnitteluvaiheet <strong>ja</strong>lainsäädännön kehittyminen 566.2 Maaliikenneyhteydet<strong>Helsingin</strong> Yleiskaavassa 1992 576.3 Maaliikenneyhteyksienvaihtoehtotarkastelu 1994 586.4 Maaliikenneyhteydet ympäristövaikutustenarviointimenettelyssä 1994 – 1996 596.4.1 Maaliikenneyhteyksien vaihtoehdotsuunnittelualueen eteläpäässä 596.4.2 Maaliikenneyhteyksien vaihtoehdotvälillä Porvoonväylä – päärata 606.5 <strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelma<strong>ja</strong> maaliikenneyhteyksientavoitteet 616.6 <strong>Satama</strong>tien yleissuunnitelma 1997 616.7 <strong>Satama</strong>radan alustava yleissuunnitelma 626.7.1 Eteläosa <strong>satama</strong>sta Itäväylälle 626.7.2 <strong>Satama</strong>rata Itäväylältä päärataverkolle 626.8 <strong>Satama</strong>tien tiesuunnitelma 636.8.1 Tiesuunnitelman laatiminen<strong>ja</strong> käsittelyt 636.8.2 Suunnitelman sisältö 646.8.3 Vaikutukset liikenteeseen 666.8.4 Vaikutukset ympäristöön 666.9 <strong>Satama</strong>radan yleissuunnitelma 2001 676.9.1 Yleissuunnitelman laatiminen<strong>ja</strong> käsittelyt 676.9.2 Suunnitellut toimenpiteet 686.9.3 Haitallisten ympäristövaikutustenlieventäminen 707 Ympäristönäkökulmamaaliikenneyhteyksienrakentamisessa 727.1 Ympäristövastuullisuus rakentamisenlähtökohtana 727.2 Tunnelien louhinta 727.2.1 Tunnelien lujittaminen<strong>ja</strong> sortumien ehkäisy työn aikana 727.2.2 Louhintavesien käsittely 737.2.3 Melu <strong>ja</strong> tärinä 747.2.4 Louheen kuljetus 747.3 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien hallinta 747.3.1 Tunnelilouhinnat 747.3.2 Österängenin paineellinen poh<strong>ja</strong>vesi 757.3.3 Keravan kaatopaikan valumavedet 757.4 Rakentamisen laatu <strong>ja</strong> ympäristönseurantajärjestelmä 757.5 Viranomais- <strong>ja</strong> asukasyhteistyö 767.6 Työturvallisuus 777.7 Rakentamisen vaikutuksia 778Meriväylän suunnittelu<strong>ja</strong> rakentaminen 788.1 Väylävaihtoehdot 788.2 Väyläsuunnitelma 788.2.1 Mitoitusalus 788.2.2 Mitoitusvaihtoehdot 788.2.3 Ruoppaukset 798.2.4 Väylän merkintä 808.3 Lupakäsittely 808.4 Hankkeen toteutus 818.5 Väylän turvallisuus <strong>ja</strong> navigoitavuus 828.6 Väylän käytön aikaisetympäristövaikutukset 82SISÄLLYS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


9<strong>Satama</strong>-alueen merenpoh<strong>ja</strong>npuhdistaminen TBT:stä 849.1 <strong>Satama</strong>n rakentamisen edellyttämätruoppaukset 849.2 <strong>Satama</strong>n <strong>ja</strong> väylän vesilupa 1998<strong>ja</strong> TBT:n esillenousu 849.3 TBT <strong>satama</strong>-alueen sedimenteissä 859.4 Puhdistamisratkaisun kehittäminen 869.5 Puhdistamisratkaisun edellyttämätluvat 869.6 TBT:n esillenousun seurannaisvaikutuksiavuosina 2003 <strong>ja</strong> 2004 879.7 Puhdistamisratkaisun toteutus 879.7.1 Suo<strong>ja</strong>rakenteiden toteuttaminen<strong>ja</strong> Niinilahden valmistelu 879.7.2 Puhdistusruoppaus <strong>ja</strong> sedimenttiensijoittaminen Niinilahdentäyttöalueelle 899.7.3 Massastabilointi<strong>ja</strong> massojen hyötykäyttö 919.8 Puhdistamisella saavutetut tulokset 9210Telakka-alueen pilaantuneenmaaperän kunnostus 9410.1 Johdanto 9410.2 Toimintahistoria 9410.3 Tutkimukset <strong>ja</strong> suunnitelmat 9510.3.1 Ympäristölupaa edeltäneettutkimukset 9510.3.2 Riskinarvio <strong>ja</strong> kunnostuksenyleissuunnitelma 9610.3.3 Ympäristölupa 9710.3.4 Täydentävät tutkimukset 9710.4 Kunnostus 9810.4.1 Kunnostustyön yleiskuvaus 9810.4.2 Maaperän kunnostuksentunnusluvut 10010.5 Esimerkkejä erityishaasteista 10010.5.1 Maalijätealue 10010.5.2 Jätetäyttöalue 10210.6 Työsuojelu 10210.7 Johtopäätökset 10311<strong>Satama</strong>keskuksen kehittäminenosana kaupunkia <strong>ja</strong> luontoympäristöä10411.1 Taustaa <strong>ja</strong> kysymyksenasettelu<strong>ja</strong> 10411.2 Tavoitteena toimiva <strong>ja</strong> huoliteltukokonaisuus 10511.2.1 Arkkitehtonisen yleissuunnittelunkäynnistäminen 10511.2.2 Arkkitehtoninen yleissuunnittelukiinteäksi osaksi suunnitteluprosessia10611.3 Mielenkiintoisia rakennuskohteita 10711.3.1 Meluseinä 10711.3.2 <strong>Satama</strong>n valaistus 10711.3.3 Melumäki 10811.3.4 Jalankulkusilta <strong>ja</strong> tekniikkapalkit 10811.3.5 Logistiikka-alue 10811.3.6 Muuntamot 10911.4 Asemakaavoituksen arviointia<strong>Vuosaaren</strong> <strong>satama</strong>n kokemustenpoh<strong>ja</strong>lta 11011.4.1 <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristönasemakaava toteutuksenlähtökohtana 11011.4.2 <strong>Satama</strong>n viereisen yritysalueensuunnittelu <strong>satama</strong>lähtöiseksi 11011.4.3 Poikkeamia <strong>ja</strong> muutoksiaasemakaavaan 11112 <strong>Satama</strong>hankerakennusvalvonnan kannalta 11412.1 Luvitus 11412.2 Natura 2000 11512.3 Yhteistyö muuttuu suunnitelmalliseksi 11512.4 Rakennustekniset <strong>ja</strong> muut haasteet 11612.5 <strong>Satama</strong> on Helsingille tärkeäkaupunkikuvallinen imagotekijä 11612.6 <strong>Satama</strong> on lähtölaukaus 11713 <strong>Satama</strong>hankkeenympäristöseurannat 11813.1 Johdanto 11813.2 Seurannan tausta <strong>ja</strong> tavoitteet 11813.2.1 Tausta 11813.2.2 Seurantojen tavoitteet 118SISÄLLYS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


13.3 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenlinnustonseuranta 11913.3.1 Linnustonseurannan tausta<strong>ja</strong> tavoitteet 11913.3.2 Linnustonseurannan toteuttaminen 11913.3.3 Linnustonseurannan tulokset 12113.4 Kasvillisuuden seuranta 12413.4.1 Kasvillisuusseurannan tavoitteet<strong>ja</strong> toteuttaminen 12413.4.2 Kasvillisuusseurannan tulokset 12513.5 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seuranta 12613.5.1 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seurannantavoitteet <strong>ja</strong> toteuttaminen 12613.5.2 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seurannantulokset 12813.6 Vesistö- <strong>ja</strong> kalatalousseuranta 12913.6.1 Vesistö- <strong>ja</strong> kalataloustarkkailuohjelma12913.6.2 Vesistö- <strong>ja</strong> kalatalousseurannantulokset 13013.7 <strong>Vuosaaren</strong> <strong>satama</strong>toiminnanympäristöluvan velvoitteet 13313.8 Ympäristötietopalvelu 13313.9 Ympäristöseurantojen <strong>ja</strong>tkaminen 13414<strong>Satama</strong>n rakentamiseenliittyvät ympäristöhankkeet 13614.1 Johdanto 13614.2 <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamispäätökseenliittyvät päätökset 13614.3 Uusia luonnonsuojelualueita 13714.3.1 Östersundomin lintuvesienluonnonsuojelualueenperustaminen 13714.3.2 Mustavuori–Porvarinlahdenluonnonsuojelualueen laajentaminen<strong>ja</strong> Porvarinlahden etelärannanluonnonsuojelualueenperustaminen 13714.4 <strong>Vuosaaren</strong> kaatopaikan <strong>ja</strong> täyttömäenkunnostaminen <strong>ja</strong> maisemointi 13814.5 Mellunmäen luhdan säilyttäminen<strong>ja</strong> hoitaminen 14014.6 <strong>Vuosaaren</strong> <strong>satama</strong>n koillisrannan<strong>ja</strong> lähialueiden kehittäminen 14015 Räjähtämättömienlentopommien aiheuttamariski <strong>satama</strong>n rakentamisessa 14215.1 Johdanto 14215.2 Talvisodan ilmahyökkäyksissäisot tappiot 14215.3 Jatkosodan alkuvuosinaHelsinkiä pommitettiin 36 kertaa 14215.4 <strong>Helsingin</strong> suurpommituksethelmikuussa 1944 14315.4.1 Pommien määrä<strong>ja</strong> pommitusten a<strong>ja</strong>nkohdat 14315.4.2 Ilmatorjuntarykmentti 1 puolustipääkaupunkia 14315.4.3 Itsemurhapatteri harhauttiVuosaaressa 14415.4.4 Miksi pommit eivät osuneet? 14515.4.5 Jäikö pomme<strong>ja</strong> suutareiksi? 14615.4.6 Toimintaohjeet löydettäessäräjähteeksi epäilty esine 14716<strong>Vuosaaren</strong> <strong>satama</strong>hanke<strong>ja</strong> arkeologiset tutkimukset 14816.1 Johdanto 14816.2 Porvarinlahden kalkkiuunit 14816.2.1 Historiallinen tausta 14816.2.2 Kalkinpoltto maauunissa 14816.2.3 Arkeologinen kaivaus 14916.3 Länsisalmen Gubbackan autiotontti 15016.3.1 Historiallinen tausta 15016.3.2 Gubbackan arkeologisettutkimukset 15116.4 Arkeologisten tutkimusten tulokset 155Yhteenveto <strong>Vuosaaren</strong>17<strong>satama</strong>hankkeen päätöksistä<strong>ja</strong> lupamenettelyistä 156Tekijät esiin 168Sammandrag 176Summary 179SISÄLLYS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


1 JohdantoLähtökohtia <strong>ja</strong> toteutusaikataulu<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen tavoitteena on olluttoteuttaa Vuosaareen uusi a<strong>ja</strong>nmukainen <strong>satama</strong>.Hankkeeseen kuuluu <strong>satama</strong>n lisäksi uusi tieyhteysKehä III:lle, yhteys pääradalle <strong>ja</strong> uusi <strong>satama</strong>anjohtava laivaväylä. Hankkeen valmistuttua vanhattavara<strong>satama</strong>t, Länsi<strong>satama</strong> <strong>ja</strong> Sörnäinen, lopettavattoimintansa <strong>ja</strong> niiden alueet vapautuvat muuhunkäyttöön. Näin saadaan keskustan <strong>ja</strong> meren tuntumaanasunto<strong>ja</strong> lähes 30 000 asukkaalle <strong>ja</strong> lisäksitoimitilaa yrityksille. Suunnittelun tavoitteenaon ollut myös kohottaa <strong>Vuosaaren</strong> <strong>ja</strong> koko itäisen<strong>Helsingin</strong> arvostusta asuin- <strong>ja</strong> työpaikka-alueena.<strong>Satama</strong> <strong>ja</strong> sen viereinen yritysalue muodostavatlogistiikkatoimijoiden keskittymän, josta käytetäännimitystä <strong>Vuosaaren</strong> <strong>satama</strong>keskus. <strong>Satama</strong>keskuksestaon tarkoitus kehittää toiminnallisesti <strong>ja</strong> visuaalisestimielenkiintoinen osa merellistä Helsinkiä.<strong>Vuosaaren</strong> alue liitettiin <strong>Helsingin</strong> kaupunkiinvuonna 1966. Perusteluina olivat tällöin erityisesti<strong>Helsingin</strong> energianhuollon <strong>ja</strong> <strong>satama</strong>n tulevat tarpeet.Vuonna 1992 <strong>Vuosaaren</strong> <strong>satama</strong>hanke sai likipitäennykyisen muotonsa, kun <strong>Helsingin</strong> kaupunginvaltuustohyväksyi Yleiskaava 1992:n. Hankkeenympäristövaikutusten arviointimenettely käynnistyivuonna 1994 heti uuden ympäristövaikutustenarviointimenettelystä annetun lain tultua voimaan.<strong>Helsingin</strong> kaupunginvaltuusto hyväksyi vuonna1996 <strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelman<strong>ja</strong> päätti alueen asemakaavan laatimisesta. Samaanaikaan asemakaavan laatimisen kanssa olivat laadittavanamyös <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiäkoskeva seutukaava <strong>ja</strong> Kaakkois-Vantaanosayleiskaava.<strong>Satama</strong>-alueen <strong>ja</strong> siihen liittyvien liikenneyhteyksiensuunnittelua tehtiin rinnan kaavoituksen kanssa.Varsinaiset liikenneväylien <strong>ja</strong> <strong>satama</strong>-alueen yksityiskohtaiseensuunnitteluun <strong>ja</strong> toteutukseen liittyneetpäätökset oli mahdollista tehdä kuitenkin vasta,kun korkein hallinto-oikeus hylkäsi kesäkuussa 2002alueen seutukaavaan <strong>ja</strong> asemakaavaan kohdistuneetvalitukset.<strong>Satama</strong>hankkeen rakentaminen käynnistyi vuoden2003 alussa. Rakentaminen on edennyt suunnitelmienmukaisesti. <strong>Satama</strong> otetaan käyttöön marraskuussa2008. Hankkeen kokonaiskustannuksetovat yhteensä noin 700 M€, josta <strong>satama</strong>n osuus onnoin 400 M€ <strong>ja</strong> liikenneväylien osuus noin 300 M€.Tämän lisäksi alueelle kohdistuu yksityisiä investointe<strong>ja</strong>logistiikkakeskus mukaan lukien noin 400 M€.Runsaasti selvityksiä <strong>ja</strong> laa<strong>ja</strong>t seurannat<strong>Vuosaaren</strong> <strong>satama</strong>hankkeesta on tehty enemmänympäristöselvityksiä kuin ehkä mistään muustarakennushankkeesta Suomessa. Tämä on johtunutsiitä, että <strong>satama</strong>hanke sijoittuu Natura-verkostoonkuuluvien arvokkaiden luontoalueiden läheisyyteensekä Suomen 1990-luvulla nopeasti kehittyneestä <strong>ja</strong>monipuolisesta ympäristölainsäädännöstä.Monien vaiheiden jälkeen korkein hallinto-oikeuskatsoi <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiäkäsitelleessä päätöksessään luonnonsuojelulainmukaisen arviointi- <strong>ja</strong> lausuntomenettelyn osoittavan,että hanke heikentää alueen luonnonarvo<strong>ja</strong>. Seei kuitenkaan osoita, että tämä heikentyminen kohdistuisiluonnonsuojelulain 66 §:n 1 momentissa<strong>ja</strong> luontodirektiivin 6 artiklassa tarkoitetuin tavoinmerkittävänä niihin luonnonarvoihin, joiden suojelemiseksikohde F10100065 Mustavuoren lehto<strong>ja</strong> Östersundomin lintuvedet on sisällytetty Natura2000 -verkostoon.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeessa toteutetaan kansainvälisestikintarkastellen huomattavan laa<strong>ja</strong>aympäristövaikutusten seurantaa. Osa seurannoistaaloitettiin jo ennen rakentamista, niitä on tehtyrakennusaikana <strong>ja</strong> niitä <strong>ja</strong>tketaan <strong>satama</strong>toiminannanalettua. Linnuston <strong>ja</strong> kasvillisuuden seurannallahalutaan saada tietoa vaikutuksista erityisestiPorvarinlahden, Labbackan, Mustavuoren <strong>ja</strong> Kasabergetinalueille. Seurantaohjelmaan kuuluu myöspoh<strong>ja</strong>- <strong>ja</strong> pintavesien seuranta sekä vesi- <strong>ja</strong> kalatalousseuranta.10JOHDANTO<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Hanke on ollut uusien säädösten ennakkotapausHankkeeseen liittyvissä lupaprosesseissa on sovellettukattavasti laa<strong>ja</strong>a ympäristölainsäädäntöämme,sillä rakentamista tapahtui maa- <strong>ja</strong> vesialueella sekätunneleissa. Hankkeen suuri koko, monet valitukset<strong>ja</strong> uusien lakien soveltaminen vaikuttivat hankkeensuunnittelun <strong>ja</strong> käsittelyjen kestoon. Erityisen haastavaksihanketta koskevassa päätöksenteossa muodostuivat<strong>satama</strong>n vaikutukset lähellä si<strong>ja</strong>itsevaanNatura 2000 -alueeseen. Monessa lupapäätöksessäon myös ollut kyse pilottiratkaisusta, sillä hankkeessaon käytetty uusia teknisiä ratkaisu<strong>ja</strong>, jotkaovat olleet ensimmäistä kertaa lupaharkinnan kohteena.Ympäristöhaittojen vähentäminen lähtökohtanakaikissa suunnitteluvaiheissa <strong>ja</strong> rakentamisessaLähtökohtana <strong>satama</strong>n suunnittelussa <strong>ja</strong> rakentamisessaon ollut ympäristövastuullisuus <strong>ja</strong> ympäristöhaittojenvähentäminen. Maaliikenneyhteyksienpoh<strong>ja</strong>ksi valittiin jo seutukaavavaiheessa ympäristönkannalta vähiten haitallinen tunnelien käyttöönperustuva Porvarinlahden lin<strong>ja</strong>usvaihtoehto. Jatkosuunnittelussapaneuduttiin erityisesti väylien sovittamiseenmaisemaan <strong>ja</strong> melun aiheuttamien haittojenvähentämiseen.<strong>Satama</strong>an johtavan meriväylän suunnittelun poh<strong>ja</strong>ksivalittiin liikennöitävyyden <strong>ja</strong> ympäristön kannaltaparas Itä-Tontun lin<strong>ja</strong>usvaihtoehto huolimattasiitä, että tämä vaihtoehto oli muita kalliimpi.Väylien rakentamista on oh<strong>ja</strong>nnut ympäristöönkohdistuvien riskien tunnistaminen <strong>ja</strong> niiden välttäminen.Yhteistyö eri tahojen kesken mahdollistimuun muassa sen, että massansiirrot on voitusuunnitella kokonaisuuden kannalta edullisimmallatavalla.<strong>Vuosaaren</strong> <strong>satama</strong> on rakennettu pääasiassa entiselletelakka-alueelle <strong>ja</strong> meritäytöille, mutta rakentamisenalle on jäänyt myös aiemmin virkistyskäytössäolleita alueita <strong>ja</strong> reittejä sekä paikallisestiarvokkaita luontokohteita. <strong>Satama</strong>n lähialueidensuojelulla, kunnostuksella <strong>ja</strong> maisemoinnilla korvataanaluemenetyksiä <strong>ja</strong> <strong>satama</strong>hankkeen haitto<strong>ja</strong>.Uusia teknisiä ratkaisu<strong>ja</strong><strong>Vuosaaren</strong> telakka-alueen maaperän kunnostukseentähtäävät toimet aloitettiin jo 1997. Nyt runsas vuosikymmenmyöhemmin voidaan todeta maapoh<strong>ja</strong>kunnostetuksi asetetuissa aikatauluissa <strong>ja</strong> lupamääräystenmukaisesti. Maaperän kunnostaminen Vuosaaressaonnistui odotusten mukaisesti, ehkä ylittikinne. On kuitenkin hyvä todeta, että jokainenkunnostusvaihe tuotti, perusteellisesta poh<strong>ja</strong>työstähuolimatta, yllätyksiä, takaisku<strong>ja</strong> <strong>ja</strong> haastavia vaiheita.Keväällä 2003, kun <strong>Vuosaaren</strong> <strong>satama</strong>-alueensavimassojen ruoppaukset oli tarkoitus aloittaa,<strong>satama</strong>-alueen merenpoh<strong>ja</strong>sta löydettiin kohonneitatributyylitina- eli TBT-pitoisuuksia. Osalla tulevaa<strong>satama</strong>-aluetta ruopattavaksi suunniteltu<strong>ja</strong> masso<strong>ja</strong>ei voitu läjittää suunnitellusti <strong>satama</strong>hankkeen meriläjitysalueelleeikä ruoppaustyötä voitu toteuttaatavanomaiseen tapaan. Oli kehitettävä ratkaisu, jollamerenpoh<strong>ja</strong> voitiin puhdistaa <strong>ja</strong> <strong>satama</strong>n vesirakennustyötruoppausten osalta toteuttaa. Työssä kehitetylläratkaisulla TBT eristettiin pysyvästi meriympäristöstä.<strong>Satama</strong>n aluevalaistuksen suunnittelusta vuonna2005 järjestetyssä kilpailussa yhtenä tärkeänä tavoitteenaoli suojelu- <strong>ja</strong> virkistysalueille kohdistuvan”valosaasteen” minimointi. Voittaneen ehdotuksenpoh<strong>ja</strong>lta käynnistettiin <strong>ja</strong>tkosuunnittelu- <strong>ja</strong> selvitystyö,joka laajuudessaan hakee vertaistaan Suomessa.JOHDANTO<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö11


2Yhteiskuntataloudellinenkannattavuus2.1 Yhteiskuntataloudellisen laskelman lähtökohdatKuva 2.1Yhteiskuntataloudellisessakannattavuuslaskelmassatarkastellutvaihtoehdot.<strong>Vuosaaren</strong> <strong>satama</strong>n ensimmäinen yhteiskuntataloudellinenkannattavuuslaskelma valmistui vuonna1996 <strong>Helsingin</strong> <strong>satama</strong>n <strong>ja</strong> kaupunginkanslian talous<strong>ja</strong>suunnitteluosaston yhteistyönä [1]. Vuonna 1998laskelmaa päivitettiin <strong>Helsingin</strong> <strong>satama</strong>n tilaamassakonsulttityössä [2] vastaamaan tuoreimpia tieto<strong>ja</strong>mm. hankkeiden kustannuksista <strong>ja</strong> kuljetusmäärienkehityksestä. Laskelman toinen päivittäminen [3]tuli a<strong>ja</strong>nkohtaiseksi, kun ympäristöministeriö pyysiliikenne- <strong>ja</strong> viestintäministeriöltä lausuntoa <strong>Vuosaaren</strong><strong>satama</strong>hankkeen toteuttamisesta vuonna 2001.Tämän jälkeen laskelmaa päivitettiin vielä vuosina2002 <strong>ja</strong> 2006 vastaamaan a<strong>ja</strong>nkohtaisia tieto<strong>ja</strong> kustannuksista<strong>ja</strong> hyödyistä. Tässä artikkelissa esitettävätlaskelmat ovat vuoden 2006 päivityksen <strong>ja</strong> kustannustasonmukaiset.Yhteiskuntataloudellisella laskelmalla selvitettiin<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen kannattavuus suhteessavaihtoehtoon, jossa hanketta ei toteuteta (HET-vaihtoehto).Laskelmaa laadittaessa ei enää ollut kysymyssiitä, tulisiko <strong>Vuosaaren</strong> kokoinen <strong>satama</strong> rakentaamuualle kuin Vuosaareen, vaan nämä päätökset olitehty jo aiemmin [4]. Yhteiskuntataloudellisen kannattavuuslaskelmanvertailuasetelma oli seuraava:HANKE TOTEUTUUKoko <strong>satama</strong>kapasiteettiVuosaaressaHANKE EI TOTEUDUNykyiset <strong>satama</strong>t<strong>ja</strong>tkavat toimintaansa11,4 Mton muuallaVuosaari20 MtonSörnäinen4,8 MtonLänsi<strong>satama</strong>3,8 Mton• Vuosaari-vaihtoehto: <strong>Helsingin</strong> tavara<strong>satama</strong>toimintojensiirtäminen Vuosaareen, <strong>satama</strong>toimintojenyhdistäminen <strong>ja</strong> välityskyvyn kasvattaminen20 miljoonaan tonniin vuodessa. Länsi<strong>satama</strong>n <strong>ja</strong>Sörnäisten <strong>satama</strong>n tilalle tehdään asuin- <strong>ja</strong> toimitilo<strong>ja</strong>.• HET-vaihtoehto: Tavara<strong>satama</strong>toiminto<strong>ja</strong> <strong>ja</strong>tketaanLänsi<strong>satama</strong>ssa <strong>ja</strong> Sörnäisissä. Nykyistensatamien kapasiteetin ylittävä liikenne siirtyymuualle. Laskelmissa on oletettu liikenteen siirtyvänKirkkonummen Pikkalaan.Vuosaari-vaihtoehdon vaikutusten suuruus riippuu<strong>satama</strong>n kautta kulkevan tavaran määrästä. 1990-luvun alussa <strong>Vuosaaren</strong> <strong>satama</strong>n suunnittelun tavoitteenaoli 8–10 miljoonan tavaratonnin kapasiteetti.Ensimmäisten yleissuunnitelmatasoisten suunnitelmienvalmistuessa havaittiin a<strong>ja</strong>nmukaisilla alue- <strong>ja</strong>laituritehokkuuksilla päästävän noin 12 miljoonantonnin kapasiteettiin. Tätä arviota käytettiin myöhemminjohdonmukaisesti hankkeen kannattavuuslaskelmissavuosina 1996, 1998, 2001 <strong>ja</strong> 2002.Suunnitelmien tarkentuessa 2000-luvulla <strong>ja</strong>lostuimyös käsitys tulevasta liikenteestä yhä puhtaamminkontti- <strong>ja</strong> kumipyöräliikenteeseen. <strong>Satama</strong>nkapasiteettia ryhdyttiin tarkastelemaan konttien,rekkojen <strong>ja</strong> perävaunujen kapasiteetin perusteella.Todenmukaisempi arvio <strong>Vuosaaren</strong> <strong>satama</strong>ntavaranvälityskyvystä on nyt 18–20 miljoonaa tonnia.Viimeisimmässä laskelmassa on käytetty tätäarviota. Laskelmiin on kuitenkin kaikissa vaiheissasisältynyt herkkyystarkastelua <strong>satama</strong>n tavaramääränsuhteen.Laskelmassa noudatettiin liikenne- <strong>ja</strong> viestintäministeriönyleisohjetta liikenneväylähankkeidenyhteiskuntataloudellisesta arvioinnista (ohje tunnetaanmyös nimillä Yhtali-ohje <strong>ja</strong> Hankearviointiohje).Yhteiskuntataloudellisessa arvioinnissa tarkastellaanrahamääräisiä <strong>ja</strong> rahassa arvotettaviavaikutuksia. Suoraan rahamääräisinä arvioitaviavaikutuksia ovat muutokset investointi-, ylläpito- <strong>ja</strong>operointikustannuksissa <strong>ja</strong> ajoneuvokustannuksissa.Rahassa arvotettavia vaikutuksia ovat matka-aikasäästötsekä liikenteen onnettomuus- <strong>ja</strong> päästömää-12YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K I R J O I T TA J AHeikki Metsäranta, DI, työskentelee Strafica Oy:ssä.Hän on vastannut konsulttina <strong>Vuosaaren</strong> <strong>satama</strong>n yhteiskuntataloudellisistakannattavuuslaskelmista.rien <strong>ja</strong> melulle altistuneiden määrän muutokset.Rahamääräisille <strong>ja</strong> arvotettaville vaikutuksille onolemassa Tiehallinnon määrittämät [5], liikenne<strong>ja</strong>viestintäministeriön vahvistamat yksikköarvot,joista esitetään esimerkkejä taulukossa 2.1.Ajoneuvokustannusten yksikköarvot on määriteltyajoneuvokanta- <strong>ja</strong> hintatilastojen perusteella.A<strong>ja</strong>n arvo johdetaan Suomessa keskimääräisistäpalkkakustannuksista. Onnettomuuskustannustenarvo koostuu tilasto- <strong>ja</strong> tutkimustiedoista määritettävästäreaalitaloudellisesta osasta sekä muissaPohjoismaissa tehtyihin maksuhalukkuustutkimuksiinperustuvasta hyvinvoinnin menetyksen arvosta.Ympäristövaikutuksista arvotettu<strong>ja</strong> ovat päästötilmaan <strong>ja</strong> liikenteen melulle altistuminen. Päästökustannukseton arvotettu vaikutuspolkumenetelmälläkansainvälisiin tutkimustuloksiin <strong>ja</strong> suomalaisiinselvityksiin perustuen. Ilmastonmuutoksen <strong>ja</strong>melulle altistumisen kustannukset on johdettu kansainvälisistätutkimustuloksista.AjoneuvokustannuksetHenkilöautoKuorma-auto5,68 snt/km28,41 snt/kmKuorma-auto <strong>ja</strong> varsinainen perävaunu 37,00 snt/kmAikakustannuksetHenkilöauto työa<strong>ja</strong>n matkallaHenkilöauto työ- tai asiointimatkallaHenkilöauto vapaa-a<strong>ja</strong>n matkallaYhdistelmäajoneuvoOnnettomuuskustannukset33,27 €/h/auto10,32 €/h/auto15,88 €/h/auto19,57 €/h/autoKuolemaan johtanut onnettomuus 2 205 000 €Henkilövahinko-onnettomuus keskim. 471 000 €Tieliikenneonnettomuus keskimäärin 118 000 €Ympäristökustannukset (taa<strong>ja</strong>ma / ha<strong>ja</strong>-asutus)Rikkidioksidi (SO ²)Typen oksidit (NO x)Hiukkaset (PM ²,5 )Hiilimonoksidi (CO)HiilivedytHiilidioksidi (CO ²)LikaantuminenMelu14 100 / 2 100 €/tn1 170 / 458 €/tn213 000 / 6 640 €/tn25,5 / 0,73 €/tn70,2 / 70,2 €/tn33,8 / 33,8 €/tn0,095 / 0,00095 snt/km1 010 / 1 010 €/häiriötä kokeva as./vuosi2.2 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen yhteiskuntataloudelliset vaikutukset2.2.1 Yleiskuvaus vaikutuksistaTaulukko 2.1LiikennehankkeidenYhtali-laskelmissakäytettäviä yksikköarvo<strong>ja</strong>vuoden 2005hintatasossa [5].Vuosaari-vaihtoehdosta aiheutuu seuraavia rahassaarvioitavissa olevia välittömiä hyötyjä <strong>ja</strong> haitto<strong>ja</strong>(kuva 2.2):1. <strong>Satama</strong>n tavaraliikenteen hyödyt <strong>ja</strong> haitat: <strong>Satama</strong>toimintojenkeskittäminen Vuosaareen vaikuttaa<strong>satama</strong>sta lähtevien <strong>ja</strong> sinne saapuvien kuljetustensuoritteisiin, kustannuksiin sekä tämän liikenteenaiheuttamiin onnettomuus- <strong>ja</strong> päästökustannuksiin.2. Yhdyskuntarakenteen muutoksen hyödyt <strong>ja</strong> haitat:Länsi<strong>satama</strong>n <strong>ja</strong> Sörnäisten <strong>satama</strong>-alueidenrakentamisesta asuin- <strong>ja</strong> toimitilojen käyttöönseuraa, että pääkaupunkiseudun liikenteen kokonaissuoriteon pienempi kuin HET-vaihtoehdossa.Liikenteen aiheuttamat kustannukset ovat vastaavastipienemmät.3. <strong>Satama</strong>n toiminnan hyödyt <strong>ja</strong> haitat: <strong>Satama</strong>toimintojenkeskittäminen vaikuttaa <strong>satama</strong>npitäjän,<strong>satama</strong>nkäyttäjien <strong>ja</strong> tullilaitoksen kustannuksiin.4. Vuosaari-vaihtoehdon välilliset <strong>ja</strong> aikaistettavatinvestoinnit (haitto<strong>ja</strong>): Hanasaaren voimalaitokseenon tehtävä lisäinvestointe<strong>ja</strong>, jotta Sörnäisten<strong>satama</strong>n alue voidaan hyödyntää asuntorakentamiseen.<strong>Satama</strong>hankkeen seurauksenajoudutaan aikaistamaan <strong>satama</strong>ratkaisusta riippumattatehtäviä Porvoonväylän <strong>ja</strong> Kehä III:n parannustöitä.5. HET-vaihtoehdon investoinnit (hyötyjä): <strong>Satama</strong>hankkeenseurauksena ei tarvitse toteuttaa niitä<strong>satama</strong>- <strong>ja</strong> väyläinvestointe<strong>ja</strong>, jotka pitäisi tehdäHET-vaihtoehdossa. Lisäksi hyötyä syntyy siitä,ettei kantatiehen 51 <strong>ja</strong> Kehä III:n länsipään parannusinvestointe<strong>ja</strong>tarvitse aikaistaa.YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö13


6. Ero liikenneväylien ylläpitokustannuksissa: <strong>Vuosaaren</strong><strong>satama</strong>an johtavien liikenneväylien ylläpitokustannuksetovat erilaiset kuin HET-vaihtoehdossa.7. Investointien jäännösarvot: Perusinvestointienjäännösarvo on 30 vuoden kuluttua <strong>satama</strong>n avaamisestarealisoituva hyöty. HET-vaihtoehdon suorieninvestointien jäännösarvo on vastaavasti saamattajäävä hyöty eli haitta.2.2.2 Investointikustannukset<strong>Satama</strong>hankkeen kustannusarvioTarkasteltavassa hankkeessa <strong>Vuosaaren</strong> nykyiselletelakka-alueelle <strong>ja</strong> sen ympäristöön rakennetaanuusi kappaletavaraliikenteen <strong>satama</strong>, jonka laskennallinenkäyttökapasiteetti on 20 miljoonaa tonniavuodessa. <strong>Satama</strong>investointien lisäksi <strong>Vuosaaren</strong><strong>satama</strong>hankkeeseen sisältyy tieyhteyksien, <strong>satama</strong>radansekä meriväylän rakentaminen.<strong>Satama</strong>hankkeen kustannusarvio (vuoden 2006kustannustasossa) on yhteensä noin 590 miljoonaaeuroa, joka koostuu seuraavista osista:1. <strong>satama</strong> <strong>ja</strong> sen kunnallistekniikka 315 M€2. tiejärjestelyt 84 M€ (josta 11 M€ toteutettaisiin<strong>satama</strong>hankkeesta riippumatta)3. <strong>satama</strong>rata 180 M€4. meriväylä 11 M€.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeesta johtuvatmuut investointikustannuksetHanasaaren voimalaitokseen on tehtävä 13,2 miljoonaneuron lisäinvestoinnit, jotta Sörnäisten <strong>satama</strong>nalue voidaan hyödyntää asuntorakentamiseen. Tämäinvestointikustannus lasketaan Vuosaari-vaihtoehdonhaitaksi.Vuosaari-vaihtoehdossa on aikaistettava Porvoonväylän,Itäväylän <strong>ja</strong> Kehä III:n parantamistoimenpiteitä.Laskelmassa on oletettu, että aikaistuson viisi vuotta. Tästä aiheutuu laskennallisia korkokustannuksia10,5 miljoonaa euroa. Aikaistuksestaon toisaalta jonkin verran hyötyä myös muulle kuin<strong>satama</strong>n liikenteelle. Tämä hyötyerä otetaan jäljempänähuomioon laskettaessa koko pääkaupunkiseudunliikenteen hyötyjä.Investointikustannukset, jotka vältetäänLaskelmassa oletetaan, että HET-vaihtoehdossaPikkalaan rakennettaisiin <strong>satama</strong>, jonne Länsi<strong>satama</strong>sta<strong>ja</strong> Sörnäisistä yli jäävä tavaraliikenne oh<strong>ja</strong>utuisi.Lisäksi olisi mahdollisesti investoitava uuden<strong>satama</strong>n meriväylään sekä <strong>satama</strong>n maaliikenneyhteyksiin.Uuden <strong>satama</strong>n investointien kustannusarvioolisi yhteensä noin 216 miljoonaa euroa. Vuosaari-vaihtoehdossanämä investoinnit vältetään.Länsi<strong>satama</strong>n katuyhteys Länsiväylälle kulkeeMechelininkadun kautta. Yhteys toimii tällä hetkellätyydyttävästi, mutta on erittäin häiriöherkkä. Tästäsyystä HET-vaihtoehdossa on varauduttava Ruoho-Pääkaupunkiseudunmuun liikenteensuorite <strong>ja</strong> kustannuksetpienenevät.<strong>Satama</strong>n ylläpidon<strong>ja</strong> toiminnankustannuksetvähenevät.Keski-Pasilanrakentamisenkustannuksetpienenevät.Länsi<strong>satama</strong>n <strong>ja</strong>Sörnäisten <strong>satama</strong>nalueille asunto<strong>ja</strong> noin28 000 asukkaalle.Liikenteen päästöjen<strong>ja</strong> onnettomuuksienmäärä vähenee.<strong>Satama</strong>ntavaraliikenteenkustannuksetpienenevät<strong>Satama</strong>operaatiot keskittyvätyhteen <strong>satama</strong>an.<strong>Satama</strong>n autokuljetusten suorite pienenee<strong>ja</strong> junakuljetusten osuus kasvaa.Aluskuljetusten suorite kasvaa.Kuva 2.2Yleiskuva <strong>Vuosaaren</strong><strong>satama</strong>hankkeen yhteiskuntataloudellisistavaikutuksista.Investoidaan Hanasaarenvoimalaitokseen <strong>ja</strong> aikaistetaanPorvoonväylän, Itäväylän <strong>ja</strong>Kehä III:n parantamishankkeita.Teiden <strong>ja</strong> ratojen ylläpidonkustannukset kasvavat.Investoidaan<strong>Vuosaaren</strong> <strong>satama</strong>an<strong>ja</strong> senliikenneyhteyksiinVältetään Ruoholahden laa<strong>ja</strong>tinvestoinnit sekä kantatie 51:nparantamishankkeen aikaistaminen.Vältetään pääkaupunkiseudun3. tavara<strong>satama</strong>n <strong>ja</strong> senliikenneyhteyksien rakentaminen.14YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


lahden liikenneyhteyden parantamiseen. Arvioparannustoimien kustannuksista on noin 114 miljoonaaeuroa. Kun <strong>Vuosaaren</strong> <strong>satama</strong> toteutetaan, eiRuoholahdessa enää ole <strong>satama</strong>n liikenteestä aiheutuviainvestointitarpeita.<strong>Vuosaaren</strong> <strong>satama</strong> vapauttaa Keski-Pasilastarautatieliikenteen käyttöön muutoin tarvittavaamaa-alaa. Tämän merkitsee sitä, että kummassakinvaihtoehdossa rakennettava Keski-Pasilan alue voidaan<strong>Vuosaaren</strong> ansiosta rakentaa enemmän maavaraisestieikä kansirakenteiden päälle. Asia tuleeselväksi valtion <strong>ja</strong> <strong>Helsingin</strong> kaupungin aiesopimuksessa,jossa käsitellään Keski-Pasilan tulevan maankäytönperiaateratkaisu<strong>ja</strong>. Rakennuskustannuksissasaavutettava säästö vuosina 2013–2015 on yhteensänoin 93 miljoonaa euroa.HET-vaihtoehdossa olisi lisäksi aikaistettavakantatiellä 51 välin Munkkulla–Kivenlahti parantamista.Laskelmassa on oletettu, että aikaistus on 5vuotta. Tästä aiheutuu laskennallisia korkokustannuksia6,8 miljoonaa euroa. Aikaistuksen hyöty pääkaupunkiseudunliikenteelle on otettu laskelmassahuomioon Vuosaari-vaihtoehdon haittana.Investointien jäännösarvot<strong>Vuosaaren</strong> <strong>satama</strong>n investointien jäännösarvo 30vuoden kuluttua <strong>satama</strong>n avaamisesta on 138 miljoonaaeuroa. HET-vaihtoehdon investointien jäännösarvoolisi vastaavasti 76 miljoonaa euroa. Laskelmassaotetaan hyötynä huomioon näiden erotus(62 miljoonaa euroa).2.2.3 Vaikutukset <strong>satama</strong>n tavaraliikenteenkustannuksiin<strong>Satama</strong>hankkeella on vaikutusta tie-, rautatie- <strong>ja</strong> vesiliikenteeseensekä niistä aiheutuviin kustannuksiin.Tiekuljetusten keskimääräinen matkanpituuslyhenee <strong>Vuosaaren</strong> <strong>satama</strong>n valmistuttua. Muutosjohtuu etäisyyseroista <strong>ja</strong> kantakaupungin nopeus- <strong>ja</strong>reittirajoituksista. Tästä seuraa, että <strong>satama</strong>n tieliikenteenajoneuvo- <strong>ja</strong> aikakustannukset sekä päästö<strong>ja</strong>onnettomuuskustannukset ovat pienemmät Vuosaari-vaihtoehdossakuin HET-vaihtoehdossa.<strong>Satama</strong>ratkaisun oletetaan lisäksi vaikuttavan kuljetusmuodonvalintaan. Laskelmassa nämä vaikutuksetilmenevät seuraavasti:• Vuosaareen kuljetettaessa kuorma-autojen liikennesuoriteon pienempi kuin HET-vaihtoehdossa.Tämän seurauksena tieliikenteen ajoneuvo-, aika-,onnettomuus- <strong>ja</strong> päästökustannukset pienenevät.• Vuosaari-vaihtoehdossa junakuljetusten kilpailukykyon parempi <strong>ja</strong> siten myös junakuljetustenosuus liikenteestä on suurempi kuin HETvaihtoehdossa.Osa kuljetuksista siirtyy autoistajunaan, mikä merkitsee pienempää tieliikenteensuoritetta sekä pienempiä onnettomuus- <strong>ja</strong> päästökustannuksia.Rautatiekuljetusten keskimääräinen matkan pituuson niin ikään lyhyempi Vuosaari-vaihtoehdossa kuinHET-vaihtoehdossa. <strong>Satama</strong>n rautatieliikenteen liikennöintikustannuksetsekä päästö- <strong>ja</strong> onnettomuuskustannuksetovat vastaavasti pienemmät. <strong>Satama</strong>ratkaisunvaikutuksella kuljetusmuodon valintaanon myös merkitystä. Laskelmassa vaikutukset tulevatesille seuraavasti:• Vuosaari-vaihtoehdossa kuljetusmatka lyhenee<strong>ja</strong> rautatieliikennöitsijä saavuttaa rationalisointihyötyä,koska liikennöinti suuntautuu yhteen eikäkolmeen <strong>satama</strong>an. Näistä tekijöistä seuraa, ettärautatiekuljetusten liikennöintikustannukset ovatVuosaari-vaihtoehdossa pienemmät kuljetusmäärienkasvusta huolimatta. Vaikutukset onnettomuus-<strong>ja</strong> päästökustannuksiin ovat hyvin pienet.• Junaan siirtyvät kuljetukset hyötyvät rautatiekuljetustenalemmista kustannuksista. Siirtymä onhyödyllinen sekä kuljetusten anta<strong>ja</strong>lle että liikennöitsijälle.Rautatieliikenteen suoritteen kasvulisää vastaavasti rautatieliikenteen päästökustannuksia,mutta vähentää samalla tieliikenteenpäästökustannuksia.Vesiliikenteen aluskustannukset kasvavat liikenteensiirryttyä Vuosaareen. Ero johtuu siitä, että länsisuunnanulkomaanliikenteen matka Vuosaareen onkeskimäärin pidempi kuin nykyisiin satamiin. Tästäseuraa myös, että vesiliikenteen päästökustannuksetovat hieman suuremmat Vuosaari-vaihtoehdossakuin HET-vaihtoehdossa.Silloin kun <strong>Vuosaaren</strong> <strong>satama</strong>n tavaraliikenteenkokonaismäärä on kasvanut 20 miljoonaan tonniin <strong>ja</strong>junakuljetusten osuus on 20 %, on <strong>satama</strong>hankkeenhyöty tavaraliikenteelle kaikkiaan noin 26 miljoonaaeuroa vuodessa (taulukko 2.2).TiekuljetuksetRautatiekuljetuksetVesikuljetuksetKeskimääräinen kuljetusmatka, km –8 –10 +12Kuljetussuorite, Mtonkm/v –148 –42 +245CO ²-päästöjen muutos, ton/v –8 500 –90 +4 200Taulukko 2.2<strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvaikutukset <strong>satama</strong>ntavaraliikenteelle,kun <strong>satama</strong>n tavaraliikenteenkokonaismääräon 20 miljoonaa tonnia<strong>ja</strong> rautatiekuljetustenosuus 20 %.Hyödytyhteensä(M€/v)Liikennöinnin hyöty, M€/v 14,9 2,8 –4,8 12,9Säästö onnettomuuskustannuksissa, M€/v 6,3 0,0 0,0 6,3Säästö päästökustannuksissa, M€/v 8,5 –1,2 –0,4 6,9Hyödyt yhteensä, M€/v 29,7 1,6 –5,2 26,1YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö15


Taulukko 2.3<strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvaikutuksetpääkaupunkiseudunmuun kuin <strong>satama</strong>liikenteensuoritteisiin<strong>ja</strong> kustannuksiin.2.2.4 Vaikutukset yhdyskuntarakenteestajohtuviin liikennekustannuksiinVuosaari-vaihtoehdossa <strong>Helsingin</strong> työssäkäyntialueenyhdyskuntarakenne on tiiviimpi kuin HETvaihtoehdossa.Länsi<strong>satama</strong>n <strong>ja</strong> Sörnäisten <strong>satama</strong>alueillevoidaan sijoittaa vähintään 28 000 asukasta,jotka muuten sijoittuisivat arvion mukaan keskimäärin26 km:n etäisyydelle <strong>Helsingin</strong> keskustasta.Tämä vaikuttaa suoraan tieliikenteen ajoneuvo-,aika-, onnettomuus- <strong>ja</strong> päästökustannuksiin, jotkaovat Vuosaari-vaihtoehdossa noin 55 miljoonaaeuroa vuodessa pienemmät kuin HET-vaihtoehdossa(taulukko 2.3).Todennäköisesti liikkumiskäyttäytyminen <strong>ja</strong>kulkutapa<strong>ja</strong>kauma ovat kaikkiaan hyvin erilaisetriippuen siitä, asuvatko 28 000 henkilöä kantakaupungissavai jossain muualla pääkaupunkiseudulla.Tätä eroa laskelmassa ei ole kuitenkaan arvioitu.Laskelmassa on myös oletettu, että asuinalueidenrakentamiskuntoiseksi saattamisesta syntyvissä kustannuksissatai rakentamiskustannuksissa ei ole merkittäviäero<strong>ja</strong> vaihtoehtojen välillä.Henkilö- <strong>ja</strong>pakettiautoliikenneKuormaautoliikenneLiikennesuorite, Mkm/v –68 –5CO ²-päästöjen muutos, ton/v –4 100 –2 000Hyödytyhteensä(M€/v)Säästö ajoneuvo- <strong>ja</strong> aikakustannuksissa, M€/v 41,2 4,4 45,6Säästö onnettomuuskustannuksissa, M€/v 7,0 0,5 7,5Säästö päästökustannuksissa, M€/v 1,1 1,1 2,2Hyödyt yhteensä (M€/v) 49,3 6,0 55,32.2.5 Vaikutukset <strong>satama</strong>n toiminnan<strong>ja</strong> liikenneväylien ylläpitokustannuksiin<strong>Satama</strong>npitäjä säästää <strong>Vuosaaren</strong> <strong>satama</strong>n valmistuttuavuotuisissa ylläpitokustannuksissa. Hyöty syntyypääasiassa siitä, että yhden uuden <strong>satama</strong>n ylläpitotulee edullisemmaksi kuin nykyisten kahden<strong>ja</strong> oletetun kolmannen <strong>satama</strong>n ylläpito. Säästö onnoin 1,9 miljoonaa euroa vuodessa. <strong>Satama</strong>toimintojensiirrosta nykyisiltä paikoilta Vuosaareen vastaavastiaiheutuu kertaluonteinen, noin 1,7 miljoonaneuron kustannus.<strong>Satama</strong>nkäyttäjät menettävät <strong>Vuosaaren</strong> <strong>satama</strong>nmyötä mahdollisuuden hyödyntää olemassa oleviarakennuksiaan Länsi<strong>satama</strong>ssa <strong>ja</strong> Sörnäisissä. Näidenrakennusten käyttöarvona voidaan pitää palovakuutusarvoa,joka on yhteensä 15,5 miljoonaaeuroa.<strong>Satama</strong>toimintojen keskittämisellä Vuosaareensaavutetaan toiminnallisia hyötyjä mm. henkilöstökuluissa,puhtaanapidossa <strong>ja</strong> vartioinnissa. <strong>Satama</strong>nkäyttäjät<strong>ja</strong> tullilaitos hyötyvät niin ikään<strong>satama</strong>toimintojen keskittämisestä yhteen paikkaan.Hyödyn suuruus on riippuvainen käsiteltävän liikenteenmäärästä. Kun <strong>satama</strong>n kautta kulkeva tavaramääräon 20 miljoonaa tonnia vuodessa, on keskittämisenhyöty yhteensä noin 17 miljoonaa euroavuodessa.<strong>Vuosaaren</strong> maayhteyksissä on pitkiä tunneleita,joiden kunnossapito- <strong>ja</strong> käyttökustannukset ovat korkeammatkuin maan päällä kulkevien väylien. HETvaihtoehtoonarvioidaan toisaalta myös sisältyväntunneliratkaisu<strong>ja</strong>. Laskelmassa on arvioitu, että <strong>Vuosaaren</strong>maaliikenneyhteyksien vuotuiset kunnossapito-<strong>ja</strong> käyttökustannukset ovat vuodessa noin 1,4miljoonaa euroa suuremmat kuin HET-vaihtoehdonvastaavien väylien.2.3 Yhteiskuntataloudellinen laskelmaYhteiskuntataloudellisessa laskelmassa vuosittainkertyvät hyödyt <strong>ja</strong> haitat diskontataan 30 vuodena<strong>ja</strong>lta perusvuoden (2009) arvoon. Vastaavasti perusinvestoinninkustannukselle lasketaan perusvuodenarvo lisäämällä kustannusarvioon rakentamisenaikainenlaskennallinen korko (5 %).<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksieninvestoinnit ovat rakennusa<strong>ja</strong>lta kertyvine korkoineenyhteensä noin 661 miljoonaa euroa. Perusinvestoinnillasaavutetaan yhteiskuntataloudellisiahyötyjä, joiden nykyarvo on 1 471 miljoonaa euroa.Voidaan todeta, että <strong>Vuosaaren</strong> <strong>satama</strong>hanke onHET-vaihtoehtoon verrattuna selvästi yhteiskuntataloudellisestikannattava. Hankkeen nykyarvo on810 miljoonaa euroa, hyöty-kustannussuhde 2,2 <strong>ja</strong>sisäinen korko 15 % (taulukko 2.4). Hankkeen merkittävimmäthyödyt syntyvät seuraavista tekijöistä:• <strong>Satama</strong>n kuljetusten kannalta yhden <strong>satama</strong>nmalli on parempi kuin kolmen <strong>satama</strong>n malli.Tästä seuraa säästöjä <strong>satama</strong>n raskaan liikenteenliikennöinti-, päästö- <strong>ja</strong> onnettomuuskustannuksissa.16YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


• <strong>Satama</strong>toimintojen si<strong>ja</strong>itessa yhdessä paikassasaavutetaan toiminnallisia säästöjä <strong>satama</strong>npitäjän,<strong>satama</strong>nkäyttäjien <strong>ja</strong> tullilaitoksen kustannuksissa.• Sörnäisten <strong>ja</strong> Länsi<strong>satama</strong>n alueille rakennetaanasunto<strong>ja</strong> <strong>ja</strong> toimitilo<strong>ja</strong>. Tästä seuraa säästöjä pääkaupunkiseudunmuun kuin <strong>satama</strong>n raskaan liikenteenliikennöinti-, päästö- <strong>ja</strong> onnettomuuskustannuksissa.Laskelmaan sisältyy luonnollisesti useitakin epävarmuustekijöitä,joiden suhteen on perusteltua tehdäherkkyystarkastelua. Olennaisimpia epävarmuustekijöitäovat seuraavat:• <strong>Satama</strong>n liikenne-ennusteen toteutuminen. <strong>Satama</strong>nliikenteen hyödyt (20 % kaikista hyödyistä)<strong>ja</strong> <strong>satama</strong>toimintojen hyödyt (16 % kaikista hyödyistä)ovat riippuvaisia liikenteen määrästä. Jos<strong>satama</strong>n liikenne ei kasva nykyisestä, niin HETvaihtoehdossaei tarvittaisi kolmatta <strong>satama</strong>a.• Junakuljetusten osuus <strong>satama</strong>n tavaraliikenteestä.Vaikuttaa <strong>satama</strong>n liikenteen hyötyjen määrään.• Nykyisten <strong>satama</strong>-alueiden rakentaminen. Alueillesijoittuvien asukkaiden määrä <strong>ja</strong> heidänliikkumistottumuksensa vaikuttavat pääkaupunkiseudunliikenteen hyötyjen määrään.• Investointikustannukset. Kustannusten kasvu heikentääsuoraan kannattavuutta. Samalla on otettavahuomioon, että myös HET-vaihtoehdon kustannuksiinsisältyisi vastaavaa epävarmuutta.Herkkyystarkastelun päätulos on, että <strong>Vuosaaren</strong><strong>satama</strong>hanke on yhteiskuntataloudellisesti kannattava,vaikka <strong>satama</strong>n liikenne ei enää kasvaisi <strong>ja</strong>junakuljetusten osuus <strong>satama</strong>n liikenteestä säilyisinykyisellään.Peruslaskelmassa on oletettu, että yhden <strong>satama</strong>nmallissa rautatieliikenteen kilpailukyky on selvästiparempi kuin kolmen <strong>satama</strong>n mallissa. Tämän seurauksenajunakuljetusten osuus <strong>satama</strong>n liikenteestäon Vuosaari-vaihtoehdossa perustellusti suurempikuin HET-vaihtoehdossa. <strong>Vuosaaren</strong> <strong>satama</strong>hankeon kuitenkin yhteiskuntataloudellisesti kannattavamyös siinä tapauksessa, että junakuljetusten osuuson sama molemmissa vaihtoehdoissa. Herkkyystarkastelunperusteella hanke voidaan todeta kannattavaksijo <strong>satama</strong>n nykyisellä liikennemäärällä <strong>ja</strong>kulkumuoto<strong>ja</strong>kautumalla.Yhteiskuntataloudellisen laskelman suhde ympäristövaikutuksiinra<strong>ja</strong>utuu niihin muutoksiin, joilleon rahamääräinen arvo. Laskelma tuo näkyviin<strong>satama</strong>hankkeen vaikutukset liikenteen suoritteisiin<strong>ja</strong> siten liikenteen hiilidioksidi- <strong>ja</strong> muihin päästöihin.Vuosaari-vaihtoehdossa tieliikenteen vuotuinensuorite on noin 95 miljoonaa ajoneuvokilometriäpienempi <strong>ja</strong> rautatieliikenteen suorite 42 miljoonaatonnikilometriä pienempi kuin HET-vaihtoehdossa.Vesiliikenteen vuotuinen suorite sen si<strong>ja</strong>an kasvaaVuosaari-vaihtoehdon toteutumisen seurauksenanoin 245 miljoonaa tonnikilometriä.Suoritemuutosten seurauksena pääkaupunkiseudunliikenteen vuosittainen hiilidioksidipäästöon reilut 10 000 tonnia pienempi kuin HET-vaihtoehdossaolisi. Vaikutus on suuruusluokaltaan 0,8 %pääkaupunkiseudun liikenteen hiilidioksidipäästöistä.PerusinvestointiTaulukko 2.4Vuosaari-vaihtoehdonyhteiskuntataloudellinenkannattavuusverrattuna HET-vaihtoehtoon(vuoden 2006tietojen perusteella).<strong>Satama</strong> <strong>ja</strong> sen liittäminen kunnallisteknisiin verkkoihin 315Meriväylä 11Tie (pl. joka tapauksessa tehtävät toimenpiteet) 84Rata 180Rakentamisen aikaiset korkokustannukset (5 % vuodessa) 71Yhteensä (A) 661Ensimmäiseen käyttövuoteen diskontattujen hyötyjen (+) <strong>ja</strong> haittojen (–)erotus, M€<strong>Satama</strong>n tavaraliikenne 290Muu pääkaupunkiseudun liikenne 535<strong>Satama</strong>n toiminta 236Vuosaari-vaihtoehdon välilliset <strong>ja</strong> aikaistettavat investoinnit –23HET-vaihtoehdon suorat, välilliset <strong>ja</strong> aikaistetut investoinnit 367Säästö Keski-Pasilan rakennuskustannuksissa 73Ero väylien ylläpitokustannuksissa –22Investointien jäännösarvo (netto) 14Yhteensä (B) 1 471Hyöty-kustannussuhde (B/A) 2,23Nykyarvo (B–A), M€ 810Sisäinen korko (korko, jolla B–A=0) 15,0 %L ä h t e e t1. <strong>Vuosaaren</strong> <strong>satama</strong>hanke. Yhteiskuntataloudellinenkannattavuuslaskelma (YHTALI). <strong>Helsingin</strong> <strong>Satama</strong>,Kaupunginkanslian talous- <strong>ja</strong> suunnitteluosasto, 20. 3.1996,Helsinki2. <strong>Vuosaaren</strong> <strong>satama</strong>. Yhteiskuntataloudellinen kannattavuuslaskelma(YHTALI). <strong>Helsingin</strong> <strong>Satama</strong>n julkaisu, sar<strong>ja</strong> C,1998:11, Helsinki3. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen yhteiskuntataloudellinenkannattavuuslaskelma (YHTALI). Liikenne- <strong>ja</strong> viestintäministeriönmietintöjä <strong>ja</strong> muistioita B22/2001, Helsinki.4. <strong>Vuosaaren</strong> <strong>satama</strong>hanke. Valtiontalouden tarkastusvirastontarkastuskertomus 15/2001, Helsinki.5. Tieliikenteen ajokustannusten yksikköarvot 2005. Suunnitteluvaiheenoh<strong>ja</strong>us. Tiehallinto, Helsinki.YHTEISKUNTATALOUDELLINEN KANNATTAVUUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö17


3<strong>Satama</strong>nympäristövaikutukset3.1 JohdantoHelsinki on valmistellut uutta <strong>satama</strong>a vuosikymmeniä,siitä saakka kun Vuosaari liitettiin kaupunkiin.Tänä aikana ympäristöasioiden merkitys on kasvanut.Yhdestäkään muusta hankkeesta Suomessa eiole tehty niin paljon ympäristöselvityksiä kuin <strong>Vuosaaren</strong><strong>satama</strong>sta. <strong>Satama</strong>hankkeen myönteiset vaikutukseterityisesti <strong>Helsingin</strong> kantakaupungissa ontodettu huomattaviksi <strong>ja</strong> haitat Vuosaaressa <strong>ja</strong> uusienliikenneyhteyksien varrella hallittaviksi. <strong>Vuosaaren</strong><strong>satama</strong> on ollut mahdollista rakentaa arvokkaidenluontoalueiden viereen, koska ympäristönäkökohdaton otettu suunnittelussa <strong>ja</strong> päätöksenteossa huomioontaloudellisten <strong>ja</strong> teknisten seikkojen rinnalla.Haittojen lieventäminen on ollut kaikissa vaiheissakiinteä osa <strong>satama</strong>hankkeen suunnittelua <strong>ja</strong> toteutusta.Useista suunnitelmissa esitetyistä lievennystoimistaon tullut myös lupaehto<strong>ja</strong>. Johdonmukainenpyrkimys haittojen ennaltaehkäisyyn <strong>ja</strong> minimointiinon synnyttänyt mm. pilaantuneiden massojenkäsittelyä, ruoppausvälineistöä, massojen kuljetusta,<strong>satama</strong>n valaistusta <strong>ja</strong> raskaan liikenteen haittojenvähentämistä koskevia innovaatioita.3.2 Alueen luontoarvojen <strong>ja</strong> <strong>satama</strong>n vaikutusten selvittäminen aiemminMustavuoren <strong>ja</strong> Porvarinlahden arvokasta luontoaon tutkittu kauan. Vuonna 1949 julkaistussa ehdotuksessa<strong>Helsingin</strong> seudun luonnonsuojelukohteiksi[1] esitettiin Mustanvuoren seudun <strong>ja</strong> Borgarstrandvikeninperukan varaamista kansanpuistoksi <strong>ja</strong> osaasiitä luonnonsuojelualueeksi. Perusteluina olivatalueen vaihteleva luonto, kalliomänniköt, komeatkuusikot <strong>ja</strong> rehevät lehdot sekä vuorelta avautuvakomea näköala.1960-luvulla todettiin <strong>Vuosaaren</strong> soveltuvan hyvin<strong>satama</strong>n paikaksi teknilliseltä <strong>ja</strong> taloudelliselta kannalta.Väylän rakentamisen oletettiin aiheuttavan vainvähän ruoppauksia <strong>ja</strong> louhintaa. Rannan muotoa <strong>ja</strong>vesialueiden poh<strong>ja</strong>olosuhteita pidettiin tärkeinä kriteereinä<strong>satama</strong>n sijoituksessa. Ympäristövaikutuksiaei vielä laajemmin selvitetty eikä arvioitu. <strong>Vuosaaren</strong>suunnittelukomitea halusi kuitenkin jättääasuntoalueiden <strong>ja</strong> <strong>satama</strong>ksi suunnitellun alueenväliin riittävän leveän vihervyöhykkeen [22].1970-luvulla seutukaavaliitto selvitti seudun<strong>satama</strong>vaihtoehto<strong>ja</strong> [8] <strong>ja</strong> <strong>Helsingin</strong> kaupunkisuunnitteluvirastoinventoi <strong>Vuosaaren</strong> luontoa [16]. Mustavuorenlehto todettiin <strong>Helsingin</strong> itäisten alueidenainoaksi luonnontilaiseksi lehdoksi. Sitä käytettiin<strong>ja</strong> käytetään myös yliopisto-opetukseen. <strong>Helsingin</strong>yliopiston kasvimuseossa on vuosina 1965 <strong>ja</strong> 1979Mustavuoresta löydetyt näytteet korpihohtosammaleesta,joka on yksi Mustavuoren lehdon <strong>ja</strong> Östersundominlintuvesien Natura-alueen (FI0100065)suojelun perusteista [14]. 1970-luvun jälkeen sammaltaei enää ole havaittu.1980-luvulla Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet otettiin mukaan valtakunnallisiinsuojeluohjelmiin. Porvarinlahti muodostaa Sipoonpuolella si<strong>ja</strong>itsevien Bruksvikenin, Torpvikenin <strong>ja</strong>Kapellvikenin kanssa valtioneuvoston vuonna 1982vahvistamaan Valtakunnalliseen lintuvesiensuojeluohjelmaankuuluvat Östersundomin lintuvedet.Mustavuoren lehto on ollut vuodesta 1989 valtioneuvostonvahvistamassa Valtakunnallisessa lehtojensuojeluohjelmassa.<strong>Helsingin</strong> kaupungin esityksestäUudenmaan lääninhallitus teki vuonna 1987 päätöksenMustavuoren–Porvarinlahden-luonnonsuojelualueenperustamisesta kaupungin omistamille maille.Vuonna 1984 valmistui ns. RAMA-selvitys [16],joka käynnisti <strong>Helsingin</strong> ranta-alueilla suuria maankäyttömuutoksia.Siinä arvioitiin maankäyttöratkaisu<strong>ja</strong>edelleen pääasiassa toiminnallis-taloudelliseltakannalta. Raportissa todetaan kuitenkin kaupunkikuvallistenvaikutusten lisäksi raskaan liikenteenhaitoista kantakaupungissa sekä öljysatamien hajuhaitasta<strong>ja</strong> päästöistä.Valtakunnallisen satamien kehittämisohjelman(SANKA) tarkastelut vuonna 1988 tehtiin ensisi<strong>ja</strong>isestikuljetustaloudellisten näkökohtien <strong>ja</strong> kilpailukykyäedistävän palvelutason kannalta [15]. Hankkeiden,suunnitelmien <strong>ja</strong> ohjelmien ympäristövaikutustenarviointia koskevaa lainsäädäntöä ei vielä ollut.18SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K I R J O I T TA J APirkko Pulkkinen, MMM (ympäristönsuojelu), LuK (suunnittelumaantiede),työskentelee johtavana ympäristötarkasta<strong>ja</strong>na <strong>Helsingin</strong>kaupungin ympäristökeskuksessa. Hän on ollut ympäristötoimenedusta<strong>ja</strong>na <strong>Vuosaaren</strong> <strong>satama</strong>n valmistelussa vuodesta 1989 alkaen.Kuva 3.1<strong>Vuosaaren</strong> <strong>satama</strong>hankkeensi<strong>ja</strong>intiSATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö19


3.3 YVA-lain valmistelu <strong>ja</strong> ympäristövaikutusten arviointi HelsingissäSisäasiainministeriö asetti vuonna 1981 komitean,jonka tehtävänä oli laatia ehdotus valtakunnallisestimerkityksellisten rakennus- <strong>ja</strong> kehittämishankkeidenympäristövaikutusten arvioimiseksi <strong>ja</strong> ennakoimiseksisekä arviointimenetelmien kehittämiseksi [23].Yhdysvalloissa oli ollut vuodesta 1969 voimassa lakiympäristövaikutusten arvioinnista. Komitea piti tärkeänäarvioinnin tekemistä samanaikaisesti suunnittelunkanssa mutta ei vielä tarkastellut mahdollisuuttaerillisen lain valmisteluun.<strong>Helsingin</strong> kaupunki alkoi kehittää ympäristövaikutustenarviointia maankäytön suunnittelussa.Kaupunkisuunnitteluvirasto teetti vuonna 1989ympäristölautakunnan esityksestä sekä Viikki–Latokartano-osayleiskaavanettä Vuosaari–Niinisaariosayleiskaavanympäristövaikutusten arvioinnit.Vuosaaressa arvioitiin Vuosaari–Niinisaarenkaupunkirakennemallien A2 (runsaasti asutusta) <strong>ja</strong>B3L (asutusta <strong>ja</strong> 7 miljoonan tonnin <strong>satama</strong>) sekäJätkäsaaressa asutus- (runsaasti asutusta) <strong>ja</strong> <strong>satama</strong>vaihtoehtojen(ei asutusta <strong>ja</strong> 3,8 miljoonan tonnin<strong>satama</strong>) vaikutuksia luonnonolosuhteiltaan <strong>ja</strong> kulttuurihistoriallisestiarvokkaisiin alueisiin, virkistysalueisiin<strong>ja</strong> -reitteihin, ilmanpäästöihin, meluun sekäpinta- <strong>ja</strong> poh<strong>ja</strong>vesiin. Selvityksen mukaan <strong>satama</strong>oli virkistyksen, liikennepäästöjen <strong>ja</strong> liikennemelunkannalta edullisempaa sijoittaa Vuosaareen <strong>ja</strong> luonnonolosuhteiltaanarvokkaiden alueiden sekä pinta<strong>ja</strong>poh<strong>ja</strong>vesien kannalta säilyttää Jätkäsaaressa [12].Vuonna 1991 ympäristöministeriö asetti työryhmän,joka YVA-92 -mietinnössään esitti hallituksenesityksen muotoon laaditun ehdotuksen laiksiympäristövaikutusten arviointimenettelystä [24].Työryhmä esitti myös ympäristövaikutusten selvittämiseen<strong>ja</strong> arviointiin velvoittavia muutoksia useisiinmuihin lakeihin. YVA-laki <strong>ja</strong> siihen liittyvät lakimuutoksetoli tarkoitus saada voimaan 1. 1. 1993.1990-luvun alussa myös <strong>Vuosaaren</strong> <strong>satama</strong>n valmisteluvauhdittui, <strong>ja</strong> kaupunkisuunnitteluvirasto<strong>ja</strong>tkoi alueen maankäytön suunnittelua. <strong>Helsingin</strong><strong>satama</strong>n suuntaviivat (SAKE) -työryhmän raportissavuonna 1990 kerrottiin teknisten, toiminnallisten <strong>ja</strong>taloudellisten seikkojen ohella ympäristövaikutuksistasekä Mustavuoren <strong>ja</strong> Porvarinlahden alueidenluontoarvoista [4]. Kaupunginvaltuusto hyväksyi29. 8. 1990 SAKE-raportin kanssa toivomusponnen,jossa edellytettiin, että <strong>ja</strong>tkosuunnittelun yhteydessätehdään perusteellinen selvitys sekä nykyisten ettäsuunniteltavien satamien ympäristövaikutuksista.Kaupunginhallitus kehotti <strong>satama</strong>lautakuntaa ryh-tymään ponnen edellyttämiin toimiin. <strong>Satama</strong>laitosteetti selvitykset mm. <strong>Vuosaaren</strong> <strong>satama</strong>n melusta,suunnitellun <strong>satama</strong>-alueen virtaamista, vesistö- <strong>ja</strong>kalatalousvaikutuksista sekä alusten päästöistä.Kaupunkisuunnitteluvirasto tutki vuonna 1991valmistuneessa arvioinnissa tarkemmin Vuosaari–Niinisaari-osayleiskaavaluonnoksen ympäristövaikutuksiamaankäyttömallista, jossa <strong>Vuosaaren</strong>telakka-alueelle oli sijoitettu kapasiteetiltaan 7 miljoonantonnin <strong>satama</strong> [11]. Arvioinnissa haluttiin tarkentaaerityisesti <strong>satama</strong>n rakentamisen <strong>ja</strong> toiminnanympäristövaikutuksia. Selvityksessä arvioitiin<strong>satama</strong>vaihtoehdon ympäristövaikutuksia luonnon<strong>ja</strong> kulttuuriympäristön arvoalueisiin, virkistysalueisiin,vesiolosuhteisiin, ilmanlaatuun <strong>ja</strong> melutasoihin.Samaan aikaan <strong>satama</strong>laitos teetti lisäselvityksiä.<strong>Satama</strong>lautakunta kertoi kaupunginhallitukselleselostuksessaan 13. 5. 1991, että Vuosaari–Niinisaariosayleiskaavan ympäristövaikutusselvityksen jälkeenlaaditaan laa<strong>ja</strong>, vain <strong>satama</strong>a koskeva ympäristövaikutusselvitys,joka tulee olemaan osa <strong>satama</strong>nkokonaissuunnitelmaa [20].Sörnäisten <strong>satama</strong>n siirron ympäristövaikutuksiaselvitettiin vuonna 1992 [13]. Työ liittyi <strong>Helsingin</strong>Yleiskaava 1992:n valmisteluun. Yleiskaavan merkittävinyksittäinen kaupunkirakenneratkaisu olikinLänsi<strong>satama</strong>n <strong>ja</strong> Sörnäisten <strong>satama</strong>n tavara<strong>satama</strong>toimintojenkeskittäminen Vuosaareen.Ympäristövaikutusten selvittäminen tiivisti kaupunginvirastojen <strong>ja</strong> laitosten asiantuntijoiden yhteistyötä,joka <strong>ja</strong>tkui kaupungin johtajiston perustamassa<strong>Vuosaaren</strong> <strong>satama</strong>n seurantaryhmässä (Vuose). Vuosina1996 –2002 toiminut ryhmä koordinoi kaupunginvalmistelutoimenpiteitä.<strong>Helsingin</strong> <strong>satama</strong>laitos <strong>ja</strong> kaupungin ympäristökeskusvalmistautuivat <strong>Vuosaaren</strong> <strong>satama</strong>n ympäristövaikutustenarviointimenettelyyn suunnitteilla olleenYVA-lain mukaan. Vuonna 1992 neuvoteltiin valtionympäristöviranomaisten kanssa vapaaehtoisestaYVA-menettelystä [25]. Se ei kuitenkaan ollut mahdollista,koska ei tiedetty YVA-lain lopullista sisältöäeikä yhteysviranomaista. Lain arveltiin tulevan voimaanvuoden 1993 alussa tai viimeistään 1. 7. 1993.<strong>Helsingin</strong> <strong>satama</strong>laitos teetti vuonna 1993 aiempiinselvityksiin perustuneen ympäristövaikutustenarviointiohjelman luonnoksen. YVA-laki viipyi,<strong>ja</strong> arviointimenettelyn aloittamisesta neuvoteltiinuudelleen ympäristöministeriön <strong>ja</strong> Uudenmaanympäristökeskuksen kanssa [21]. Valtion ympäristöviranomaisetkertoivat lain tulevan voimaan mah-20SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


dollisesti vasta 1. 1. 1994. Vapaaehtoinen YVA ei olisikorvannut lakisääteistä menettelyä, koska eri lupaviranomaisettarvitsivat tulossa olleen lain mukaisenympäristövaikutusten arviointiselostuksen ratkaisujensapoh<strong>ja</strong>ksi.Laki ympäristövaikutusten arviointimenettelystä(468/1994, 458/2006) <strong>ja</strong> sitä täydentävä asetus(268/1999, 713/2006) sekä muutokset 12 muuhunlakiin <strong>ja</strong> kahteen asetukseen tulivat voimaan 1. 9. 1994.3.4 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen ympäristövaikutusten arviointimenettely3. 4.1 Arvioinnin järjestäminenKaupungin johtajistotoimikunta asetti 17. 3. 1993työryhmän, jonka tehtävänä oli laatia <strong>Vuosaaren</strong><strong>satama</strong>n perustamissuunnitelma. Se valmistui11. 2. 1994, <strong>ja</strong> sitä selostettiin kaupunginhallitukseniltakoulussa 21. 2. 1994 <strong>ja</strong> kaupunginvaltuuston jäsenille16. 3. 1994. Samana päivänä kaupunginvaltuustohyväksyi kuntasuunnitelmaa käsiteltäessä toivomusponnen,jossa edellytettiin, että <strong>Vuosaaren</strong> <strong>satama</strong>hankkeestatehdään tulevan YVA-lain mukainenarviointi ennen kuin kaupunginvaltuusto käsitteleeperustamissuunnitelman.<strong>Satama</strong>laitos oli valmistautunut ympäristövaikutustenarviointimenettelyyn hyvin. Prosessi päästiinaloittamaan heti lain tultua voimaan. Arviointiohjelmaluonnosoli laadittu jo edellisenä vuonna,<strong>ja</strong> kaupungin johtajisto oli kesällä 1994 perustanutYVA-menettelyn oh<strong>ja</strong>usryhmän. Arviointiohjelmavalmistui marraskuussa 1994 [5]. Uudenmaan ympäristökeskusyhteysviranomaisena antoi siitä lausuntonsa15. 3. 1995.Ympäristövaikutukset arvioitiin hankekokonaisuudestasiten, että <strong>Helsingin</strong> kaupunki vastasi<strong>satama</strong>n <strong>ja</strong> sinne johtavien maaliikenneyhteyksienarvioinnista <strong>ja</strong> Merenkulkuhallitus meriväylän arvioinnista.YVA-menettelyn oh<strong>ja</strong>usryhmään kuuluivat<strong>Helsingin</strong>, Vantaan, Sipoon, Tielaitoksen, Valtionrauta-Lainsädännön mukaisetvaikutusryhmätVertailutasoEläimistöEsimerkkejäarviointitason mittareistaLinnuston suojelupistearvoKuva 3.2Vertailtavat ympäristövaikutuksetYVA-selostuksenmukaan.KasvillisuusKasviston suojeluarvolukuLuonto,vuorovaikutussuhteet,monimuotoisuusMeriVeden laatuEliöstöVeden vaihtuvuusPoh<strong>ja</strong>vesiMäärä, laatuVertailtavatympäristövaikutuksetIhmisen terveys,elinolot <strong>ja</strong> viihtyvyysPäästöt ilmaanVälittömät terveysvaikutuksetTyöllisyysTypen oksiditMeluUudet työpaikatYhdyskuntarakenneVirkistysUudet virkistysalueetHäiriöt virkistysalueilleAsunnot, palvelutAsuinrakentaminenPalvelujen kehitysTalousMaisemaKielteisen maisematekijännäkemäalue<strong>Helsingin</strong> kaupungin talousKannattavuusYhteiskuntatalousHyöty/kustannus-suhdeSATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö21


teiden <strong>ja</strong> Merenkulkuhallituksen edusta<strong>ja</strong>t sekä asiantunti<strong>ja</strong>naUudenmaan lääninhallituksen edusta<strong>ja</strong>.Samaan aikaan <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen YVAmenettelynkanssa olivat meneillään MetropolitanPort Oy:n Pikkalan <strong>satama</strong>hankkeen ympäristövaikutustenarviointimenettely <strong>ja</strong> seutukaavaliiton selvityksetmolemmista <strong>satama</strong>hankkeista.Perusteellisista ennakkovalmisteluista huolimatta<strong>Helsingin</strong> <strong>satama</strong>hankkeen YVA-menettely vei lähes1,5 vuotta. Sen kestoa lisäsivät mm. Vantaan tekemätliikenneselvitykset <strong>ja</strong> Merenkulkuhallituksen väylätutkimukset.Arviointiselostus valmistui lokakuussa1995 [6]. Menettely päättyi yhteysviranomaisena toimineenUudenmaan ympäristökeskuksen annettuaselostuksesta lausuntonsa 13. 3. 1996 [8].3.4.2 Arvioidut vaihtoehdot <strong>ja</strong> lisäselvityksetYVA-menettelyssä oli vaihtoehtona uusi kappaletavaraliikennettävarten Vuosaareen rakennettava<strong>satama</strong> meriväylä- <strong>ja</strong> maaliikenneyhteysvaihtoehtoineen.<strong>Satama</strong>lta vapautuville alueille Länsi<strong>satama</strong>ssa<strong>ja</strong> Sörnäisissä rakennettaisiin pääasiassaasunto<strong>ja</strong>. Toisena vaihtoehtona oli, ettei <strong>satama</strong>hankettatoteutettaisi. Satamia kehitettäisiin vanhoillaalueilla mahdollisuuksien mukaan <strong>ja</strong> <strong>Vuosaaren</strong>telakka-aluetta teollisuusalueena [6].<strong>Helsingin</strong>, Vantaan <strong>ja</strong> Sipoon päätöksentekijöistäkoostunut <strong>Vuosaaren</strong> <strong>satama</strong>n neuvottelukuntavalitsi aiempien selvitysten <strong>ja</strong> suunnitelmienpoh<strong>ja</strong>lta ympäristövaikutusten arviointiin seuraavatmaaliikennevaihtoehdot:• tie Porvarinlahden yli sillalla <strong>ja</strong>lyhyessä tunnelissa Labbackan mäen ali• tie Porvarinlahden <strong>ja</strong> Labbackan mäen alipitkässä tunnelissa• rata Porvarinlahden yli sillalla <strong>ja</strong> tunnelissaLabbackan mäen ali• rata <strong>satama</strong>sta Porvarinlahden eteläpuolitselänteen <strong>ja</strong> tunnelissa Mustavuoren ali• <strong>satama</strong>rata on liitettävissä päärataan Koivukylässätai Heli-radan lin<strong>ja</strong>usta noudattaen Tapanilassa.<strong>Satama</strong>hankkeen ympäristövaikutusten arviointiperustui aiempiin selvityksiin, asiantuntijoidenarvioihin, asukkaiden näkemyksiin <strong>ja</strong> YVA-menettelynaikana tehtyihin lisäselvityksiin. Vaikutusalueenasukkaille tehtiin kysely, <strong>ja</strong> asukkaille pidettiinviisi kuulemistilaisuutta. Lisäksi järjestettiin 11viranomaishaastattelua <strong>ja</strong> kolme muuta kuulemistilaisuutta:ammattikalastajille, virkistyskalastajille<strong>ja</strong> luonnonsuojelujärjestöille.Arvioinnin aikana tehtiin lisäselvitykset seuraavistaaiheista:• tieliikenneväylien palvelutasot• maisemavaikutukset• meluvaikutukset• päästöt ilmaan• poh<strong>ja</strong>vesiselvitys• asiantunti<strong>ja</strong>lausunto vaikutuksista Porvarinlahden<strong>ja</strong> sen lähiympäristön linnustoon• vaikutukset kasvillisuuteen <strong>ja</strong> kasvistoon• Porvarinlahden vesi- <strong>ja</strong> sedimenttitutkimus• vaarallisten aineiden kuljetusten arviointi• virkistysvaikutukset• läjitys- <strong>ja</strong> merihiekanottoalueiden tutkimukset• uuden väylävaihtoehdon haraukset• väylän navigointisimulaatio• väylävaihtoehtojen navigoitavuus• virtausmallinnus• alusten aiheuttamat aallot <strong>ja</strong> virtaukset• yhteenveto <strong>satama</strong>hankkeeseen liittyvistämerialueen tutkimuksista3.4.3 Vaihtoehtojen vertailuArviointiselostuksessa esitettiin luontoon, ihmisiin<strong>ja</strong> yhteiskuntaan kohdistuvia vaikutuksia. Arviointiatäydennettiin tiedoilla hankkeen kustannuksista<strong>ja</strong> kannattavuudesta.Vaihtoehtojen vertailussa seuraavat seikat tukivat<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen toteuttamista:1. Ihmisiin suoraan kohdistuvat terveysvaikutukset<strong>Satama</strong>n <strong>ja</strong> sen liikenteen melu kohdistuu alueille,joilla on vähemmän asukkaita.2. <strong>Helsingin</strong> palvelujen <strong>ja</strong> asuntotuotannon määräKantakaupunkiin voidaan rakentaa uusia asuntoalueita.3. TyöllisyysSuuri rakennusprojekti <strong>ja</strong> <strong>satama</strong>kapasiteetinlisääntyminen työllistävät.4. Taloudelliset vaikutuksetHanke on sekä yhteiskuntataloudellisesti että <strong>Helsingin</strong>kaupungin talouden kannalta kannattava.5. Maisemalliset vaikutuksetTelakan <strong>ja</strong> kahden <strong>satama</strong>n si<strong>ja</strong>an hankkeen toteuttamisenlopputuloksena on yksi suuri <strong>satama</strong> <strong>ja</strong>sinne johtavat maaliikenneyhteydet.6. Päästöt ilmaan<strong>Satama</strong>n liikenteen <strong>ja</strong> henkilöautoliikenteen liikennemäärät<strong>ja</strong> päästöt pienenevät verrattuna siihentilanteeseen, että keskustan satamien kapasiteetinloputtua osa <strong>satama</strong>kapasiteetista joutuuhakeutumaan kymmenien kilometrien päähän <strong>ja</strong>asuntoalueet rakennetaan keskustan ulkopuolelle.22SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Hankkeen toteuttamatta jättämistä puolsivat seuraavattekijät:1. Eläimistöön kohdistuvat vaikutukset<strong>Satama</strong>toiminnat <strong>ja</strong> liikenne aiheuttavat häiriötäerityisesti Porvarinlahden linnustolle.2. Kasvillisuuteen kohdistuvat vaikutukset<strong>Satama</strong>toiminnat <strong>ja</strong> maaliikenneyhteydet vahingoittavatkasvillisuuden kannalta merkittäviä alueita.Luonnontilassa olevat Käärmeniemi, Lehdessaari,Pikku-Lehdessaaari, Västinki <strong>ja</strong> Varisluotosekä osat Fotängenistä <strong>ja</strong> Skillbergetistä jäävät<strong>satama</strong>n alle.3. Vaikutukset merialueellaRakentamisesta <strong>ja</strong> väylästä aiheutuu kielteisiä vaikutuksiauuden väylän <strong>ja</strong> <strong>satama</strong>n alueelle.Kielteiset vaikutukset vähenevät keskustan tuntumassa,mutta laivaliikenne alueella ei kuitenkaankokonaan lopu.4. Poh<strong>ja</strong>vesivaikutuksetYksi ratavaihtoehdoista sijoittuu osittain poh<strong>ja</strong>vedenmuodostumisalueelle <strong>ja</strong> tunnelit sekä muutrakentamistoimenpiteet saattavat aiheuttaa tilapäisiävaikutuksia poh<strong>ja</strong>vesiolosuhteisiin.3.4.4 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenhaittavaikutukset YVA-selostuksen mukaan<strong>Helsingin</strong> <strong>satama</strong>hankkeen vuonna 1995 valmistuneessaYVA-selostuksessa [6] arvioitiin <strong>Vuosaaren</strong><strong>satama</strong>n rakentamisen voivan aiheuttaa ilman lievennystoimenpiteitäseuraavanlaisia haitto<strong>ja</strong>:Poh<strong>ja</strong>vedetPääkaupunkiseudulla on käyttökelpoisia poh<strong>ja</strong>vesivaro<strong>ja</strong>niukasti. <strong>Satama</strong>n maaliikenneyhteyksienläheisyydessä on neljä poh<strong>ja</strong>vesialuetta: <strong>Vuosaaren</strong>,Vartiokylän <strong>ja</strong> Fazerilan sekä Hiekkaharjun–Hakkilanpoh<strong>ja</strong>vesialueet. Poh<strong>ja</strong>vesivaikutus voi pienentäähyödynnettävissä olevan poh<strong>ja</strong>veden määrää, alentaapaikallisesti poh<strong>ja</strong>veden korkeustasoa tai muuttaalaatua. Huonoin vaihtoehto poh<strong>ja</strong>veden kannaltaolisi rata Mustavuoreen tunnelissa.IlmanlaatuHankkeeseen liittyvät päästöt ilmaan ovat pieniäverrattuna pääkaupunkiseudun kokonaispäästöihin.<strong>Satama</strong>toimintaan liittyvät päästöt aiheutuvatlaivaliikenteestä, lastin käsittelystä <strong>satama</strong>-alueellasekä kuljetuksista maaliikenneväylillä. Paikallisestipäästöt vaikuttavat ilmanlaatuun lähiympäristössä.Sitä kautta vaikutukset kohdistuvat ihmisenterveyteen <strong>ja</strong> viihtyvyyteen sekä luontoon. <strong>Vuosaaren</strong><strong>satama</strong> tulisi si<strong>ja</strong>itsemaan ilmanlaadun kannaltapääkaupunkiseudun puhtaimmalla alueella.MaisemaMaaliikenneyhteyksien <strong>ja</strong> <strong>satama</strong>n maisemavaikutuksetvoivat kohdistua maisemallisesti arvokkaisiinalueisiin. Näitä ovat Västerkullan kartano <strong>ja</strong> sitäympäröivä avomaisema puuku<strong>ja</strong>nteineen, Porvarinlahtireunavyöhykkeineen, meren ranta, saaristo <strong>ja</strong>vesialueet, Mustavuori vallituksineen, Kasabergetinlänsiosat <strong>ja</strong> Nordsjön kartano lähiympäristöineen.Merimaisemassa <strong>satama</strong> laajentaisi merkittävästitelakka-alueen <strong>ja</strong> voimalaitoksen luonnontilaiseenmaisemaan tekemää aukkoa. Erityisesti Piku-Niinisaaren<strong>ja</strong> Mölandetin maisema Kalkkisaaren selällemuuttuisi voimakkaasti.MeluMelun päiväohjearvo 55 dB(A) ulottuu lähimpienyksittäisten asuntojen kohdalle pohjoisessa <strong>ja</strong> idässä.Mölandetin <strong>ja</strong> Pikku Niinisaaren lähimpien talojenluona melu on suurimmillaan noin 50 dB(A). ErityisestiPorvarinlahden kohdalla kaikki esitetyt maaliikennevaihtoehdotaiheuttavat ilman meluntorjuntatoimenpiteitämelun huomattavaa lisääntymistävirkistys- <strong>ja</strong> luonnonsuojelualueilla. Kehä III:n liikennemääränelinkertaistuu välillä Porvoonväylä–Itäväylä, joten melualueet kasvavat moninkertaisiksi.<strong>Satama</strong>toiminnan aiheuttama yli 55 dB(A):nmelu ulottuu virkistyskäytössä oleville Skillbergetinalueelle <strong>ja</strong> Porvarinlahden rannalle.Luonto- <strong>ja</strong> virkistysalueet<strong>Satama</strong> sijoittuu telakka-alueelle, merialueelle sekäLehdessaaren, Pikku Lehdessaaren, Västingin, Varisluodon<strong>ja</strong> Käärmeniemen maa-alueelle. Virkistyskäytönkannalta merkittävin muutos on se, ettäNiinilahden <strong>ja</strong> Ruusuniemen pienvene<strong>satama</strong>t sekähuomattava osa Kalkkisaaren selkää jäävät <strong>satama</strong>nalle. Eri maaliikennevaihtoehdot häiritsevät eri virkistysalueita.Kaikissa vaihtoehdoissa syntyy estevaikutuksia.Varsinkin Skillbergetin alue <strong>ja</strong> Porvarinlahdeneteläranta ovat maaliikenneyhteyksienrakentamisen jälkeen vaikeasti tavoitettavissa.PorvarinlahtiMaaliikennevaihtoehdosta riippuen rakennusaikaisetvaikutukset voivat kohdistua Porvarinlahdenvesialueelle tai rannan pehmeikköön. Kaivut, täytöttai rakenteet saattavat vaikeuttaa veden vaihtuvuuttatai aiheuttaa samentumista. Suuret rakennusaikaisetmuutokset voivat vaikuttaa useiden vuosiena<strong>ja</strong>n mm. rehevöitymiseen <strong>ja</strong> vesieliöstöön.SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö23


Arvokkaat luontoalueet <strong>ja</strong> linnusto<strong>Satama</strong>hankkeen toteuttaminen merkitsisi väistämättäItä-<strong>Vuosaaren</strong> luonnon köyhtymistä, sillä osaarvokkaista kohteista jäisi <strong>satama</strong>n alle. Maaliikenneyhteydetaiheuttavat Porvarinlahden–Mustavuorenalueen eläimistölle estevaikutuksia. Vaihtoehdoistariippuen eri maaliikenneyhteyksien haittavaikutuksetkohdistuisivat eri lintulajeihin.3.4.5 Haitallisten vaikutusten lieventäminenYVA-asetuksen 10§:n mukaan arviointiselostuksessakuuluu esittää ehdotus toimiksi, joilla ehkäistään <strong>ja</strong>rajoitetaan haitallisia ympäristövaikutuksia. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen arviointimenettelyn aikanaetsittiin keino<strong>ja</strong> haittavaikutusten lieventämiseksi.YVA-selostuksessa [6] todettiin mm., että eläimistöön<strong>ja</strong> virkistykseen kohdistuvia haitto<strong>ja</strong> vähennetäänmerkittävästi melusuo<strong>ja</strong>uksella <strong>ja</strong> kasvillisuusvaurioitarakentamisvaiheen huolellisellasuunnittelulla <strong>ja</strong> toteutuksella. Siltojen rakentamisenvaikutusten Porvarinlahden vesitasapainoonarvioitiin riippuvan rakentamistavasta. Suositeltiin,että Porvarinlahden vesialueelle tai pehmeillerannoille tehtäisiin mahdollisimman vähän rakenteita,ruoppauksia <strong>ja</strong> täyttöä. Herkillä alueilla voitaisiinhuolellisella toteutuksella vähentää linnuillepesimäaikana koituvaa haittaa. Ruoppaustekniikalla<strong>ja</strong> suo<strong>ja</strong>verhoilla voitaisiin rajoittaa ruoppauksista <strong>ja</strong>täytöistä johtuvaa samentumista pienemmälle alueelle<strong>ja</strong> lyhytaikaisemmaksi. Maisemallisilla perusteillaesitettiin rata- <strong>ja</strong> tielinjojen tarkennuksia mm.kartanoiden tuntumassa <strong>ja</strong> Hanabölen peltoaukealla.Saarimaisilla istutusalueilla voitaisiin pienentääkielteisiä maisemavaikutuksia pohjoiseen <strong>ja</strong> lounaaseen.Yhteysviranomaisena YVA-menettelyssä toiminutUudenmaan ympäristökeskus korosti lausunnossaanvuonna 1996 [8], että mikäli hankkeen vaikutuksetkohdistuisivat <strong>Vuosaaren</strong> <strong>satama</strong>-alueenvälittömässä läheisyydessä oleville kasvistollisesti<strong>ja</strong> linnustollisesti arvokkaille alueille, olisi kaikkikeinot käytettävä haittojen lieventämiseksi. <strong>Vuosaaren</strong>maaliikenneyhteyksissä tämä tarkoittaisi luonnonympäristöäsäästävien tunneliratkaisujen valintaa.Rakennustöiden yhteydessä olisi kiinnitettävähuomiota siihen, etteivät työmaan haitat leviä toimenpidealueenulkopuolelle.3.4.6 Myönteiset vaikutuksetseudun yhdyskuntarakenteeseenSelvitysten <strong>ja</strong> arviointien mukaan <strong>Helsingin</strong> tavarasatamienkeskittämisellä <strong>Vuosaaren</strong> uuteen <strong>satama</strong>anosoittautui olevan merkittäviä ympäristöhyötyjä seudunyhdyskuntarakenteeseen <strong>ja</strong> <strong>Helsingin</strong> kantakaupunkiin[6,18].• Länsi<strong>satama</strong>n <strong>ja</strong> Sörnäisten <strong>satama</strong>n alueille kantakaupunginhyvien joukkoliikenneyhteyksienäärelle voidaan rakentaa asunto<strong>ja</strong> 20 000 –30 000ihmiselle <strong>ja</strong> erityisesti Sörnäisten <strong>satama</strong>n alueellerunsaasti myös työpaikko<strong>ja</strong>. Kantakaupunginrannoille toteutetaan yhtenäinen virkistysreitistö<strong>ja</strong> uusia puisto<strong>ja</strong>.• Ilman <strong>satama</strong>ratkaisua vastaava määrä asunto<strong>ja</strong>jouduttaisiin rakentamaan muualle. Vaihtoehtoisetpaikat si<strong>ja</strong>itsisivat keskimäärin 26 km:npäässä <strong>Helsingin</strong> keskustasta. Tämä ha<strong>ja</strong>uttaisikoko seudun yhdyskuntarakennetta <strong>ja</strong> lisäisi arvioidenmukaan noin 73 miljoonaa vuotuista ajokilometriä.Rakentamiseen jouduttaisiin käyttämäänJätkäsaari Sörnäisten <strong>ja</strong> Hermannin ranta Keski-PasilaKuva 3.3<strong>Vuosaaren</strong> <strong>satama</strong>nrakentaminen mahdollistaaJätkäsaaren,Kala<strong>satama</strong>n <strong>ja</strong> Keski-Pasilan kehittämisen.24SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


kasvullista maata mm. seudun metsiä. Nyt rakennetaan<strong>satama</strong>- <strong>ja</strong> ratapihakäytöstä vapautuvillealueille, joiden maaperä tutkitaan <strong>ja</strong> kunnostetaan.• Keski-Pasilan ratapihan käyttö vähenee. Tällejoukkoliikenteen <strong>ja</strong> kaupunkirakenteen kannaltaedulliselle alueelle voidaan rakentaa asunto<strong>ja</strong> <strong>ja</strong>työpaikko<strong>ja</strong>.• Vaarallisten aineiden purkaminen, lastaaminen,varastointi <strong>ja</strong> kuljetukset poistuvat kantakaupunginasuin- <strong>ja</strong> toimistorakennusten läheltä. Noin100 000 ihmisen arvioidaan olevan alueilla, joillahe voivat altistua mahdollisissa vaara- tai onnettomuustilanteissamyrkyllisille aineille. NykyisenLänsi<strong>satama</strong>n liikenne ruuhkauttaa liikennettäRuoholahdessa <strong>ja</strong> lisää terveydelle haitallisiapäästöjä koko Länsi-<strong>Helsingin</strong> alueella.• Tavarajunien melu poistuu kantakaupungista.Raskaan autoliikenteen kokonaismäärä väheneeuudessa, liikenteellisesti edullisemmassa paikassa.Satamien välinen raskas liikenne poistuu.Sörnäisten <strong>satama</strong>n <strong>ja</strong> Länsi<strong>satama</strong>n yhteenlasketturaskas liikenne arkipäivisin on noin 2 300rekkaa <strong>ja</strong> noin 900 kuorma-autoa. Näistä 100 onsatamien välistä liikennettä.• Kantakaupungin raskaan liikenteen läpiajokieltoon johtanut satamien raskaan liikenteen keskustaakiertäville reiteille. Se kulkee taa<strong>ja</strong>an asuttujenalueiden halki <strong>ja</strong> ruuhkauttaa Kehä I:tä. Satamienvälinen raskas liikenne kulkee mm. Kuusisaaren,Munkkiniemen, Pasilan <strong>ja</strong> Vallilan kautta. Tavarasatamienkeskittäminen Vuosaareen siirtää merkittävänosan raskaasta liikenteestä keskeisenkaupunkialueiden ulkopuolisille reiteille, jotkaon suunniteltu tavaraliikennettä varten.3.5 YVA-menettelyn hyödytLaki ympäristövaikutusten arviointimenettelystätuli voimaan <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen suunnitteluaikana.YVA-menettelyllä oli hankkeen <strong>ja</strong>tkonkannalta useita etu<strong>ja</strong>, vaikka lain viipyminen <strong>ja</strong>arviointimenettelyn kesto vaikuttivat hankkeen valmisteluaikaan.1. Hankkeesta vastaavien <strong>ja</strong> eri osapuolten yhteistyötiivistyi. Tehokkaasti toimivat suunnitteluorganisaatiotsaatiin muodostettua nopeasti.2. Hankekokonaisuus hahmottui hyvin. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen – <strong>satama</strong>n, tien, radan <strong>ja</strong> meriväylän– YVA-menettely osoitti, ettei suurta hankettakannata pilkkoa osiin vaan hanke on tarkoituksenmukaistaarvioida kokonaisuutena.3. YVA-menettelyllä saatiin virallinen hyväksyntäselvitysten riittävyydelle <strong>ja</strong> löydettiin keskeisetlisäselvitystarpeet. Uudenmaan ympäristökeskustotesi yhteysviranomaisen lausunnossaan13. 3. 1996 [8], että hankkeen suunnitteluvaiheenhuomioon ottaen arviointiselostusta on yleisyydestäänhuolimatta pidettävä riittävänä <strong>ja</strong> selvityksiäon tarkennettava myöhemmin suunnittelu<strong>ja</strong>lupamenettelyissä.4. Osallistuminen <strong>ja</strong> tiedotus arviointimenettelynaikana avasivat keskustelua <strong>ja</strong> tekivät hankkeenvaikutuksineen tunnetuksi. <strong>Vuosaaren</strong> <strong>satama</strong> oliollut mukana jo <strong>Helsingin</strong> Yleiskaava 1992:ssa <strong>ja</strong>sen esittelytilaisuuksissa, mutta vasta YVA-menettelyynkuuluneet asukastilaisuudet <strong>ja</strong> -kysely sekälausuntovaiheet lisäsivät asukkaiden <strong>ja</strong> päätöksentekijöidentietoa hankkeesta.5. Arviointi auttoi näkemään ympäristövaikutustenkokonaisuuden <strong>ja</strong> erilaisten vaikutusten kietoutumisenyhteen.6. Arvioinnin aikana aloitettiin haittojen estämisen<strong>ja</strong> lieventämisen suunnittelu. Huolellisesti suunnitellut<strong>ja</strong> toteutetut lievennystoimet vaikuttivatoleellisesti hankkeen hyväksyttävyyteen <strong>ja</strong> etenemiseen[7].7. Arviointiselostuksessa aloitettiin vaikutusten seurannansuunnittelu.8. Arviointiselostusta <strong>ja</strong> menettelyn aikana tehtyjälisäselvityksiä voitiin käyttää myöhemmin sekäkaavavalmistelussa että hankesuunnittelussa.SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö25


3.6 YVA:n vaikutukset päätöksentekoon <strong>ja</strong> <strong>ja</strong>tkosuunnitteluun<strong>Helsingin</strong> kaupunginvaltuusto hyväksyi <strong>Vuosaaren</strong><strong>satama</strong>n perustamissuunnitelman vuonna 1996 <strong>ja</strong>käsitteli samalla myös hankkeen ympäristövaikutuksia.YVA-selostus oli <strong>ja</strong>ettu kaupunginvaltuustonjäsenille heti kun se oli valmistunut vuonna 1995.Kaupunginhallitus päätti valtuustokäsittelyn jälkeen29. 4. 1996 mm. seuraavaa [2]:• Liikenneyhteyksien suunnitelmissa otetaan huomioonympäristövaikutusten arviointimenettelyssäesille tulleet mahdollisuudet haittojen lieventämiseksi.• Meri- <strong>ja</strong> maaliikennevaihtoehtoratkaisu<strong>ja</strong> toteutettaessaetusi<strong>ja</strong>lle pannaan mahdollisuuksienmukaan ympäristöön <strong>ja</strong> luontoon vähiten haitto<strong>ja</strong>aiheuttava vaihtoehto <strong>ja</strong> otetaan huomioon ympäristöministeriössälaadittavana olevan Natura 2000-ohjelman periaatteet.• Ruopattaessa meriväylää <strong>ja</strong> rakennettaessa maayhteyksiänoudatetaan mahdollisuuksien mukaanluontoa <strong>ja</strong> ympäristöä säästäviä toteuttamistapo<strong>ja</strong>.<strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelman <strong>ja</strong>YVA-menettelyn jälkeen aloitettiin tien <strong>ja</strong> radanyleissuunnittelu. <strong>Satama</strong>tielle <strong>ja</strong> -radalle määriteltiinvuonna 1997 laa<strong>ja</strong>poh<strong>ja</strong>isissa hanke- <strong>ja</strong> ympäristöryhmissäyhdenmukaiset maankäyttö- <strong>ja</strong> ympäristötavoitteetseuraavasti:• Kaavojen maankäyttövarauksien toteutumistaedistetään. Virkistysaluekokonaisuudet <strong>ja</strong> niidenväliset yhteydet säilytetään.• Arvokkaat kulttuurimaisemakokonaisuudet pyritäänsäilyttämään.• Rakentaminen tehdään niin, että toimenpidealueetpysyvät mahdollisimman suppeina.• Luonnonsuojelun tavoitteena on turvata vähintäänsen nykyinen taso. Tavoitteena on, ettei millekäänarvoalueelle aiheuteta merkittävää haittaa.• Suunnitellun Natura 2000 -alueen erityisille luontoarvoilleei aiheuteta haittaa.• Rakentaminen ei saa vaikuttaa haitallisesti poh<strong>ja</strong><strong>ja</strong>pintavesiin tai niiden laatuun.• Meluntorjunnassa pyritään siihen, että alueilleasetetut ohjearvot eivät ylity.Tien yleissuunnitelmaan valittiin Porvarinlahden <strong>ja</strong>Labbackan mäen alittava tunneliratkaisu. Suunnittelussapäätettiin kiinnittää erityistä huomiota meluntorjuntaan,kuljetusriskien minimointiin, arvokkaidenkulttuurimaisemakokonaisuuksien säilyttämiseensekä arvokkaiden luontoalueiden <strong>ja</strong> erityisestiNatura-kohteeksi suunnitellun Mustavuoren lehdon<strong>ja</strong> Östersundomin lintuvesien alueen suojeluun.<strong>Satama</strong>radasta tutkittiin YVA-vaiheessa useitavaihtoehto<strong>ja</strong>. Kasvillisuus- <strong>ja</strong> poh<strong>ja</strong>vesiselvitystenjälkeen päätettiin luopua Mustavuoren läpi menevästätunnelivaihtoehdosta arvokkaan lehdon säästämiseksi<strong>ja</strong> valita radan vieminen sillalla Porvarinlahdenkapeikon yli <strong>ja</strong> Labbackan mäen ali.Meriväylävaihtoehdosta valittiin ns. Itä-Tontunlin<strong>ja</strong>us. Lähes suora väylä todettiin turvalliseksi<strong>ja</strong> helposti navigoitavaksi. Ruoppauksia tarvittiinyhteensä kahden kilometrin matkalla. Ruoppausmasso<strong>ja</strong>hyödynnettiin <strong>satama</strong>-alueen täytöissä.<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavaanotettiin määräyksiä, joilla huolehdittiin hankkeensopeutumisesta ympäristöön <strong>ja</strong> haittojen vähentämisestä.<strong>Satama</strong>n <strong>ja</strong> liikenneyhteyksien yksityiskohtaisessasuunnittelussa tarkennettiin lievennystoimia.Suunnitelmien tarkentuminen <strong>ja</strong> lievennystoimienvarmistuminen vaikuttivat osaltaan myös ympäristöministeriönmyönteiseen kantaan kaavojen vahvistusvaiheessa[7].Kaupunginvaltuuston tehtyä <strong>Vuosaaren</strong> <strong>satama</strong>nrakentamispäätöksen <strong>Helsingin</strong> kaupunginhallituskehotti 14. 10. 2002 <strong>Helsingin</strong> <strong>Satama</strong>a huolehtimaansiitä, että <strong>satama</strong>n yksityiskohtaisessa suunnittelussa<strong>ja</strong> rakennusaikana otetaan huomioon ympäristöhaittojenlieventämien <strong>ja</strong> erityisesti se, että työmaastasen ulkopuolelle mahdollisesti aiheutuvat haitat jäävätmahdollisimman vähäisiksi [3].26SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 3.4Ilmakuva alueeltaennen <strong>Vuosaaren</strong><strong>satama</strong> hankkeentoteuttamista vuodelta2002. Kuvassa näkyyetualalla vanha telakkaalue<strong>ja</strong> voimalaitos <strong>ja</strong>oikealla Porvarinlahti.L ä h t e e t1. Erkamo, V. 1949. Ehdotus <strong>Helsingin</strong> seudun luonnonsuojelukohteiksi.<strong>Helsingin</strong> <strong>ja</strong> sen ympäristön aluesuunnitelmaliitto.2. <strong>Helsingin</strong> kaupunginhallitus, pöytäkir<strong>ja</strong>note 29. 4. 1996,Kaupunginvaltuuston 24. 4.1996 tekemien päätöstentoimeenpano.3. <strong>Helsingin</strong> kaupunginhallitus, pöytäkir<strong>ja</strong>note 14.10. 2002.1305§. Kaupunginvaltuuston 9.10. 2002 tekemien päätöstentäytäntöönpano. Teknistä tointa johtavan apulaiskaupunginjohta<strong>ja</strong>ntoimiala, 13.4. <strong>Helsingin</strong> <strong>satama</strong>n kehittämisen suuntaviivat (SAKE)-työryhmän loppuraportti 16. 1. 1990. <strong>Helsingin</strong> kaupunki.5. Insinööritoimisto Paavo Ristola Oy. Ympäristövaikutustenarviointi, arviointiohjelma. <strong>Helsingin</strong> <strong>satama</strong>hanke.<strong>Helsingin</strong> kaupunki <strong>ja</strong> Merenkulkuhallitus 1994.6. Insinööritoimisto Paavo Ristola Oy. Ympäristövaikutustenarviointiselostus. <strong>Helsingin</strong> <strong>satama</strong>hanke. <strong>Helsingin</strong>kaupunki 29. 9.1995.7. Lausunto korkeimmalle hallinto-oikeudelle, ympäristöministeriö9. 4. 2002. Lausunto valituksista koskienympäristöministeriön päätöstä <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong>sen liikenneyhteyksiä koskevan seutukaavan <strong>ja</strong> seutukaavanmuutoksen vahvistamisesta 24. 1. 2002.8. Lausunto ympäristövaikutusten arviointiselostuksesta,<strong>Helsingin</strong> <strong>satama</strong>hanke. Uudenmaan ympäristökeskus13. 3. 1996.9. Liikennetekniikka Oy 1986. <strong>Helsingin</strong> vaikutusalueen <strong>satama</strong>vaihtoehtojentoteuttamisen edellytykset <strong>ja</strong> seuraamukset.<strong>Helsingin</strong> seutukaavaliiton julkaisu<strong>ja</strong> 21/1986.10. Liikennetekniikka Oy, Neptun Oy 1977. <strong>Helsingin</strong> vaikutusalueen<strong>satama</strong>vaihtoehdot. <strong>Helsingin</strong> seutukaavaliitto,<strong>satama</strong>työryhmä.11. Liikennetekniikka Oy 1991. Vuosaari–Niinisaari-osayleiskaava.Osayleiskaavaluonnoksen ympäristövaikutusselvitys1991. <strong>Helsingin</strong> kaupunki kaupunkisuunnitteluvirasto/yleiskaavatoimisto,Kaupunginkanslia/Vuosaari-toimisto.12. Liikennetekniikka Oy. Ympäristövaikutusten arvio Vuosaari–Niinisaari-osayleiskaava.<strong>Helsingin</strong> kaupunkikaupunkisuunnitteluvirasto, yleiskaavaosasto julkaisuYA:25/1989.13. LT-Konsultit Oy. Sörnäisten <strong>satama</strong>n siirron ympäristövaikutukset.<strong>Helsingin</strong> kaupunki, kaupunginkanslia,yleiskaavatoimisto 1992.14. Mustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet(FI0100065) -Natura-tietolomake. Uudenmaan ympäristökeskus19. 3. 1998.15. Satamien kehittämisohjelma, <strong>Satama</strong>-asiainneuvottelukunta(SANKA) komiteanmietintö 1988:47.16. Suunnittelukeskus Oy, Liiketaloustieteellinen tutkimuslaitos,<strong>Satama</strong>tekninen Oy. RAMA <strong>Helsingin</strong> valinnaisiakäyttömahdollisuuksia omaavia ranta-alueita koskevaselvitys. <strong>Helsingin</strong> kaupunginkanslia, talous- <strong>ja</strong> suunnitteluosasto14. 3. 1984.17. Vuolanto, S. 1970. <strong>Helsingin</strong> itäiset kaupunginosat, biologinentutkimus 31. 12. 1970. Kaupunkisuunnitteluvirasto,yleiskaavaosasto.18. <strong>Vuosaaren</strong> <strong>satama</strong>hanke <strong>ja</strong> ympäristö. Esite 2005. VUO-SA-projekti, VUOLI-projekti.19. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteydet, vaihtoehtotarkastelu1994. VUOLI-työryhmä, <strong>Helsingin</strong> kaupunki,Vantaan kaupunki, Sipoon kunta, Valtionrautatiet,Uudenmaan tiepiiri, Suunnittelukeskus Oy.20. <strong>Vuosaaren</strong> <strong>satama</strong>n valmistelutoimenpiteitä koskevamuistio 25. 3. 1991. <strong>Helsingin</strong> <strong>satama</strong>laitos.21. <strong>Vuosaaren</strong> <strong>satama</strong>n YVA, neuvottelu Uudenmaan lääninhallituksessa19. 5. 1993, muistio.22. <strong>Vuosaaren</strong> suunnittelukomitean mietintö. <strong>Helsingin</strong>kaupunki kaupunginhallituksen mietinnöt 3–1968.23. Ympäristövaikutusten arviointi. Komitean mietintö1982:46.24. Ympäristövaikutusten arviointi. YVA 92 -työryhmänmietintö. Ympäristöministeriö, ympäristönsuojeluosasto.Työryhmän mietintö 65/1992.25. YVA-laki <strong>ja</strong> Vuosaari, neuvottelu <strong>Helsingin</strong> <strong>satama</strong>laitoksella9. 6. 1992, muistio.SATAMAN YMPÄRISTÖVAIKUTUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö27


4<strong>Vuosaaren</strong> <strong>satama</strong>hanke<strong>ja</strong> Natura 20004.1 TaustaKuva 4.1Mustavuoren lehto <strong>ja</strong>Östersundomin lintuvedetNatura 2000 -aluesekä <strong>Vuosaaren</strong> <strong>satama</strong>hankkeensi<strong>ja</strong>inti.Natura 2000 on EU:n jäsenvaltioiden yhteinen luonnonsuojelualueidenverkosto, johon kuuluvilla erityissuojelualueillasuojellaan EU:n alueella esiintyvääluonnonvaraista eläimistöä <strong>ja</strong> kasvistoa. EU:nNatura 2000 -suojelualueverkosto perustuu neuvostondirektiiviin 92/43/ETY luontotyyppien sekäluonnonvaraisen eläimistön <strong>ja</strong> kasviston suojelusta(luontodirektiivi). Natura 2000 -suojelualueverkostoonon sisällytetty myös ensimmäisen EU:n luonnonsuojelusäädöksen,nimittäin jo vuonna 1979hyväksytyn neuvoston direktiivin luonnonvaraistenlintujen suojelusta (79/409/ETY, lintudirektiivi)mukaiset erityissuojelualueet.KasabergetLabbackaPorvarinlahtiBruksvikenKapellvikenTorpvikenSuomessa Natura 2000 -verkosto on toteutettuluonnonsuojelulain (1096/1996) 64 §:n no<strong>ja</strong>lla tehdyllävaltioneuvoston päätöksellä 20. 8. 1998 sekäsen jälkeen tehdyillä täydentävillä päätöksillä. Päätöksestätehtiin korkeimpaan hallinto-oikeuteen yli1 600 valitusta. Korkein hallinto-oikeus antoi valitustenpääosaan päätöksensä 14. 6. 2000. Näillä päätöksilläkorkein hallinto-oikeus hylkäsi valtaosansille tehdyistä valituksista, minkä johdosta verkostotuli Suomessa voimaan lähes sellaisena kuin valtio-neuvosto oli sen päättänyt. Vain 48 aluetta kumottiintai palautettiin uudelleen käsiteltäväksi.Sittemmin komissio on luontodirektiivin mukaisestihyväksynyt Suomen ehdotuksen osana boreaalisenluonnonmaantieteellisen vyöhykkeen Naturaalueitavuoden 2005 tammikuussa [1] <strong>ja</strong> uudelleenvuoden 2007 marraskuussa [2]. Suomessa onNatura-alueita tällä hetkellä noin 1 800 kappaletta.Niiden yhteinen pinta-ala on noin 5 miljoonaa hehtaaria,joista maa-alueita on noin 3,6 miljoonaa hehtaaria.Suomen Natura-alueista 19 kappaletta kuuluuluontodirektiivin mukaisessa järjestelmässä Alpiiniseenvyöhykkeeseen, josta komissio on tehnyt päätöksenvuonna 2003 <strong>ja</strong> päivityspäätöksen vuonna2008. Nämä alueet si<strong>ja</strong>itsevat tunturilapin pohjoisimmissaosissa. Natura-alueita on Suomen pintaalastaliki 15 prosenttia. Suomen osalta verkosto onkäytännössä riittävästi toteutettu luontodirektiivinliitteen I luontotyyppien <strong>ja</strong> liitteen II lajien suojelualueidenriittävyyden ollessa lähes 100 %. Kansallisessaprosessissa on vielä kesken kolmen Natura2000 -alueen käsittely valitusten <strong>ja</strong> KHO:n päätöstenvuoksi. Lisäksi koko EU:ssa mereiset Natura 2000-alueet ovat kesken. Komissio edellyttää, että jäsenmaatantavat niitä koskevat ehdotuksensa vuoden2008 aikana.Natura 2000 -suojelustatus aiheuttaa rajoituksiaalueen käytölle. Suuri osa Suomen Natura 2000 -alueista toteutetaan perustamalla luonnonsuojelualueita.Tämä saattaa jopa johtaa alueen lunastamiseenvaltiolle luonnonsuojelulain 52 §:n no<strong>ja</strong>lla.Luonnonsuojelulain 65 §:n mukaan on Natura-alueilla<strong>ja</strong> niiden lähialueilla arvioitava erilaisten hankkeidenvaikutuksia Natura-luonnonarvoihin. Joshanke tai suunnitelma joko yksistään tai tarkasteltunayhdessä muiden hankkeiden <strong>ja</strong> suunnitelmienkanssa todennäköisesti merkittävästi heikentää niitäluonnonarvo<strong>ja</strong>, joiden suojelemiseksi alue on sisällytettyNatura 2000 -verkostoon, hankkeen toteutta<strong>ja</strong>ntai suunnitelman laati<strong>ja</strong>n on asianmukaisellatavalla arvioitava nämä vaikutukset. Sama koskeesellaista hanketta tai suunnitelmaa alueen ulkopuolella,jolla todennäköisesti on alueelle ulottuvia merkittäviähaitallisia vaikutuksia.28VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aKari Marttinen, oikeustieteen lisensiaatti, asiana<strong>ja</strong><strong>ja</strong>, toimiiympäristöoikeuden kompetenssiryhmän vetäjänä asianajotoimistoHammarström Puhakka Partners Oy:ssä. Hän on hoitanut <strong>Vuosaaren</strong><strong>satama</strong>hankkeen oikeusprosesse<strong>ja</strong> vuodesta 1996 alkaen.Lain 66 §:n mukaan viranomainen ei saa myöntäälupaa hankkeen toteuttamiseen taikka hyväksyä taivahvistaa suunnitelmaa, jos 65 §:n 1 <strong>ja</strong> 2 momentissatarkoitettu arviointi- <strong>ja</strong> lausuntomenettely osoittaahankkeen tai suunnitelman merkittävästi heikentävänniitä luonnonarvo<strong>ja</strong>, joiden suojelemiseksi alueon sisällytetty tai on tarkoitus sisällyttää Natura2000 -verkostoon. Vaikka eri jäsenvaltioissa onkinerilaisia käsityksiä siitä, kuinka tiukkaa Natura 2000-alueiden suojelun tulisi olla, on EY:n tuomioistuintulkinnut luontodirektiivin velvoitteita, kuten heikentämiskieltoahyvinkin tiukasti. HeikentämiskiellostaEY:n tuomioistuin lausui asiassa C-127/02Waddenzee seuraavasti:”Erityisesti luontodirektiivin 6 artiklan 3 kohdassa asetettujenharkintavallan rajojen osalta tästä säännöksestäilmenee, että pääasiassa kyseessä olevan kaltaisessatilanteessa toimivaltaiset kansalliset viranomaisetvoivat hyväksyä sydänsimpukoiden mekaanisen pyynninvain varmistuttuaan siitä, että se ei vaikuta kyseisen alueenkoskemattomuuteen, kun otetaan huomioon tämäntoiminnan vaikutusten asianmukaista arviointia koskevatpäätelmät, <strong>ja</strong> että näin on silloin, kun ei ole olemassamitään tieteelliseltä kannalta järkevää epäilyä tällaistenvaikutusten aiheutumatta jäämisestä (ks. tämän tuomion59 kohta).”4.2 Yleistä Natura 2000 -alueiden valinnasta SuomessaNatura 2000 -alueiden valinta perustuu luontodirektiivin3 <strong>ja</strong> 4 artiklaan sekä direktiivin liitteeseen III.Direktiivin 3 artiklassa säädetään Natura 2000 -verkostontavoitteista. Sen mukaan perustetaan erityistensuojelutoimien alueiden yhtenäinen eurooppalainenekologinen verkosto. Tämän verkoston avullaon varmistettava kyseisten luontotyyppien <strong>ja</strong> lajienelinympäristöjen suotuisan suojelun tason säilyttäminentai tarvittaessa ennalleen saattaminen niidenluontaisella levinneisyysalueella. Kunkin jäsenvaltionon edistettävä Natura 2000 -verkoston aikaansaamistasiinä suhteessa kuin sen alueella esiintyyluontodirektiivin liitteessä I tarkoitettu<strong>ja</strong> luontotyyppejä<strong>ja</strong> liitteessä II tarkoitettujen lajien elinympäristöjä.Jäsenvaltion on tätä varten osoitettava 4 artiklanmukaisesti alueita erityisten suojelutoimien alueiksiottaen huomioon suotuisan suojelutason tavoite.Direktiivin 4 artikla sisältää varsinaiset säännöksetalueiden valintamenettelystä sekä viittauksenliitteeseen III, jossa säädetään alueiden valinnanaineellisoikeudellisista kriteereistä. Valintamenettelykoostuu kolmesta eri vaiheesta:1. ensin jäsenvaltio laatii 1-vaiheessa kansallisenehdotuksen yhteisön tärkeinä pitämiksi alueiksi(SCI-alueet);2. sitten komissio laatii yhteistyössä jäsenvaltioidenkanssa 2-vaiheessa ehdotuksen yhteisön tärkeinäpitämiksi alueiksi <strong>ja</strong> päättää niistä erikseen kunkinluonnonmaantieteellisen vyöhykkeen osalta.Vyöhykkeitä on nykyisin EU:n laajennuttua kaikkiaan9 kappaletta. Suomi kuuluu pääosin boreaaliseenluonnonmaantieteelliseen vyöhykkeeseen.Ylä-Lapin tunturialueet kuuluvat alpiiniseen vyöhykkeeseen.3. Lopuksi jäsenvaltio muodostaa SCI-alueista erityistensuojelutoimien alueita (SAC). Direktiivisallii hyvin laa<strong>ja</strong>-alaisen menettelyvalikoimanSAC-alueiden muodostamisessa.Tässä yhteydessä on hyvä vielä huomata, että Suomiliittyi EU:iin 1. 1. 1995 pyytämättä jäsenyysneuvotteluissalisäaikaa luontodirektiivin täytäntöönpanolle.Tästä johtuen Suomen olisi tullut hyväksyä 1. vaiheenkansallinen ehdotus SCI-alueiksi jo vuoden 1995 kesäkuussa,mikä aikataulu oli jo alun perin täysin mahdotonkunnollisen valintaprosessin läpiviemiseksi.VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö29


4.3Mustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet Natura 2000 -alueenvalintakriteeritMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedetNatura 2000 -alue (tunnus FI0100065) muodostuuMustavuoren lehdosta <strong>ja</strong> neljästä merenlahdesta eliPorvarinlahdesta, Bruksvikenistä, Torpvikenistä <strong>ja</strong>Kapellvikenistä (lueteltuina lännestä itään). Aluesisältyy Natura 2000 -verkostoon sekä luontodirektiivinmukaisena SCI-alueena että lintudirektiivinmukaisena SPA-alueena. Alueen koko on 355 hehtaaria.Alueen valintaperusteina ovat luontodirektiivinluontotyypeistä tärkeimpinä boreaaliset lehdot<strong>ja</strong> kasvipeitteiset silikaattikalliot <strong>ja</strong> kasvipeitteisetkalkkikalliot. Boreaalisia lehto<strong>ja</strong> on 10 % alueenkoko pinta-alasta. Vähemmän tärkeinä suojelutavoitteinaovat muun muassa olleet luontodirektiivinmukaan laa<strong>ja</strong>t matalat lahdet, vaihettumissuot <strong>ja</strong>rantasuot. Kaikki luokittelun perustana olevat luontotyypiton esitetty seuraavassa taulukossa:Luontotyyppi pinta-ala luokkaLaa<strong>ja</strong>t matalat lahdet 23 % CKostea suurruohokasvillisuus 3 % BAlavat niitetyt niityt 0–1 % BVaihettumissuot <strong>ja</strong> rantasuot 37 % CKasvipeitteiset kalkkikalliot 1 % BKasvipeitteiset silikaattikalliot 8 % BBoreaaliset lehdot 10 % AFennoskandian metsäluhdat 2 % CKuusivaltaiset puustoiset suot 0–1 % CLuokittelussa (A–D) A edustaa erinomaista <strong>ja</strong> Dei merkittävää suojeluarvoa. Suuri pinta-ala tekeelaajoista matalista lahdista, vaihettumissoista <strong>ja</strong>rantasoista merkittäviä kohteessa, vaikka niidensuhteellinen suojeluarvo onkin luokassa C. Luontodirektiivinliitteen II lajeista alueella on joskushavaittu korpihohtosammalta.Kaikkein merkittävintä suojeluarvoa kohteessaedustavat kuitenkin alueella esiintyvät lintudirektiivinliitteen I lajit. Niitä ovat:LajiPikkusieppoKirjokerttuYleisarvioPyy -KalatiiraPikkulepinkäinenLuhtahuittiRuisrääkkäLaulujoutsenSuokukkoLiroKehrääjäBBCBBB(levähtävä)(levähtävä)(levähtävä)Näiden luokitteluperusteena olevien lintulajienelinympäristöjen heikentäminen on vastaavastikielletty, samoin kuin luontodirektiivin mukaistenluontotyyppien <strong>ja</strong> lajienkin. Kielto perustuu lintujenkinosalta edellä selostettuun LSL 66 §:ään.CKuva 4.2Porvarinlahti on matala<strong>ja</strong> kapea ruovikkoinenlahti, joka sijoittuulähelle <strong>Vuosaaren</strong><strong>satama</strong>a. Kuva otettutammikuussa 2008.Kuva: <strong>Vuosaaren</strong><strong>satama</strong>n mediapankki30VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 4.3Pikkulepinkäinen (vas.)<strong>ja</strong> kirjokerttu olivatmerkittävässä roolissa,kun hankkeen vaikutuksiaNatura-alueeseenarvioitiin. Niiden reviirejäsi<strong>ja</strong>itsi Porvarinlahdenrantavyöhykkeellä.Kuvat: Lasse J. LaineTietoa näiden lintulajien esiintymisestä Naturakohteessa<strong>ja</strong> sen ympäristössä on kansainväliselläkintavalla ainutlaatuisesti kerätty <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenlinnustoseurannalla, jota on tehty vuodesta2002 lukien. Raportit on julkaistu <strong>Helsingin</strong>kaupungin ympäristökeskuksen julkaisusar<strong>ja</strong>ssa <strong>ja</strong>ne ovat löydettävissä internetin välityksellä <strong>Vuosaaren</strong><strong>satama</strong>hankkeen kotisivuilta (ks. 13).Merenlahdet ovat valtakunnallisesti arvokkaiksiluokiteltu<strong>ja</strong> linnustoltaan <strong>ja</strong> kuuluvat lintuvesiensuojeluohjelmaan. Kapellviken on merenlahdistalaajin <strong>ja</strong> se on arvioitu merkittävimmäksi alueenlintuvesistä, vaikka suojeluarvossa ei olekaan merkittävääeroa muihin lahtiin. Lajisto vaihtelee erilahdissa, Kapellvikenissä korostuvat ruovikkolajit,kun taas Porvarinlahdella on varpuslintu<strong>ja</strong> <strong>ja</strong> vesilintu<strong>ja</strong>.Merenlahdet ovat merkittäviä muutonaikaisialevähdysalueita useille lintulajeille.4.4 Valitukset <strong>ja</strong> niiden käsittely KHO:ssaValtioneuvoston päätöksestä 20. 8. 1998, jolla muidenalueiden ohella hyväksyttiin Mustavuoren lehto<strong>ja</strong> Östersundomin lintuvedet -alue Suomen kansalliseen1. vaiheen ehdotukseen SCI-alueista sekä alueenluokittelusta lintudirektiivin mukaiseksi SPAalueeksi,valitettiin korkeimpaan hallinto-oikeuteen.Valittajina olivat eräs Sipoon puolella olevaa tilaahallinnoiva kuolinpesä, Pelastetaan Vuosaari! kansalaisliike,BirdLife Suomi ry <strong>ja</strong> <strong>Helsingin</strong> SeudunLintutieteellinen Yhdistys Tringa ry <strong>ja</strong> Suomenluonnonsuojeluliitto ry.Valituksissa vaadittiin ensisi<strong>ja</strong>isesti kohteen ra<strong>ja</strong>uksenlaajentamista. Laajennusvaatimuksia esitettiinmerenlahtien välisiin metsäalueisiin sekä peltoihin<strong>ja</strong> kallioihin. Kasabergetin ra<strong>ja</strong>usta, joka noudattikunnanra<strong>ja</strong>a, moitittiin myös kaikissa luontojärjestöjenvalituksissa. Valituksiin oli liitetty kartat, joidenmukaan ra<strong>ja</strong>usta vaadittiin muutettavaksi. Kuolinpesänvalituksessa myös vaadittiin täydentämään alueensuojelun perustana olevia laje<strong>ja</strong>, erityisesti lintulaje<strong>ja</strong>.Ympäristöministeriö antoi valituksesta lausunnot[3], jossa se viittasi nk. yleislausuntoon (päivätty1. 3. 1999), jonka ministeriö antoi muun muassa Maa<strong>ja</strong>metsätaloustuotta<strong>ja</strong>in keskusjärjestö MTK ry:nvalitukseen sekä eräiden luontojärjestöjen valituksiin.MTK oli vaatinut koko valtioneuvoston päätöksenkumoamista <strong>ja</strong> luontojärjestöt lukuisten alueidenlisäämistä päätökseen. Kyseisessä yleislausunnossakäsiteltiin laa<strong>ja</strong>sti muun muassa Natura-alueidenvalintamenettelyä sekä oikeusvaikutuksia. Valintamenettelyäpidettiin lausunnossa luontodirektiivinmukaisena eikä ministeriö nähnyt tarvetta kumotapäätöstä eikä lisätä siihen alueita. Erityisesti Mustavuorenlehto <strong>ja</strong> Östersundomin lintuvedet -alueenosalta ministeriö totesi alueen luonnonsuojelullisestitärkeimpien <strong>ja</strong> edustavimpien alueiden tulleensisällytetyksi kohteeseen eikä nähnyt tarvetta muuttaakohteen ra<strong>ja</strong>usta.Korkein hallinto-oikeus hylkäsi kaikki kohdettakoskevat valitukset <strong>ja</strong> jätti tutkimatta PelastetaanVUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö31


Kuva 4.4Labbackanmäelläsi<strong>ja</strong>itsevat puustoisetsuot kuuluvat luontodirektiivinperusteellaensisi<strong>ja</strong>isesti suojeltaviinluontotyyppeihin.Kuva: Lauri ErävuoriVuosaari! -kansalaisliikkeen valituksen. Tutkimattajättäminen perustui siihen, ettei yhdistystä olturekisteröity [4].Valitusten hylkääminen merkitsi sitä, ettei kohteenra<strong>ja</strong>uksiin tehty mitään muutoksia. Eri valitusperusteistaKHO lausui, että vaikka ra<strong>ja</strong>usosin noudattikin vanhojen luonnonsuojeluohjelmienra<strong>ja</strong>uksia, perustui se myös luontodirektiivinmukaisten luontotyyppien <strong>ja</strong> lajien sekä lintudirektiivinmukaisten lajien esiintymiseen alueella. Kohteenra<strong>ja</strong>usta pidettiin perusteltuna ottaen huomioonalueen ympärillä oleva rakennuskanta sekä alueeseenkohdistuneet luonnontilaa muuttaneet toimenpiteet.Kasabergetin kallioalueen ra<strong>ja</strong>us, joka kulkipitkin kunnan ra<strong>ja</strong>a, todettiin perustelluksi, koska seturvasi edustavimman silikaattikalliot-luontotyypinesiintymän <strong>ja</strong> ra<strong>ja</strong> noudatti lisäksi jyrkänteen reunaa.Mitä tuli siihen väitteeseen, että alueen lajistostapuuttui runsaasti siellä esiintyviä lintulaje<strong>ja</strong>, KHOtotesi, että lajit eivät esiintyneet siellä lintudirektiivinedellyttämällä tavalla säännöllisesti, vaan satunnaisesti.Osa lajeista oli alueella saalistavia osa muutonaikaansatunnaisesti levähtäviä tai satunnaisestipesiviä. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen kannalta KHO:nlopputulosta voidaan pitää hyvänä, vaikkakin laajennuskaanei olisi estänyt hanketta sen ollessa yleisenedun kannalta pakottavasta syystä toteutettavahanke <strong>ja</strong> siten luonnonsuojelulain 66 §:n edellytyksettäyttävä.4.5 Natura-alueen <strong>ja</strong> -säännöstön merkityksestä <strong>Vuosaaren</strong> <strong>satama</strong>hankkeessa4.5.1 Naturan laadintavaiheen pohdinto<strong>ja</strong><strong>ja</strong> suunnan valintaaSuomen jäsenyyden johdosta mahdoton aikatauluNatura 2000 -verkoston valmistelussa <strong>ja</strong> komissionpainostus edellyttivät liian nopeata toimintaa asiassa.Tämä havaittiin myös <strong>Helsingin</strong> kaupungin elimissä,kun Mustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet-kohde ilmaantui Suomen ehdotukseen. Tuossa vaiheessa<strong>Helsingin</strong> kaupungin virkakoneistossa olivoimakas pyrkimys vaikuttaa ympäristöministeriöönkohteen poistamiseksi Natura-ehdotuksesta. Tässäyhteydessä on kuitenkin syytä muistaa, että FirstCorporate Shipping C-371/98 ratkaisuun johtaneestaoikeusjutusta Iso-Britannian oikeusistuimissa oli joNaturan valmisteluvaiheessa tuolloin saatu tietoa.Tässä vaiheessa olisi ollut suuresti riskialtista ryhtyäpoistamaan kohdetta verkostoehdotuksesta. Vaikkapoistaminen olisi tapahtunutkin sillä perustella,etteivät alueen luontoarvot ole riittävän merkittäviä,olisi tapaus mitä suurimalla todennäköisyydellä rin-32VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


nastettu First Corporate Shipping -tapaukseen. SiinähänEY:n tuomioistuin lopulta päätti ennakkoratkaisuasiana,että taloudellisia tekijöitä, kuten<strong>satama</strong>n laajennusta, ei voitu ottaa huomioon ra<strong>ja</strong>tessaNatura 2000 -alueita. Samankaltaisuus <strong>Vuosaaren</strong>tapaukseen olisi ollut ilmeinen.Näin ollen tuolloin oli <strong>Helsingin</strong> kaupungin <strong>ja</strong><strong>satama</strong>n näkökulmasta viisaampaa olla vastustamattaMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet-alueen sisällyttämistä Natura 2000 -ehdotukseen.Näin sitten päädyttiinkin menettelemään, eikä<strong>Helsingin</strong> kaupunki tai <strong>Helsingin</strong> <strong>Satama</strong> vastustanutMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet-kohteen sisällyttämistä Suomen Natura-ehdotukseen.Tämän jälkeen tuli tarpeelliseksi varautua senvaikutuksiin <strong>satama</strong>hankkeessa.4.5.2 Natura-arviointi vuonna 1998Kun alue ehdotukseen sitten sisällytettiin, kävi ilmeiseksi,että <strong>Vuosaaren</strong> <strong>satama</strong>n kaavoitushankkeissaeli seutukaavaa <strong>ja</strong> asemakaavaa varten oli tehtäväluonnonsuojelulain 65 §:ssä tarkoitettu arviointi.Arviointi laadittiin vuonna 1998 <strong>ja</strong> se oli ensimmäinenlaatuaan Suomessa. Arvioinnissa sen tekijätpäätyivät lopputoteamukseen, jonka mukaan <strong>satama</strong>hankeheikentää Natura 2000 -alueen luontoarvo<strong>ja</strong>(Kurki & Mykrä; Biota BD Oy, 15. 4. 1998) [5]. Selvityksenjohtopäätöksissä todettiin:Arviomme mukaan <strong>Vuosaaren</strong> <strong>satama</strong>hanke maaliikenneyhteyksineenheikentää Natura 2000 -ohjelmaanehdolla olevan alueen (Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet) luonnonarvo<strong>ja</strong>. Lintujen osalta heikentyminenon seurausta elinympäristön pirstoutumisestasekä <strong>satama</strong>n <strong>ja</strong> <strong>satama</strong>liikenteen melusta <strong>ja</strong> häiriöstä.Kasvillisuusvaikutukset johtuvat kasvupaikkojen jäämisestärakentamisen alle sekä rakentamisen pienilmastomuutoksista.Siltä osin kun tässä selvityksessä kuvaamamme vaikutuksetkohdistuvat kansainvälisesti <strong>ja</strong> kansallisestiuhanalaisiin luontotyyppeihin <strong>ja</strong> lajeihin, heikennystävoidaan näkemyksemme mukaan pitää merkittävänä.Tämä siksi, että lajin tai luontotyypin määrittely uhanalaiseksitarkoittaa sinällään jo suojelutason olevan tällähetkellä epäsuotuisa. Natura-alueella esiintyvistä lintulajeistatällaisia ovat kirjokerttu, harmaapäätikka, pyy <strong>ja</strong>pikkulepinkäinen (lintudirektiivin liite I) sekä pikkutikka(UHEKS-toimikunta 1991), <strong>ja</strong> luontotyypeistä <strong>satama</strong>radanPorvarinlahti-vaihtoehdossa laa<strong>ja</strong>t matalat lahdet(luontodirektiivin liite I) tai Mustavuori-vaihtoehdontoteutuessa boreaaliset lehdot (luontodirektiivin liite I).Uudenmaan ympäristökeskus antoi Natura-arvioinnistalausuntonsa 19. 3. 1999 [6], jossa myös päädyttiinsiihen, että heikennys Natura-luonnonarvoilleoli merkittävää. Uudenmaan ympäristökeskuksenmukaan heikennys oli merkittävää pikkulepinkäiselle,kirjokertulle, pyylle <strong>ja</strong> kehrääjälle niiden elinympäristöönkohdistuvien haitallisten vaikutustenjohdosta. Millekään luontotyypille Uudenmaanympäristökeskus ei pitänyt heikennystä merkittävänä.4.5.3 Luonnonarvojen heikentämiskielto<strong>ja</strong> asioiden käsittelyjärjestysVaikka sekä arviointi että siitä annettu Uudenmaanympäristökeskuksen lausunto, jotka siis olivatmolemmat ensimmäisiä laatuaan, olivat YM:n seutukaavanvahvistamispäätöksessä <strong>ja</strong> KHO:n ratkaisussaosoitetulla tavalla puutteellisia, osin sisällöllisestiristiriitaisia <strong>ja</strong> esimerkiksi komission sittemminvuonna 2000 julkaiseman luontodirektiivin 6 artiklantulkintaohjeen vastaisia, oli seutukaavaa hyväksyvälläUudenmaan liitolla tuolloin käytännössä vainyksi mahdollisuus eli LSL 66 §:n mukaisen poikkeusluvanhakeminen. Näin ollen Uudenmaan liittojätti valtioneuvostolle luonnonsuojelulain 66 §:ssätarkoitetun poikkeuslupahakemuksen 30. 4. 1999(hakemus päivätty 26. 4. 1999). HakemuksessaanUudenmaan liitto kuitenkin totesi, ettei Uudenmaanympäristökeskuksen lausunnon arviota luonnonarvojenmerkittävästä heikentymisestä voitu pitäätäysin kiistattomana <strong>ja</strong> loogisena johtopäätöksenätehdyistä selvityksistä <strong>ja</strong> tutkimuksista. Uudenmaanliitossa <strong>ja</strong> <strong>Helsingin</strong> <strong>Satama</strong>ssa sekä muutoinasian arviointiin osallistuneiden piirissä ml. tämänkirjoitta<strong>ja</strong>, esitettiin kyllä hakemukseen nähden voimakkaampiakinepäilyksiä heikennyksen merkittävyysarvioinninlopputuloksen oikeellisuudesta <strong>ja</strong>lainmukaisuudesta.Valtioneuvosto päätti 2. 12. 1999 [7], ettei <strong>satama</strong>hankkeenheikennystä voitu pitää merkittävänä tehtyjenarviointien <strong>ja</strong> niistä annettujen lausuntojenperusteella. Näin ollen hakemus hylättiin tarpeettomana.Edellä kuvatun menettelyn jälkeen Uudenmaanliitto päätyi siihen, ettei <strong>satama</strong>hankkeenaiheuttama heikennys Mustavuoren lehto- <strong>ja</strong> Östersundominlintuvedet Natura-alueeseen ole merkittävää.Näin ollen se hyväksyi seutukaavan, jokaalistettiin sen jälkeen ympäristöministeriölle vahvistettavaksi.Suomen luonnonsuojeluliitto ry, BirdLife Suomiry, WWF Suomi ry, kaksi kuolinpesää, VuosaariSeura r.y., muutama rekisteröimätön yhdistys sekä<strong>Helsingin</strong> luonnonsuojeluyhdistys ry. kuitenkinVUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö33


valittivat valtioneuvoston päätöksestä, jolla hakemusoli hylätty tarpeettomana. Valitusten perusteellaKHO antoi päätöksen 20. 12. 2000 [8], jotavoidaan pitää ainutlaatuisena Suomen oikeushistoriassa,koska se ei sisällä varsinaista pääasiaratkaisualainkaan. KHO ei toisin sanoen lainkaan hylännyttai hyväksynyt valituksia tai kumonnut taikka jättänytvoimaan valtioneuvoston päätöstä. Sen si<strong>ja</strong>anKHO selittää päätöksessään LSL:n poikkeuslupamenettelyn<strong>ja</strong> kaavoituksen välisiä soveltamissuhteita<strong>ja</strong> toimivallan <strong>ja</strong>koa eri viranomaisten kesken.Merkittävää KHO:n päätöksessä oli eri toimijoidentoimivallan ra<strong>ja</strong>nveto. KHO:n mukaan kaava-asiassaheikennyksen merkittävyyden arvioiminen kuuluukaavan hyväksyjälle, ei valtioneuvostolle. Näinollen valtioneuvostolla ei ole LSL 66 §:n mukaisessamenettelyssä toimivaltaa päättää siitä, onko heikennysmerkittävää tai ei, vaan sen tulee käsitellä silletehty hakemus, jos kaavan hyväksyjä tai vahvista<strong>ja</strong>on pitänyt heikennystä merkittävänä.4.5.4 Seutukaavan vahvistaminenympäristöministeriössäKHO lausui edellä poikkeuslupaa koskeneessa ainutlaatuisessapäätöksessään toimivallan lisäksi merkittävällätavalla myös valtioneuvoston ”virheellisen”päätöksen merkityksestä. KHO:n mukaan valtioneuvostoteki Uudenmaan liiton asiassa päätöksenkaavaehdotuksen no<strong>ja</strong>lla, joka sittemmin valtioneuvostonpäätöksen oltua edellä kuvatun sisältöinen,oli tullut hyväksytyksi Uudenmaan liiton toimesta.KHO lausui, ettei valtioneuvoston tuolloisella päätökselläollut sitovaa merkitystä harkittaessa sitä,kuinka YM:n tuli kaavaa vahvistaessaan harkita heikennyksenmerkittävyyttä tai kaavan laillisuutta ylipäätään.Tämän kohdan no<strong>ja</strong>lla ympäristöministeriökatsoikin, että sillä on itsenäinen toimivalta heikennyksenmerkittävyyden arvioimisessa, <strong>ja</strong> se vahvistikaavan pyytämättä uudestaan valtioneuvoston poikkeuslupaa[9].4.5.5 Seutukaava-asian käsittely KHO:ssaKHO päätti hylätä 26. 6. 2002 seutukaavasta tehdytvalitukset vuosikir<strong>ja</strong>ratkaisullaan 2002:48 [10]. SiinäKHO vahvisti, että <strong>satama</strong>hanke heikentää Naturaalueenluonnonarvo<strong>ja</strong>, mutta heikennys ei ole merkittävää.Näin ollen seutukaava oli voitu laillisestivahvistaa pyytämättä valtioneuvoston poikkeuslupaa.Kaava-asioita on tarkasteltu yksityiskohtaisemmintämän teoksen luvussa 5.Natura-juridiikan kannalta ratkaisussa oli olennaistaensinnäkin se, ettei KHO katsonut toiminnanharjoitta<strong>ja</strong>nteettämää arviointia lupaviranomaistatai kaavan hyväksyjää sitovaksi. Lupaviranomaisentulee itsenäisesti tehdä päätöksensä arviointimenettelynpoh<strong>ja</strong>lta <strong>ja</strong> sen on tarvittaessa hankittavalisäselvityksiä. Näin ollen toimivalta heikennyksenmerkittävyyden arvioimisessa on aina luvan hyväksyvällätai suunnitelman hyväksyvällä tai vahvistavallaviranomaisella, joka ei ole sidottu asiantuntijoidenarviointeihin eikä ympäristökeskuksenlausuntoon. Viimekädessä toimivalta on kuitenkinsillä tuomioistuimella, joka antaa asiassa lopullisenratkaisun valitettaessa luvasta tai suunnitelmastanormaalein muutoksenhakukeinoin.Toiseksi KHO tarkasteli koskemattomuudenkäsitettä. Valituksissa oli väitetty, että Suomen lainsäädännössä,jossa ainoastaan merkittävä haitta suojelunperustana oleville lajeille <strong>ja</strong> luontotyypeillelaukaisee poikkeusluvan tarpeen, rikotaan luontodirektiiviä,joka edellyttää poikkeuslupaa vaikutettaessaalueen koskemattomuuteen. Tältä osin KHOlausui, että koskemattomuus liittyy alueen suojelutavoitteisiin.Tällä KHO tarkoitti, ettei koskemattomuus-ilmaustavoida erottaa luontodirektiivin 6artiklan muista termeistä <strong>ja</strong> tarkoituksesta eikä sitätule tulkita kir<strong>ja</strong>imellisesti esimerkiksi fyysisenäkoskemattomuutena (jolloin mikä tahansa puuttuminen,kuten maan kaivaminen laukaisisi poikkeusluvantarpeen).Kolmanneksi KHO edellytti Natura-alueilla tehtävänsuojelun perustana olevien lajien elinympäristöjäkoskevan kokonaisarvion. Näin ollen esimerkiksilintukantojen vuotuisilla vaihteluilla ei ollutmerkitystä arvioitaessa esimerkiksi lintulajien esiintymistäjollain alueella. KHO korosti arvioinnissavaikutuksia elinympäristöjen ominaispiirteisiin.4.5.6 Johtopäätös Natura 2000 -alueenmerkityksestä <strong>Vuosaaren</strong> <strong>satama</strong>hankkeessaNatura 2000 -alueen sijoittuminen välittömästi <strong>Vuosaaren</strong><strong>satama</strong>n naapuriin aiheutti edellä kuvatuthallinnolliset <strong>ja</strong> oikeudelliset prosessit <strong>ja</strong> vaikuttilähinnä alueen kaavoituksen etenemiseen. Näidenprosessien johdosta <strong>satama</strong>hankkeen voidaansanoa viivästyneen noin kahdella tai kolmella vuodella.Viivästys ei ollut tosin yksinomaan Naturastajohtuvaa, vaan se oli seurausta yleisemmin uudenympäristölainsäädännön soveltamisen vakiintumattomuudesta.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeessa sovellettiinuseita uusia ympäristölainsäädännön lake<strong>ja</strong>ensimmäisenä suurhankkeena. Missään vaiheessa<strong>satama</strong>hankkeen toteutuminen ei kuitenkaan ollutvakavasti uhattuna Naturan takia, vaikka menettely-34VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


tavat olivat vielä tuolloin Suomessa vakiintumattomia,mistä aiheutui hankkeessa ylimääräistä harmia<strong>ja</strong> hankkeen viivästymistä.Omat kiemuransa aiheutti myös asian käsittelyEU:n toimielimissä, erityisesti EU:n komissiossa<strong>ja</strong> EU:n parlamentin vetoomusvaliokunnassa. <strong>Vuosaaren</strong><strong>satama</strong>hankkeesta tehtiin ensin kantelu EU:nkomissiolle <strong>ja</strong> sitten vielä samansisältöinen vetoomusparlamentin vetoomusvaliokunnalle. Vetoomusvaliokuntalähetti kolmijäsenisen tutkimusryhmänselvittämään asiaa paikan päälle. Komissio ilmoitti20. 7. 2004 lopettaneensa <strong>Vuosaaren</strong> <strong>satama</strong>sta tehtyjenkantelujen käsittelyn. Vetoomus ei ole ainakaantiettävästi johtanut mihinkään toimenpiteisiin<strong>satama</strong>hankkeen johdosta, mutta tarkempaa tietoavetoomuksen käsittelyn lopettamisesta ei ole tämänkirjoitta<strong>ja</strong>n tiedossa.Oikeudellisesta näkökulmasta <strong>Vuosaaren</strong> <strong>satama</strong>hankeoli tiennäyttäjä. Siinä sovellettiin ensimmäisenkerran useita nykyisin jo vakiintuneesti sovellettavialuonnonsuojelulain säännöksiä. Samalla tavalla siinäoli vuosina 1994 – 1996 sovellettu myös ympäristövaikutustenarviointimenettelyä koskevia säännöksiäensimmäisenä hankkeena Suomessa. Toisaalta voidaanhyvin väittää, että Natura-oikeusprosesseissaomaksuttu tinkimätön ympäristön huomioonottaminenvaikutti varmasti koko <strong>satama</strong>n rakennusvaiheeseen.Eri lupaprosesseissa, erityisesti aiemmantelakkatoiminnan aiheuttaman merenpoh<strong>ja</strong>n pilaantumisenpuhdistamisessa suunniteltiin <strong>ja</strong> toteutettiinSuomessa ainutlaatuisen suurimittainen <strong>ja</strong> vaikeaympäristön kunnostushanke nivoen se vielä saumattomastiyhteen <strong>satama</strong>n rakentamisen kanssa. Tässäkintyössä oli koko a<strong>ja</strong>n lähtökohtana halu minimoidahaitalliset ympäristövaikutukset.Lopuksi voidaan sanoa, että <strong>Vuosaaren</strong> <strong>satama</strong>hankeoli myös hyvä esimerkki ympäristölainsäädännössämmelaajennettujen valitusmahdollisuuksienkäytännön merkityksestä suurissa rakennushankkeissa.<strong>Vuosaaren</strong> <strong>satama</strong>hanke koki voimakastavastustusta lähisaarten kesämökkiläisten <strong>ja</strong> muutamanvarakkaan maanomista<strong>ja</strong>n taholta. Myös ympäristöjärjestötvastustivat melko pitkään hanketta,osin myös sen ympäristöä hyödyttäviä osaprosesse<strong>ja</strong>,mikä on kummallista. Vaikka hankkeen Naturavaikutustenei-merkittävyys <strong>ja</strong> Naturan merkitys ylipäätäänoli tullut lainvoimaisesti ratkaistuksi edelläkuvatussa seutukaavaa koskevassa KHO:n päätöksessä,ei tämä estänyt valittajia <strong>ja</strong> hankkeen vastustajialiittämästä joka valitukseen perusteluita, joillaväitettiin jonkin luvanvaraisen hankkeen osan heikentävänmerkittävästi Natura-luonnonarvo<strong>ja</strong>. Näinollen KHO joutui lukuisissa päätöksissään lausumaansiitä, mikä merkitys Naturalla oli kuhunkinhankkeen osan lupaan <strong>ja</strong> sen laillisuuteen. Toisaaltaviranomaisten, erityisesti Länsi-Suomen ympäristölupavirastonkäytännönläheinen <strong>ja</strong> rationaalinentoiminta erityisesti TBT-ruoppausten yhteydessä olihankkeen etenemisen kannalta erittäin olennaista.Tärkeässä roolissa olivat tuolloin lupiin sisällytetyttöidenaloittamisoikeudet.L ä h t e e t:1. Komission päätös 2005/101/EY, neuvoston direktiivin92/43/ETY mukaisesta luettelosta boreaalisen vyöhykkeenluonnonmaantieteellisellä alueella olevista yhteisöntärkeinä pitämistä alueista, EUVL L 40, 11. 2. 2005, s. 1.2. Komission päätös 2008/24/EY, neuvoston direktiivin92/43/ETY mukaisen, boreaalisen vyöhykkeen luonnonmaantieteelliselläalueella olevista yhteisön tärkeinä pitämistäalueista tehdyn luettelon ensimmäisestä päivityksestä.3. Ympäristöministeriön lausunnot valtioneuvoston 20päivänä elokuuta 1998 tekemästä Euroopan yhteisönNatura 2000 -verkoston Suomen ehdotuksen hyväksymisestäkoskevasta päätöksestä tehdystä valituksesta(2 kpl), Dnrot 22,23,24 <strong>ja</strong> 29/5713/98, 6/500/98, 3/501/96sekä Dnrot 28/5713/98, 6/500/98, 3/501/96.4. Korkeimman hallinto-oikeuden päätös 14. 6. 2000 t. 13675. Mustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet, <strong>Vuosaaren</strong><strong>satama</strong>hankkeen vaikutukset Natura 2000 -alueeseen,15. 4. 1998, Sami Kurki <strong>ja</strong> Sakari Mykrä, Biota BD Oy.6. Luonnonsuojelulain 65 §:n mukainen lausunto; <strong>Helsingin</strong>kaupungin <strong>Vuosaaren</strong> <strong>satama</strong>hanke 19. 3.1999, Dnro0198L0671-2557. Valtioneuvoston päätös 2.12. 1999 koskien poikkeustaNatura 2000 -kohteen heikentämiskiellosta, n:o104/19998. Korkeimman hallinto-oikeuden päätös 20. 12. 2000 t. 3307.9. Ympäristöministeriön päätös 24. 1. 2002 n:o 10/5221/99,109 –113/591/2000 seutukaavan vahvistamisesta.10. Korkeimman hallinto-oikeuden päätös 26. 6. 2002 t. 1607(2002:48).VUOSAAREN SATAMAHANKE JA NATURA 2000<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö35


5<strong>Satama</strong>n suunnitteluunliittyneet kaavat5.1 Maankäytön suunnittelu <strong>satama</strong>hankkeen perustana<strong>Vuosaaren</strong> <strong>satama</strong>hanke on laa<strong>ja</strong> kokonaisuus, jonkasuunnittelu on liittynyt kiinteästi alueen kaavoitukseen.Lainvoimaiset kaavat ovat olleet välttämätönedellytys aluetta käsittävien yksityiskohtaisten suunnitelmienhyväksymiselle.Kaavoitus on ollut monivaiheinen prosessi, jokaon edennyt vuorovaikutteisesti liittyen hankkeenympäristövaikutusten arviointimenettelyyn, Naturaarviointiin<strong>ja</strong> yksityiskohtaisten suunnitelmien laadintaan.<strong>Satama</strong>n suunnitteluun kiinteästi liittyneitä kaavo<strong>ja</strong>ovat olleet:• <strong>Helsingin</strong> seudun seutukaava, taa<strong>ja</strong>ma-alueet,liikenneväylät <strong>ja</strong> -alueet.• <strong>Helsingin</strong> Yleiskaava 1992.• <strong>Helsingin</strong> seudun seutukaava <strong>ja</strong> sen muutos,<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> sen liikenneyhteydet.• <strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö, asemakaava<strong>ja</strong> asemakaavan muutos.• Kaakkois-Vantaan osayleiskaava.Aluetta käsittelevissä seutukaavoissa on ratkaistuuuden <strong>satama</strong>n si<strong>ja</strong>inti, <strong>satama</strong>-alueen yleispiirteinenmaankäyttö <strong>ja</strong> uuden <strong>satama</strong>n aiheuttamatmuutokset koko <strong>Helsingin</strong> seudun alueella. <strong>Satama</strong>ntoteuttamisen kannalta keskeisin kaava on ollut<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksiä käsittänytseutukaava. Tässä yhteydessä ovat määräytyneetmyös hankkeen merkittävimmät vaikutukset.<strong>Helsingin</strong> <strong>ja</strong> Vantaan yleiskaavat on laadittu poh<strong>ja</strong>utuenseutukaavassa esitettyihin ratkaisuihin. Ne tarkentavatosaltaan myös <strong>satama</strong>an liittyviä järjestelyjä<strong>Satama</strong>n asemakaavassa on seutukaavo<strong>ja</strong> <strong>ja</strong> yleiskaavo<strong>ja</strong>tarkemmin ratkaistu <strong>satama</strong>-alueen sisäinenrakenne <strong>ja</strong> sen liittyminen ympäröivään maankäyttöön<strong>ja</strong> vaikutukset lähiympäristöön.Alueelle on tehty myöhemmin asemakaavanmuutoksia <strong>satama</strong>n <strong>ja</strong> sitä ympäröivän yritysalueentarkentuneiden suunnitelmien <strong>ja</strong> toiminnallistentavoitteiden mukaisesti. Tätä asiaa on tarkemminkäsitelty luvussa 11.Nyt alueella voimassa olevat myöhemmin laaditutUudenmaan maakuntakaava <strong>ja</strong> <strong>Helsingin</strong> Yleiskaava2002 noudattavat <strong>Vuosaaren</strong> <strong>satama</strong>n osaltaaiemmin laadittu<strong>ja</strong> kaavo<strong>ja</strong>. Vantaan kaupunginvaltuustossa17. 12. 2007 hyväksytty Vantaan yleiskaava2007 noudattaa maankäyttöratkaisultaan alueella nytvoimassa olevaa Kaakkois-Vantaan osayleiskaavaa.5.2 Taa<strong>ja</strong>maseutukaava5.2.1 Kaavan sisältöTaa<strong>ja</strong>ma-alueet, liikenneväylät <strong>ja</strong> -alueet käsittävässäseutukaavassa eli taa<strong>ja</strong>maseutukaavassa määriteltiin<strong>Helsingin</strong> seudun kehitys vuoteen 2030 asti. Siinäosoitettiin kehitettävät taa<strong>ja</strong>ma-alueet <strong>ja</strong> seudullinenyhteysverkko. Kaavalla pyrittiin eheyttämään seudunaluerakennetta. Seutukaava täydensi aikaisemminvahvistettu<strong>ja</strong> seutukaavo<strong>ja</strong> [6].Seutukaavassa osoitettiin <strong>Vuosaaren</strong> <strong>satama</strong>naluevarauksen yhteyteen varaus <strong>satama</strong>an liittyvälletyöpaikka-alueelle <strong>ja</strong> energiahuollon alueelle sekäPorvarinlahden suojelualueelle. <strong>Satama</strong>n tarvitsematmaaliikenneyhteydet on esitetty kaavan laatimisvaiheenaikana käytössä olleiden alustavien suunnitelmienmukaisesti. Tieyhteys kulkee <strong>satama</strong>an KehäIII:n <strong>ja</strong>tkeelta. <strong>Satama</strong>n ratayhteyden katkoviivamerkintäHelsingistä itään suuntautuvalta radalta osoittaakaavassa alustavan <strong>satama</strong>radan lin<strong>ja</strong>uksen.Tavaraliikennettä palvelevat vanhat <strong>satama</strong>-alueetJätkäsaaressa <strong>ja</strong> Sompasaaressa osoitettiin kaavassataa<strong>ja</strong>matoimintojen alueeksi.5.2.2 Kaavan käsittelyTaa<strong>ja</strong>maseutukaavan laadinnan voidaan katsoa alkaneenvuonna 1988. Tällöin seutukaavaliiton liittovaltuustohyväksyi seutusuunnitelman, jossa käsiteltiinseudun kehittämistavoitteita <strong>ja</strong> seudullista taa<strong>ja</strong>marakennetta.Kaava hyväksyttiin <strong>Helsingin</strong> seutukaavaliitonliittovaltuustossa 15. 12. 1992.Seutukaava vahvistettiin ympäristöministeriössä18. 6. 1996 [16]. Tällöin oli jo käytettävissä vuo-36SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Taulukko 5.1Taa<strong>ja</strong>maseutukaavaanliittyneitä käsittelyjäden 1994 lopussa käynnistyneen <strong>satama</strong>hankkeenympäristövaikutusten arviointimenettelyn tulokset.Ministeriö vahvisti kaavassa osoitetun <strong>Vuosaaren</strong><strong>satama</strong>-alueen sekä Sompasaaren <strong>ja</strong> Jätkäsaaren<strong>satama</strong>-alueiden muuttumisen taa<strong>ja</strong>matoimintojenalueeksi. Ministeriö jätti kuitenkin <strong>satama</strong>an johtavatmaaliikenneyhteydet vahvistamatta. Päätöstäänministeriö perusteli sillä, että kaavan maaliikenneyhteyksienmerkintä mahdollisti liikenneväylien22. 12. 198813. 08. 199009. 03. 199219. 08. 199215. 12. 199222. 11. 199413. 03. 199618. 06. 199608. 07. 1997Seutukaavaliiton liittovaltuusto hyväksyiseutusuunnitelman, jossa on käsiteltyseudun kehittämistavoitteita <strong>ja</strong> seudullistataa<strong>ja</strong>marakennetta.Kaavaluonnos nähtäville rakennusasetuksen154 §:n mukaisesti.Kaavaehdotus nähtäville rakennusasetuksen21 §:n mukaisesti.Kaavaehdotus nähtäville uudelleenrakennusasetuksen 21 §:n mukaisesti.Seutukaavaliiton liittovaltuusto hyväksyikaavan.<strong>Satama</strong>hankkeen ympäristövaikutustenarviointimenettely vireille.Arviointimenettely päättyi, kun Uudenmaanympäristökeskus antoi yhteysviranomaisenalausunnon hankkeenarviointiselostuksesta.Ympäristöministeriö vahvisti <strong>Vuosaaren</strong><strong>satama</strong>n aluevaraukset <strong>ja</strong> jätti vahvistamatta<strong>satama</strong>n liikenneyhteyksiä koskevataluevaraukset. Päätöksen ratkaisiministeri Haavisto.Korkein hallinto-oikeus palautti seutukaavan<strong>Vuosaaren</strong> <strong>satama</strong>n aluevarauksen<strong>ja</strong> liikenneyhteyksien osalta Uudenmaanliitolle uudelleen valmistelua varten.rakentamisen maan pinnassa ympäristöltään arvokkaidenalueiden poikki. Ministeriön päätöksenmukaan väylillä tulisi käyttää tunneliratkaisu<strong>ja</strong>.Ministeriön vahvistuspäätöksestä tehtiin useitavalituksia korkeimpaan hallinto-oikeuteen. <strong>Satama</strong>naluevarausta vastustettiin kolmessa valituksessa.Korkein hallinto-oikeus kumosi ministeriön<strong>satama</strong>-aluetta koskevan vahvistuspäätöksen<strong>ja</strong> palautti asian Uudenmaan liiton maakuntahallitukselleuudelleen käsiteltäväksi [8]. Korkein hallinto-oikeusperusteli päätöstään sillä, että <strong>satama</strong><strong>ja</strong> <strong>satama</strong>an johtavat liikenneyhteydet muodostavattoiminnallisen kokonaisuuden. Ratkaisussa, jossaon jätetty maaliikenneyhteydet vahvistamatta muttavahvistettu liikennealue, ei ole otettu huomioon<strong>satama</strong>n luonnetta toiminnallisena kokonaisuutena.Ministeriöllä ei ole ollut tällaisen kohteen osittaiseenvahvistamiseen <strong>ja</strong> osittain vahvistamatta jättämiseentoimivaltaa eikä perusteita. Mikäli ministeriöon päätöksellään tarkoittanut tehdä mahdolliseksi<strong>satama</strong>n maaliikenneyhteydet tunnelissa <strong>ja</strong> antanutniitä koskevia ohjeita, päätös oli korkeimman hallinto-oikeudenmielestä myös sisällöltään epäselvä.Korkein hallinto-oikeus totesi myös, että ministeriön<strong>ja</strong> korkeimman hallinto-oikeuden käytössä on ollutsellaista kaavan toteuttamiskelpoisuuden arvosteluunvaikuttavaa selvitystä, joka ei ollut liittovaltuustonkäytössä sen ratkaistessa asiaa.Lisäksi kaavaratkaisun kannalta keskeiset Natura2000 -alueita koskevat selvitykset olivat korkeimmanhallinto-oikeuden tehdessä päätöstään vieläkeskeneräisiä.5.3 <strong>Helsingin</strong> Yleiskaava 19925.3.1 Kaavan sisältöPääkaupunkiseudun 1980-luvun nopea kasvu aiheuttiongelmia, joiden ratkaisemiseksi valtioneuvostoteki 21. 6. 1989 periaatepäätöksen pääkaupunkiseudunkuntien määräämisestä aluepolitiikkalainmukaiseksi toimenpidealueeksi vuosiksi 1990 –1991.Päätökseen liittyi toimenpideohjelma sekä seudunkaupunginjohtajien 12. 9. 1989 allekirjoittama aiesopimus.Aiesopimuksessa sovittiin muun muassasiitä, että pääkaupunkiseudun kunnat laativat uudetyleiskaavat vuoteen 1992 mennessä.<strong>Helsingin</strong> Yleiskaava 1992:n keskeisenä lähtökohtanaoli aiesopimuksen mukaisesti uusien rakentamisalueidenosoittaminen asuntotuotantoa varten[4]. Yleiskaavaratkaisu perustui ensisi<strong>ja</strong>ssa jo rakennetunkaupunkirakenteen hyväksikäyttöön. Uudetrakentamisalueet on sijoitettu siten, että ne ovattehokkaan joukkoliikenteen yhteydessä lähellä työpaikka-alueita.Kaava käsittää koko <strong>Helsingin</strong> kaupunginalueen.Tavara<strong>satama</strong>toimintojen keskittäminen Vuosaareenon Yleiskaava 1992:n <strong>ja</strong> samaan aikaan laadituntaa<strong>ja</strong>maseutukaavan tärkeimpiä kaupunkirakenteellisiaratkaisu<strong>ja</strong>. Samalla kun ratkaisu parantaa <strong>satama</strong>ntoimintaedellytyksiä <strong>ja</strong> liikennetaloutta, se avaamerkittäviä maankäytön kehittämismahdollisuuksia<strong>Helsingin</strong> kantakaupungissa <strong>ja</strong> vähentää <strong>satama</strong>naiheuttamia ympäristöhaitto<strong>ja</strong>.Yleiskaavassa osoitettiin <strong>Vuosaaren</strong> <strong>satama</strong>-alue<strong>ja</strong> sen länsipuolelle siihen välittömästi liittyvä tuotanto-<strong>ja</strong> varastotoimintojen alue sekä hallinnon <strong>ja</strong>38SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 5.2Ote <strong>Helsingin</strong>Yleiskaavasta 1992.SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö39


Taulukko 5.2<strong>Helsingin</strong> yleiskaavaan1992 liittyneitä käsittelyjä.julkisten palvelujen alue. Tämän työpaikka-alueenpohjoispuolelle osoitettiin yhdyskuntahuollon aluenykyiselle voimalaitosalueelle <strong>ja</strong> sen laajennustarpeille.<strong>Satama</strong>n aluevarauksiin liittyvät luonnonalueetosoitettiin virkistys- <strong>ja</strong> luonnonsuojelualueiksi.<strong>Vuosaaren</strong>lahden pohjukka oli yleiskaavan selostuksenmukaan tarkoitus varata vene<strong>satama</strong>-alueeksi.Jätkäsaaren <strong>ja</strong> Sompasaaren tavaraliikenne<strong>satama</strong>ton kaavassa osoitettu merkinnällä, jonkamukaan ne muutetaan asuntoalueeksi, jos <strong>satama</strong>toiminnotsiirtyvät alueelta pois.21. 05. 199021. 01. 199124. 08. 199209. 12. 199201. 10. 1996<strong>Helsingin</strong> kaupunginhallitus päättiYleiskaava 1992:n lähtökohdista.Kaavaluonnos nähtäville rakennusasetuksen154 §:n mukaisesti.Ehdotus nähtäville rakennusasetuksen29 §:n mukaisesti.Yleiskaava hyväksyttiin kaupunginvaltuustossa.Ympäristöministeriö kumosi kaavan <strong>Vuosaaren</strong><strong>satama</strong>n liikenneyhteyksien osalta.5.3.2 Kaavan käsittely<strong>Helsingin</strong> kaupunginvaltuusto hyväksyi yleiskaavan9. 12. 1992.Ympäristöministeriö hyväksyi 1. 10. 1996 seutukaavapäätöksenkanssa yhdenmukaisesti yleiskaavaakoskevat valitukset niiltä osin kuin ne koskivat <strong>satama</strong>ntie- <strong>ja</strong> ratayhteyksiä [17]. Liikenneyhteyksienosalta päätöksessä todetaan, että ne voidaan toteuttaaesimerkiksi tunneliratkaisuina. <strong>Satama</strong>varaustapidettiin päätöksessä tarkoituksenmukaisena <strong>ja</strong>luontosuhteet huomioivana.<strong>Satama</strong>-alueen varaus Vuosaaressa sekä vaihtoehtoisetasuntoalueiden merkinnät Jätkäsaaressa <strong>ja</strong>Sompasaaressa jäivät siten yleiskaavaan.<strong>Helsingin</strong> Yleiskaava 1992:ta ei ole vahvistettu.Sillä ei siten ole ollut rakennuslain mukaista oikeudellisestiasemakaavoitusta oh<strong>ja</strong>avaa vaikutusta.Yleiskaavan yhteydessä tehdyt selvitykset <strong>ja</strong> siinätehdyt suunnitteluratkaisut ovat kuitenkin toimineetperusteluna myöhemmin asemakaavoitetun <strong>satama</strong>alueenlaajuudelle <strong>ja</strong> kaavaratkaisuille.5.4 <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskeva seutukaava5.4.1 Kaavan sisältö<strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä käsittäväseutukaava <strong>ja</strong> seutukaavan muutos [12] täydentävätaikaisemmin vahvistettu<strong>ja</strong> seutukaavo<strong>ja</strong>, erityisestivuonna 1996 vahvistettua taa<strong>ja</strong>ma-alueitasekä liikenneväyliä <strong>ja</strong> -alueita koskevaa seutukaavaa.Kaava tukee aikaisemmissa seutukaavoissa esitettyjäperiaatteita seudun aluerakenteen <strong>ja</strong> liikennejärjestelmänhallituksi kehittämiseksi.Seutukaavan tavoitteena on turvata kappaletavaran<strong>satama</strong>toimintojen säilyttämis- <strong>ja</strong> lisäämismahdollisuudet<strong>Helsingin</strong> seudulla. Tavaratoiminnot keskitetäänkaavan mukaan Vuosaareen rakennettavaanuuteen <strong>satama</strong>an.Seutukaava sisältää vain <strong>satama</strong>n <strong>ja</strong> sinne johtavienmaaliikenneväylien aluevaraukset. Seutukaavaosoittaa entisen telakka-alueen sekä vesialueen, jolleaikaisemmin ei ole vahvistettu mitään käyttötarkoitusta,<strong>satama</strong>n liikennealueeksi. Seutukaavan muutoksellaon muutettu I seutukaavassa vahvistetutKäärmeniemen kärjen virkistys- <strong>ja</strong> suojelualue sekäLehdessaaren virkistys- <strong>ja</strong> vesialue liikennealueeksi.Taa<strong>ja</strong>maseutukaavassa vahvistettu teollisuusaluesupistui jonkin verran alueen itäosan muuttuessaliikennealueeksi. Maaliikenneyhteydet kulkevat I <strong>ja</strong>II seutukaavoissa vahvistettujen virkistys- <strong>ja</strong> suojelualueidenpoikki.Kaavassa on ympäristöhaitto<strong>ja</strong> pyritty vähentämäänseuraavasti:• Kaavan liikennejärjestelyjen lähtökohdaksi onvalittu ympäristön kannalta vähiten haitallinenPorvarinlahden lin<strong>ja</strong>usvaihtoehto.• <strong>Satama</strong>tie alittaa Natura-alueen tunnelissa.• <strong>Satama</strong>rata ylittää Porvarinlahden sillalla <strong>ja</strong> kulkeemuilta osin Natura-alueella Labbackan mäenalittavassa tunnelissa.Seutukaava on laadittu <strong>ja</strong> valmisteltu samanaikaisesti<strong>Vuosaaren</strong> <strong>satama</strong>a koskevan asemakaavankanssa. Tämän lisäksi <strong>satama</strong>hankkeesta <strong>ja</strong> senliikenneyhteyksistä on laadittu alustavat tie- <strong>ja</strong> ratasuunnitelmat.Näistä syistä johtuen seutukaavanaluevarausten vaikutukset on voitu tutkia tavanomaistaseutukaavan käsittelytarkkuutta yksityiskohtaisemmallatavalla.5.4.2 Rakennuslain edellytykset kaavanhyväksymiselleKaavan laatiminen aloitettiin korkeimman hallintooikeudenpalautettua taa<strong>ja</strong>maseutukaavan 8. 7. 1997<strong>Vuosaaren</strong> <strong>satama</strong>n aluevarauksen <strong>ja</strong> liikenneyhteyksienosalta Uudenmaan liitolle uudelleen valmisteluavarten.40SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 5.3<strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong>sen liikenneyhteyksiäkoskeva seutukaava.Uudenmaan liitto hyväksyi seutukaavan 28. 12.1999. Vuoden 2000 alussa voimaan tulleen maankäyttö-<strong>ja</strong> rakennuslain (132/199) 208 §:n siirtymäsäännöksenmukaisesti kaavan lainmukaisuuttaratkaistaessa on siten noudatettu aikaisemmanrakennuslain (370/1958) säännöksiä.Rakennuslain mukaan kaavaa laadittaessa on selvitettäväsuunnitelman toteuttamisen vaikutukset <strong>ja</strong>varattava vastaisen kehityksen edellyttämät riittävätalueet eri tarkoituksia varten. Kaavaa laadittaessa onlisäksi kiinnitettävä huomioita muun muassa seudunoloista johtuviin erityisiin tarpeisiin <strong>ja</strong> pidettävä silmällämaankäytön taloudellisuutta <strong>ja</strong> sitä, ettei kaavantoteuttamisesta aiheudu maanomistajille kohtuutontahaittaa.Rakennuslaki 3 § (469/1994)Kaavaa laadittaessa on tarpeellisessa määrin selvitettävä suunnitelman toteuttamisenympäristövaikutukset sekä yhdyskuntataloudelliset, sosiaaliset, kulttuuri<strong>ja</strong>muut vaikutukset. Kaavaan voidaan ottaa haitallisten tai häiriötä aiheuttavienympäristövaikutusten estämiseksi tai rajoittamiseksi tarpeellisia määräyksiä.Kaavaehdotusta valmisteltaessa kaavaan voidaan sisällyttää erityinen selvitysympäristövaikutuksista, jos suunnitellulla maankäytöllä on todennäköisestimerkittäviä vaikutuksia.Rakennuslaki 22 §, 2 momentti (1097/1996)Seutukaava on laadittava niin, että varataan vastaisen kehityksen edellyttämätriittävät alueet eri tarkoituksia varten. Kaavaa laadittaessa on kiinnitettävä huomiotaseudun oloista johtuviin erityisiin tarpeisiin. Kaava on mahdollisuuksienmukaan sopeutettava seutukaava-alueeseen rajoittuvien alueiden seutukaavoitukseensekä valtakunnansuunnitteluun. Luonnonsuojelulain 7 <strong>ja</strong> 77 §:ssä tarkoitettujenluonnonsuojeluohjelmien <strong>ja</strong> -päätösten sekä 32 §:ssä tarkoitettuamaisema-aluetta koskevien perustamispäätösten tulee olla ohjeena kaavaa laadittaessa.Kaavalla on myös edistettävä luonnonsuojelun kannalta arvokkaidenluontotyyppien sekä luonnonvaraiselle eläimistölle <strong>ja</strong> kasvistolle tärkeidenluonnon ominaispiirteiden säilymistä. Kaavaa laadittaessa on pidettävä silmällämaankäytön taloudellisuutta <strong>ja</strong> sitä, ettei kaavan toteuttamisesta aiheudu maanomistajillekohtuutonta haittaa.5.4.3 Luonnonsuojelulain edellytykset kaavanhyväksymiselleRakennuslaissa kaavoille asetettujen oikeudellistensisältövaatimusten ohella tulee ottaa huomioon myösNatura 2000 -verkostoa koskevat luonnonsuojelulainsäännökset.SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö41


Kaavaa hyväksyttäessä <strong>ja</strong> vahvistettaessa onoltava selvillä kaavan vaikutuksista Natura 2000-verkostoon. Kaavan toteuttaminen ei saa merkittävästiheikentää niitä luonnonarvo<strong>ja</strong>, joiden suojelemiseksialue on sisällytetty Natura 2000 -verkostoon.Kaavaa ei voida hyväksyä eikä vahvistaa,jos luonnonsuojelulain mukainen arviointi- <strong>ja</strong> lausuntomenettelyosoittaa kaavan heikentävän edellämainittu<strong>ja</strong> luonnonarvo<strong>ja</strong>. Kaava voidaan kuitenkinhyväksyä <strong>ja</strong> vahvistaa, jos valtioneuvosto yleisistunnossaanpäättää, että kaava on toteutettava erittäinLuonnonsuojelulaki 65 §, 1 <strong>ja</strong> 2 momentit (371/1999)Hankkeiden <strong>ja</strong> suunnitelmien arviointiJos hanke tai suunnitelma joko yksistään tai tarkasteltuna yhdessä muiden hankkeiden<strong>ja</strong> suunnitelmien kanssa todennäköisesti merkittävästi heikentää valtioneuvostonNatura 2000 -verkostoon ehdottaman tai verkostoon sisällytetyn alueenniitä luonnonarvo<strong>ja</strong>, joiden suojelemiseksi alue on sisällytetty tai tarkoitussisällyttää Natura 2000 -verkostoon, hankkeen toteutta<strong>ja</strong>n tai suunnitelman laati<strong>ja</strong>non, jollei hankkeeseen ole sovellettava ympäristövaikutusten arviointimenettelystäannetun lain (468/1994) 2 luvussa tarkoitettua arviointimenettelyä, asianmukaisellatavalla arvioitava nämä vaikutukset. Sama koskee sellaista hankettatai suunnitelmaa alueen ulkopuolella, jolla todennäköisesti on alueelle ulottuviamerkittäviä haitallisia vaikutuksia.Luvan myöntävän tai suunnitelman hyväksyvän viranomaisen on katsottava,että 1 momentissa tarkoitettu arviointi on tehty. Viranomaisen on sen jälkeenpyydettävä siitä lausunto alueelliselta ympäristökeskukselta <strong>ja</strong> siltä, jonka hallinnassaluonnonsuojelualue on. Jos ympäristökeskus itse on hankkeen toteutta<strong>ja</strong>,lausunnon antaa sen si<strong>ja</strong>sta ympäristöministeriö. Lausunto on annettava viivytyksettä<strong>ja</strong> viimeistään kuuden kuukauden kuluessa.Luonnonsuojelulaki 66 § (371/1999)Luvan myöntäminen sekä suunnitelman hyväksyminen <strong>ja</strong> vahvistaminenViranomainen ei saa myöntää lupaa hankkeen toteuttamiseen taikka hyväksyätai vahvistaa suunnitelmaa, jos 65 §:n 1 <strong>ja</strong> 2 momentissa tarkoitettu arviointi- <strong>ja</strong>lausuntomenettely osoittaa hankkeen tai suunnitelman merkittävästi heikentävänniitä luonnonarvo<strong>ja</strong>, joiden suojelemiseksi alue on sisällytetty tai on tarkoitussisällyttää Natura 2000 -verkostoon.Sen estämättä mitä 1 momentissa säädetään, saadaan lupa kuitenkin myöntäätaikka suunnitelma hyväksyä tai vahvistaa, jos valtioneuvosto yleisistunnossapäättää, että hanke on toteutettava pakottavasta syystä eikä vaihtoehtoista ratkaisuaole.Jos alueella on luontodirektiivin liitteessä I tarkoitettu ensisi<strong>ja</strong>isesti suojeltavaluontotyyppi tai liitteessä II tarkoitettu ensisi<strong>ja</strong>isesti suojeltava laji, on lisäksiedellytyksenä, että ihmisten terveyteen, yleiseen turvallisuuteen tai ympäristöllemuualla koituviin erittäin merkittäviin suotuisiin vaikutuksiin liittyvä syy taikkamuu erittäin tärkeän yleisen edun kannalta pakottava syy vaatii luvan myöntämistätaikka suunnitelman hyväksymistä tai vahvistamista. Viimeksi mainitussatapauksessa asiasta on hankittava komission lausunto.tärkeän yleisen edun kannalta pakottavasta syystäeikä vaihtoehtoista ratkaisua ole.5.4.4 Uudenmaan liiton hakemusluonnonsuojelulain heikentämiskiellostaUudenmaan liitto pyysi 26. 4. 1999 päivätyllä hakemuksellavaltioneuvostolta lupaa poiketa luonnonsuojelulain66 §:n mukaisesta luonnonarvojenheikentämiskiellosta <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiäkoskevan seutukaavan hyväksymisenmahdollistamiseksi. Uudenmaan liitto totesi kuitenkinhakemuksessaan, että ympäristökeskuksenarvioita merkittävästä heikentymisestä lintudirektiivinliitteen I lajien kannalta ei voida pitää täysinkiistattomana <strong>ja</strong> loogisena johtopäätöksenä tehdyistätutkimuksista. Asiaa käsitellään myös luvussa 4.Ympäristöministeriö katsoi, ettei laadittujen selvitysten<strong>ja</strong> lausuntojen poh<strong>ja</strong>lta voitu ratkaista, heikentyvätkökohteen luonnonarvot luonnonsuojelulain66 §:n 1 momentissa tarkoitetuin tavoin. Sen vuoksiympäristöminiteriö pyysi <strong>satama</strong>hankkeen luonnonsuojelulainmukaisesta arvioinnista lausunnot vieläkolmelta asiantunti<strong>ja</strong>lta. Saadut lausunnot ovat osinristiriitaisia. Lasse J. Laineen lausunnossa päädytäänkantaan, jonka mukaan Natura-alueen luonnonarvoteivät heikenny merkittävällä tavalla. Markku Mikkola-Roos<strong>ja</strong> Heikki Hirvonen katsoivat, että merkittävääluonnonarvojen heikentymistä syntyisi.Valtioneuvosto päätti yleisistunnossaan 2. 12. 1999asiaa esitelleen ministeri Hassin kannasta poiketen,että <strong>Vuosaaren</strong> <strong>satama</strong>n seutukaavaehdotusta koskevaarviointi- <strong>ja</strong> lausuntomenettely osoittaa, että ehdotusei merkittävästi heikennä niitä luonnonarvo<strong>ja</strong>, joidensuojelemiseksi Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet (FI0100065) -niminen alue on valtioneuvostonpäätöksen 20. 8. 1998 mukaisesti ehdotettusisällytettäväksi Natura 2000 -verkostoon [14].Valtioneuvosto päätti lisäksi, että Uudenmaan liitonhakemus luonnonsuojelulain 66 §:n mukaisenvaltioneuvoston päätöksen tekemisestä hylätään tarpeettomana.Valtioneuvosto päätti samalla palauttaahakemuksen asiakirjoineen Uudenmaan liitolle.Lisäksi valtioneuvosto totesi pitävänsä tärkeänä,että aluetta koskevien hankkeiden arvioinnissa otetaanvastedes huomioon luonnonsuojelulain 65 §:nmukaisesti <strong>satama</strong>hankkeen alueelle aiheuttamatvaikutukset <strong>ja</strong>, että <strong>satama</strong>hankkeen vaikutusten riittäväseuranta <strong>ja</strong> luonnolle kohdistuvien haittojen lieventäminensisällytetään <strong>satama</strong>hankkeen yksityiskohtaiseensuunnitteluun.Korkein hallinto-oikeus antoi päätöksellään20. 12. 2000 [9] ratkaisun valtioneuvoston 21. 12. 199942SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kaavan laatimiseen liittyen on selvitettävä, heikentääkö kaavan toteuttaminen todennäköisesti merkittävästiNatura 2000 -alueiden perusteena olevia luonnonarvo<strong>ja</strong> (MRL 9 § <strong>ja</strong> 197 § <strong>ja</strong> MRA 1 §)KylläTehtävä arviointi kaavan vaikutuksista Natura 2000 -alueiden perusteena oleviin luonnonarvoihin <strong>ja</strong> pyydettäväsiitä lausunto alueelliselta ympäristökeskukselta <strong>ja</strong> luonnonsuojelualueen halti<strong>ja</strong>lta (LSL 65.1 § <strong>ja</strong> 65.2 §)EiKuva 5.4Natura-arviointikaavoituksessa [19].Osoittaako arviointi- <strong>ja</strong> lausuntomenettely, että kaava heikentää merkittävästiNatura 2000 -alueen perusteena olevia luonnonarvo<strong>ja</strong> (LSL 66.1 §)KylläEiOnko vaihtoehtoisia ratkaisu<strong>ja</strong> (LSL 66.2 §)KylläEiOnko alueella ensisi<strong>ja</strong>isesti suojeltavia luontotyyppejä tai laje<strong>ja</strong> (LSL 66.3 §)KylläEiOvatko kysymyksessä ihmisten terveyteen, yleiseen turvallisuuteen tai ympäristöllemuualla koituneet erittäin merkittävät suotuiset vaikutukset (LSL 66.3 §)EiKylläHankittava komission lausunto (LSL 66.3 §)Valtioneuvoston päätös (LSL 66.2 §)Ei välttämätön yleisen edun kannaltaToteutettava yleisen edun kannalta pakottavasta syystäKaavaa ei voida hyväksyä eikä vahvistaaNatura 2000 -alueen perusteena olevat luonnonarvot eivät oleesteenä kaavan hyväksymiselle eikä vahvistamiselleantamasta päätöksestä tehtyihin valituksiin. Päätöksessäänkorkein hallinto-oikeus on muun muassatodennut seuraavaa:”Luonnonsuojelulain 66 §:n 2 momentissa ei ole tarkoitettusellaista järjestelmää, että poikkeusmenettelynyhteyteen siirrettäisiin lain 65 §:ssä tarkoitettua arviointi-<strong>ja</strong> lausuntomenettelyä tai myöskään 66 §:n 1 momentinmukaan lupaviranomaiselle taikka suunnitelman hyväksyvälletai vahvistavalle viranomaiselle säännönmukaisestikuuluvaa päätäntävaltaa.”Korkeimman hallinto-oikeuden päätöksessä on sitenratkaistu asioiden lainmukainen käsittelyjärjestys.Sen mukaisesti kysymykset suunnitellun <strong>satama</strong>hankkeenlainmukaisuudesta <strong>ja</strong> luonnonsuojelulain65 <strong>ja</strong> 66 §:ssä tarkoitettujen rajoitusten vaikutuksestatulevat ratkaistavaksi seutukaavaa koskevassasäännönmukaisessa menettelyssä.5.4.5 Uuden poikkeamispäätöksen valmisteluKorkeimman hallinto-oikeuden päätöksen jälkeenympäristöministeriössä selvitettiin uudelleen kaavanvahvistamismahdollisuuksia. Valmistelussalähdettiin ympäristöministeri Hassin kannanotonmukaisesti siitä, että <strong>satama</strong>hanketta koskeva arviointi-<strong>ja</strong> lausuntomenettely osoittaa hankkeen merkittävästiheikentävän Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet -nimisen Natura 2000 -alueenluonnonarvo<strong>ja</strong>. Asian valmistelua varten ympäristöministeriöpyysi <strong>satama</strong>hankkeesta liikenne- <strong>ja</strong>viestintäministeriön sekä sosiaali- <strong>ja</strong> terveysministeriönlausunnot.Liikenne- <strong>ja</strong> viestintäministeriö totesi lausunnossaan3. 4. 2001, että <strong>Vuosaaren</strong> <strong>satama</strong>hanke on merkittävävaltakunnallinen hanke eikä <strong>satama</strong>lle oleolemassa riittävää vaihtoehtoa <strong>Helsingin</strong> seudullaeikä muuallakaan Suomessa.Sosiaali- <strong>ja</strong> terveysministeriö piti lausunnossaan11. 5. 2001 kansanterveydellisistä syistä <strong>ja</strong> yleisenturvallisuuden vuoksi <strong>satama</strong>toimintojen pikaistasiirtoa <strong>Helsingin</strong> ydinalueelta Vuosaareen välttämättömänä.Koska alueelle esiintyy ensisi<strong>ja</strong>isesti suojeltavialaje<strong>ja</strong> <strong>ja</strong> luontotyyppejä, ympäristöministeriö katsoi,että sen tulee Suomen lainsäädännön mukaan pyytääSATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö43


asiasta vielä komission lausunto. Alueella esiintyykorpihohtosammalta (Herzogiella turfacea, 1984),joka on ensisi<strong>ja</strong>isesti suojeltava laji sekä puustoisiasoita (91D0) <strong>ja</strong> metsäluhtia (9080), jotka ovat ensisi<strong>ja</strong>isestisuojeltavia luontotyyppejä. Selvitystenmukaan hankkeella ei ole kuitenkaan näihin esiintymiinvaikutuksia.Lausuntopyynnössään [18] ministeriö totesi, ettäluontodirektiivin 6 (4) artiklan <strong>ja</strong> etenkin komissionsiitä antaman tulkintaohjeen perusteella voidaankatsoa, että komission lausunto olisi tarpeenvain silloin, kun hankkeen luontoarvo<strong>ja</strong> heikentävätvaikutukset kohdistuvat luontodirektiivin perusteellaensisi<strong>ja</strong>isesti suojeltavaan luontotyyppiin <strong>ja</strong>/tailajiin <strong>ja</strong> hanketta perustellaan ”muulla erittäin tärkeälläyleisen edun kannalta pakottavalla syyllä”.Ministeriö katsoi tällöin, että Suomen luonnonsuojelulainsanamuoto on tältä osin tiukempi, sillä seedellyttää, että jo erityisesti suojeltavan luontotyypintai lajin esiintyminen alueella edellyttää lausunnonpyytämistä.Komission lausunto voitaisiin jättää pyytämättämyös siinä tapauksessa, että ihmisten terveyteen,yleiseen turvallisuuteen tai ympäristölle muuallakoituviin erittäin merkittäviin vaikutuksiin perustuvasyy vaatii luvan myöntämistä. Sosiaali- <strong>ja</strong> terveysministeriönlausunnon mukaan suur<strong>satama</strong>nrakentamisella Vuosaareen saavutettavat terveys-,turvallisuus- <strong>ja</strong> ympäristölle muualla eli lähinnä<strong>Helsingin</strong> kantakaupungissa koituvat suotuiset vaikutuksetovat erittäin merkittävät. EYTI:n oikeuskäytäntösiitä, millaisia terveysvaikutuksia tai millaistatilannetta luontodirektiivin 6 artiklassa ontarkoitettu, on erittäin niukka. Käsillä olevaan tilanteeseensopivan oikeuskäytännön <strong>ja</strong> tarkentavientulkintaohjeiden puuttuessa ympäristöministeriö ontätäkin lainkohtaa koskevassa tulkinnassaan päätynytlausunnon pyytämisen kannalle.Komission vastauksessa 14. 11. 2001 [3] todetaan,että komission lausunto ei ole tässä asiassa tarpeen,koska hanke ei todennäköisesti vaikuta alueen ensisi<strong>ja</strong>isestisuojeltaviin luontotyyppeihin tai -lajeihin.Muihin kuin ensisi<strong>ja</strong>isesti suojeltaviin luontotyyppeihin<strong>ja</strong> -lajeihin kohdistuvien vaikutusten osaltakirjeessä kiinnitetään huomioita 6 artiklan 4 kohdanensimmäisen alakohdan mukaisesti velvollisuuteentoteuttaa kaikki tarvittavat korvaavat toimenpiteetsen varmistamiseksi, että Natura 2000:n yleinenkokonaisuus säilyy yhtenäisenä <strong>ja</strong> ilmoittaa komissiolletoteutetut toimenpiteet.Komission vastauksen jälkeen ympäristöministeriössäaloitettiin uudelleen Natura-alueiden luontoarvojenheikentämiskiellosta tarvittavan poikkeamispäätöksenvalmistelu. Poikkeamispäätös olivalmis vietäväksi valtioneuvostoon joulukuussa2001. Oikeuskansleri Nikula puuttui kuitenkin päätöksenperusteluihin. Oikeuskansleri tulkitsi EU:nluonto- <strong>ja</strong> lintudirektiivin soveltamista siten, etteivätliikenne- <strong>ja</strong> viestintäministeriön lausunnossaesitetyt perustelut yksiselitteisesti <strong>ja</strong> oikeudellisestikestävällä tavalla riittäneet osoittamaan pakottavaatarvetta rakentaa <strong>satama</strong> juuri Vuosaareen. Poikkeamispäätöstäei siten voitu viedä valtioneuvostoon.5.4.6 Rakennuslain perusteella kaavaankohdistuneet valituksetUudenmaan liiton liittovaltuuston päätöksestähyväksyä seutukaava jätettiin ympäristöministeriölleviisi valitusta. Rakennuslakiin perustuvat valituksetkohdistuivat laissa vaadittuihin vaikutusarviointeihin<strong>ja</strong> kaavan sisältövaatimuksiin.Valituksissa pidettiin muun muassa <strong>satama</strong>n aluevaraustariittämättömänä <strong>ja</strong> valtakunnallisia perusteitapuutteellisina. <strong>Satama</strong>n aiheuttamia liikenteeseen<strong>ja</strong> meluun liittyviä selvityksiä pidettiin myöspuutteellisina. Valittajien mukaan ei myöskään oltukiinnitetty riittävää huomiota virkistystarpeisiin,Westerkullan kartanoon liittyvän kulttuuriympäristönvaalimiseen eikä ratatunnelin aiheuttamiin riskeihin.Päätöksessään [20] 24. 1. 2002 ympäristöministeriötotesi, että <strong>satama</strong>n aluevaraus perustuu <strong>Vuosaaren</strong><strong>satama</strong>n perustamissuunnitelman sekä <strong>satama</strong>nyleissuunnitelmaluonnoksen laskelmiin aluetarpeesta.Aluevaraus tullaan toteuttamaan tasaisenakenttänä, jonka sisäisiä järjestelyjä voidaan <strong>satama</strong><strong>ja</strong>kuljetuslogistiikan kehityksen myötä helpostimuuttaa tekniikan kehitystä vastaavaksi.Varsinaisen seutukaavassa osoitetun <strong>satama</strong>-alueenyhteyteen on myös ympäristöministeriössä vahvistettavanaolevassa asemakaavassa osoitettu noin52 hehtaaria käsittävä työpaikka-alue. Ne korttelit,jotka rajoittuvat suoraan <strong>satama</strong>an, on varattu <strong>satama</strong>toimintoihinliittyville teollisuus- <strong>ja</strong> varastorakennuksille.Tälle yhteensä noin 18 hehtaarin suuruisellealueelle on suora yhteys <strong>satama</strong>-alueelta. Suunnitellun<strong>satama</strong>-alueen läheisyydessä Itä-Helsingissä <strong>ja</strong>Kaakkois-Vantaalla on jo nyt laajo<strong>ja</strong> tukkukaupan<strong>ja</strong> teollisuuden alueita. Ainakin osa näistä alueistasoveltuu hyvin myös <strong>satama</strong>an liittyvien teollistentoimintojen tukialueeksi.Seutukaavan melutarkastelut perustuvat pääasiassa<strong>Helsingin</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointiselostukseen. Arviointia <strong>ja</strong>44SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


meluntorjuntasuunnitelmia on myöhemmin tarkennettu<strong>satama</strong>n asemakaavan <strong>ja</strong> <strong>satama</strong>an johtavienliikenneväylien tarkemman suunnittelun yhteydessä.Seutukaavassa ei ole esitetty sen yleispiirteisyydestäjohtuen määräyksiä meluhaittojen vähentämiseksi.Tarvittavia toimenpiteitä käsitellään kuitenkin kaavaselostuksessa.Melun aiheuttamia haitto<strong>ja</strong> vähennetäänkaavassa esitettyjen tunneliratkaisujen avulla.Meluhaitto<strong>ja</strong> voidaan edelleen vähentää merkittävästiyksityiskohtaiseen suunnitteluun liittyen.Niinilahden <strong>ja</strong> Ruusuniemen pienvene<strong>satama</strong>tsekä suuri osa virkistyskalastukseen käytetystäKalkkisaarenselästä jäävät suunnitellun <strong>satama</strong>nalueelle. Toisaalta mahdollisuudet virkistyskalastukseen<strong>ja</strong> veneilyyn lisääntyvät kantakaupungin tuntumassaolevilla merialueilla, missä laivaliikennevähenee tavaratoimintojen siirtyessä Vuosaareen.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen kalataloudellisia vaikutuksiaon selvitetty kaavan lähdemateriaalina käytetyssäympäristövaikutusten arviointimenettelyssä.<strong>Satama</strong>n kalataloudellisia vaikutuksia <strong>ja</strong> vaikutuksiavirkistyskalastukseen on selvitetty lisäksi vesilainmukaisessa vesioikeuden säätelemässä prosessissa.<strong>Satama</strong>radan alustavassa yleissuunnitelmassa onselvitetty poh<strong>ja</strong>vesialueet <strong>ja</strong> kartoitettu yksityisiätalousvesikaivo<strong>ja</strong>. Radan yleissuunnitelman yhteydessäsuunnitelmia on edelleen tarkennettu. Selvitystenmukaan joidenkin kaivojen vedenpinta voialentua tai kuivua kokonaan. Vedensaanti alueenkaivojen varassa oleville kiinteistöille turvataan <strong>ja</strong>kaivoille mahdollisesti aiheutuvat vahingot korvataantai tontille johdetaan kunnallinen vesijohto.Poh<strong>ja</strong>vesien haitallisia muutoksia pystytään tarvittaessaestämään tehokkaasti tiivistämällä kallio ennenratatunnelin louhintaa.Uudet liikenneväylät sijoittuvat lähimmilläänsuunnilleen nykyisten väylien etäisyydelle Westerkullankartanosta <strong>ja</strong> sen piha-alueesta. Itäväylänpeltoalueen laajuus <strong>ja</strong> mataluus meren pinnankorkeuteen nähden ei anna <strong>satama</strong>n liikennejärjestelyillemuita mahdollisuuksia kuin matalien tie- <strong>ja</strong>ratapenkereiden toteuttamiseen. Istutettavat meluvallitestävät melun leviämisen <strong>ja</strong> lieventävät maisemallistenarvojen heikkenemistä.Suunnitellun <strong>satama</strong>n alueella <strong>ja</strong> sen lähiympäristössäsi<strong>ja</strong>itsevat mm. telakka-alue <strong>ja</strong> voimalaitos.On selvää, että yhdyskuntarakentamisen seurauksenamaisema muuttuu. Muutoksia ei voida kuitenkaanpitää niin merkittävinä, että kaava voitaisiintällä perusteella jättää vahvistamatta.Yhteenvetona asiasta ministeriö katsoi, että kaavavastaa rakennuslaissa sille asetettu<strong>ja</strong> vaatimuksia.5.4.7 Luonnonsuojelulain säännösten vaikutuskaavan vahvistamiseenYmpäristöministeriölle jätetyt valitukset perustuivatkeskeisiltä osiltaan myös luonnonsuojelulakiin.Koska <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksienvaikutusten merkittävyys Natura-alueen luonnonarvoihinoli ratkaiseva tekijä kaavan vahvistuskäsittelyssä,ympäristöministeriö kävi vielä läpitehdyn arvioinnin <strong>ja</strong> siitä annettujen lausuntojenlisäksi myös vaikutuksista erikseen pyydetyt asiantunti<strong>ja</strong>lausunnot.Ministeriö kävi läpi myös kaavanhyväksymisen jälkeen tehdyt, <strong>satama</strong>hankkeentoteuttamisen yksityiskohtaiset suunnitelmat sekäniihin liittyvät selvitykset <strong>ja</strong> arvioinnit. Tässä yhteydessätuli esiin useita aiemmissa arvioinnissa esiintyneitäristiriito<strong>ja</strong>. Voitiin myös todeta, että yksityiskohtaisissasuunnitelmissa on voitu merkittävästivähentää hankkeen aiheuttamia haitto<strong>ja</strong>.Kaavan vahvistuspäätöstä tehdessään ympäristöministeriöotti huomioon muun muassa sen, että korkeinhallinto-oikeus oli 14. 6. 2000 hylännyt Mustavuorenlehto <strong>ja</strong> Östersundomin lintuvedet Natura2000 -alueeseen kohdistetut valitukset, joissa olivaadittu kohteen laajentamista sekä sen perusteenaolevien luontoarvojen täydentämistä. Samoillaperusteilla tehtyjä valituksia ei siten voitu hyväksyämyöskään kaavaa vahvistettaessa.<strong>Satama</strong>hankkeen vaikutukset Natura 2000 -alueenluonnonarvoihin ovat seurausta <strong>satama</strong>radan allejäävästä elinympäristöstä, <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksienaiheuttamasta melusta <strong>ja</strong> häiriöstä sekä<strong>satama</strong>radan rautatiesillan <strong>ja</strong> sen yläpuolisten sähköjohtojenestevaikutuksista. Haitallisia vaikutuksiavoi aiheutua myös alueen valaistusolojen muutoksistasekä <strong>satama</strong>-alueen <strong>ja</strong> sen liikenneyhteyksienrakentamisesta. Vaikutukset kohdistuvat Porvarinlahdellesekä Labbackan–Kasabergetin alueelle.Voimakkain muutos kohdistuu Porvarinlahdenkapeikkoon. Ministeriö katsoi, että se oli tuolloinsuhteellisen rauhallinen <strong>ja</strong> ihmissilmin viehättäväpaikka. Ihmisen kannalta <strong>satama</strong>n rakentamisenaiheuttama muutos saattaa olla huomattava, kun lahdenylittää kevyen liikenteen sillan vierellä rautatie.Tämä muutos on kuitenkin vain ihmisen kokemamaisemallinen muutos. Natura-arvioinnissa vaikutuksiaon tarkasteltava suhteessa niihin luontodirektiivinmukaisiin luontotyyppeihin sekä luonto- <strong>ja</strong>lintudirektiivin mukaisten lajien elinympäristöihin,jotka on ilmoitettu tietolomakkeella alueen suojelutavoitteiksi.Päätöksessään ympäristöministeriö katsoi, että<strong>satama</strong>hankkeeseen liittynyt arviointi- <strong>ja</strong> lausunto-SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö45


menettely osoittaa, että hankkeella ei ole vaikutuksiaalueella esiintyviin ensisi<strong>ja</strong>isesti suojeltaviin luontotyyppeihintai lajeihin. Hankkeella ei ole voitu osoittaaolevan merkittäviä vaikutuksia myöskään muihinalueen tietolomakkeella esitettyihin luontotyyppeihin,koska hankkeen aiheuttama luontotyyppienpinta-alan vähennys on käytännössä pieni suhteessavastaavien luontotyyppien koko pinta-alaan kyseiselläNatura 2000 -alueella.Porvarinlahden alue on erityisesti lintujen muutonaikainenlevähdysalue sekä ravinnonhankintaalue<strong>ja</strong> pesimäalue. Tällä alueella esiintyvät ilmoituslomakkeenmukaan lintudirektiivin liitteen I lajeistakirjokerttu, pikkulepinkäinen, pyy <strong>ja</strong> kehrääjä.Porvarinlahden ympäristössä on pesinyt keskimäärinkolme kirjokerttuparia, pääasiassa entisenkaatopaikan pensaikossa. Vuoteen 1988 saakka yksireviiri si<strong>ja</strong>itsi Porvarinlahden kapeikossa suunnitellunratasillan kohdalla. Lajin tilanne on kuitenkinheikentynyt vuosi vuodelta. Kesällä 1999 Porvarinlahdellaoli vain yksi reviiri <strong>ja</strong> kesällä 2000kirjokerttu ei enää ilmaantunut alueelle lainkaan.Porvarinlahdella kirjokertun ainoat mahdollisetelinympäristöt si<strong>ja</strong>itsevat nykyisin <strong>Vuosaaren</strong> täyttömäenläheisyydessä, johon <strong>satama</strong>hankkeella ei olevaikutuksia.Pikkulepinkäinen on tärkeä laji kirjokertunmenestymisen kannalta, sillä kirjokerttu asettuusäännöllisesti pesimään sen naapuriin. Pikkulepinkäisenväheneminen on ollut selkeää Mustavuoren–Östersundomin alueella. 1970-luvun alussa sielläpesi vähintään 15 paria, vuosina 1986 –1987 kymmenenparia <strong>ja</strong> vuosina 1978 –1998 enää viisi paria.Alueella on vielä lajille soveliaita pesimäympäristöjäetenkin Kapellvikenin alueella. Porvarinlahdenhabitaatit ovat huonontuneet pensaiden <strong>ja</strong> vesakkojenkasvettua liian korkeiksi. Tämän vuoksi laji onhävinnyt myös Porvarinlahden kapeikosta eli suunnitellunrautatiesillan kohdalta.<strong>Satama</strong>radan aiheuttaman yhden mahdollisenreviirin poistumista ei voida pitää alueen suojelutilannettatarkastellen merkittävänä. Kirjokertun <strong>ja</strong>pikkulepinkäisen tulevan esiintymisen kannalta alueenpensaikkojen hoitotapa on merkittävä vaikuttavatekijä. Sopivilla hoitotoimilla lajin esiintymistä voidaanalueella jopa lisätä.Pyy <strong>ja</strong> kehrääjä eivät kuulu hankkeen välittömänvaikutusalueen pesimälajistoon Natura 2000-alueella. Aluetta koskevissa selvityksissä mainitaanmyös harmaapäätikka, jonka elinympäristöksisoveltuvia metsiä on myös Porvarinlahden rannalla.Rautatiesillan välittömät vaikutukset eivät kuitenkaanvähentäisi näiden metsien pinta-alaa Natura2000 -alueella.Rautatiesillan <strong>ja</strong> siihen liittyvän sähkölin<strong>ja</strong>n vaikutuksetalueella saalistavien <strong>ja</strong> muutoin liikkuvienlintujen kannalta ovat vähäiset, koska silta sähköjohtoineenon suhteellisen matala. <strong>Satama</strong>radan yleissuunnitelmanmukaan sähköjohdot sillalla merkitäänfluorisoivilla merkeillä johtojen linnuille aiheuttamanvaaran pienentämiseksi.Rakentaminen voi heikentää veden laatua vedensamentumisen <strong>ja</strong> kiitoaineen siirtymien vuoksi. Tällaisetvaikutukset ovat kuitenkin lyhytaikaisia <strong>ja</strong>niitä voidaan lieventää hankkeen yksityiskohtaisiinsuunnitelmiin sisällytettävien toimien avulla.<strong>Satama</strong>n <strong>ja</strong> liikenteen aiheuttamia melu- <strong>ja</strong> valaistusolosuhteidenmuutoksia alueella esiintyvien lintulajienkannalta ei selvityksissä esitettyjen tietojenvalossa voida myöskään pitää merkittävinä.<strong>Satama</strong>n <strong>ja</strong> sen liikenneyhteyksien meluvaikutuskohdistuu vain pieneen osaan (6 %) Natura 2000-aluetta (Porvarinlahden kapeikko <strong>ja</strong> suu). <strong>Satama</strong>hankkeenaiheuttama melutaso olisi tällä alueella45–50 dB. Valtioneuvoston päätöksen mukainenpäivämelutason ohjearvo luonnonsuojelualueilla on45 dB. Päätöksen perustelujen mukaan ohjearvojenei tarvitse alittua koko luonnonsuojelualueella.<strong>Satama</strong>-alue sijoittuu lähimmillään noin 200 metrinpäähän Natura -alueesta. <strong>Satama</strong>n <strong>ja</strong> Natura -alueenvälissä on tällä kohdin taa<strong>ja</strong>maseutukaavassaosoitettu suojelualue, jolla oleva puusto vähentäävalon <strong>ja</strong> melun leviämistä Natura -alueelle. <strong>Satama</strong>nvalaistuksen lähtökohtana on valon suuntaaminensinne, missä sitä tarvitaan <strong>ja</strong> toisaalta valonkarkaamisen estäminen. Työtehtävien ulkopuolellakäytetään ainoastaan turvallisuuden <strong>ja</strong> valvonnanvaatimaa valaistusta.Yhteenvetona hankkeen vaikutuksista ympäristöministeriötotesi, että <strong>Vuosaaren</strong> <strong>satama</strong>hanke heikentääniitä luonnonarvo<strong>ja</strong>, joiden suojelemiseksiMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedetniminen alue on ehdotettu sisällytettäväksi Natura2000 -verkostoon. Heikentymistä ei voida kuitenkaanpitää merkittävänä.5.4.8 Kaavan vahvistaminenYmpäristöministeriö katsoi, että seutukaava vastaasille asetettu<strong>ja</strong> vaatimuksia <strong>ja</strong> vahvisti <strong>Vuosaaren</strong><strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskevan seutukaavan24. 1. 2002.Päätöksessä määrätään rakennuslain 141 §:nno<strong>ja</strong>lla, että sitä on noudatettava ennen kuin se onsaanut lainvoiman.46SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kaavan vahvistavana ministerinä toimi ympäristöministeriSatu Hassin si<strong>ja</strong>isena ministeri Suvi-Anne Siimes. Ympäristöministeri Hassi totesiomassa kaavaan liittyvässä tiedotteessaan olevansaedelleen sillä kannalla, että kaavan toteuttaminenheikentää merkittävästi <strong>satama</strong>n lähialueella si<strong>ja</strong>itsevanMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet-nimisen Natura 2000 -alueen luonnonarvo<strong>ja</strong>.5.4.9 Valitusten käsittely korkeimmassahallinto-oikeudessaYmpäristöministeriön päätöksestä jätettiin korkeimmallehallinto-oikeudelle kaksi valitusta. Valitustenaiheet <strong>ja</strong> perustelut olivat pääosin samo<strong>ja</strong> kuin edelläkäsitellyissä ympäristöministeriölle tehdyissä valituksissa.Päätöksen valmistelua varten korkein hallintooikeuspiti 30. 5. 2002 seutukaavaan liittyvän katselmuksen.Katselmuksessa selvitettiin olosuhteitalähinnä Porvarinlahden alueella, Niinilahden vene<strong>satama</strong>-alueella,Telakka-alueella sekä <strong>Vuosaaren</strong>pohjoisrannan alueella. Korkein hallinto-oikeustutustui lisäksi sisätiloissa alueen pienoismalleihin.Tässä katselmuksessa oli esillä myös <strong>satama</strong>-alueenasemakaava <strong>ja</strong> siitä tehdyt valitukset.Päätöksessään 26. 6. 2002 [10] korkein hallintooikeustotesi, että seutukaava on yleispiirteinenalemmanasteisilla kaavoilla toteutettavaksi tarkoitettumaankäytön suunnitelma. Tässä tapauksessaaineistoon liittyy muussa järjestyksessä toteutettavaalupamenettelyä varten laadittu<strong>ja</strong> selvityksiä. Asiassaon käytettävissä asemakaavaa valmisteltaessa kertyneetrakennusasetuksen 38 §:n mukaiset selvitykset.Nämä selvitykset ovat poikkeuksellisen tarkat.Korkein hallinto-oikeus katsoi <strong>Vuosaaren</strong> <strong>satama</strong>a<strong>ja</strong> sen liikenneyhteyksiä käsitelleessä päätöksessäänarviointi- <strong>ja</strong> lausuntomenettelyn osoittavan, ettähanke heikentää alueen luonnonarvo<strong>ja</strong>. Se ei kuitenkaanosoita, että tämä heikentyminen kohdistuisiluonnonsuojelulain 66 §:n 1 momentissa <strong>ja</strong> luontodirektiivin6 artiklassa tarkoitetuin tavoin merkittävänäniihin luonnonarvoihin, joiden suojelemiseksikohde F10100065 Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet on sisällytetty Natura 2000 -verkostoon.Luonnonsuojelulain 66 §:n 1 momentti ei sitenole seutukaavan hyväksymisen esteenä. Tätä lopputulostaei myöskään voida pitää luontodirektiivin 6artiklan vastaisena.Korkein hallinto-oikeus katsoi samoin kuinympäristöministeriö, että kaava täyttää myös rakennuslainvaatimukset.Yksityiskohtaisesti perustellun päätöksen lopputuloksenakorkein hallinto-oikeus hylkäsi vaatimuksensuullisen käsittelyn toimittamisesta asian laatuunnähden <strong>ja</strong> saatuun selvitykseen nähden tarpeettomana<strong>ja</strong> katsoi, että ei ole syytä muuttaa ministeriönpäätöksen lopputulosta.Siten korkein hallinto-oikeus hylkäsi asiassa tehdytvalitukset <strong>ja</strong> ministeriön päätöksen lopputulos,jolla seutukaava <strong>ja</strong> seutukaavan muutos on vahvistettu,jää pysyväksi.Kuva 5.5Korkein hallinto-oikeuspiti <strong>Vuosaaren</strong> <strong>satama</strong>nkaavoitukseen liittyvänkatselmuksen 30. 5. 2002.Kuva: Lehtikuva /Martti KainulainenSATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö47


5.4.10 Kantelujen <strong>ja</strong> vetoomuksenkäsittely EU:ssaEuroopan yhteisöjen komissio lähetti Suomen viranomaisillekanteluihin 2002/5068 <strong>ja</strong> 2002/5300 sekävetoomukseen No 873/2002 perustuvan selvityspyynnön,joka koski Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet Natura 2000 -alueeseen liittyviäsuunnitelmia. Vetoomus <strong>ja</strong> kantelut kohdistuivatNatura-alueen laajuuteen, päätöksessä huomioitaviinlajeihin <strong>ja</strong> <strong>satama</strong>n aiheuttamiin kielteisiinvaikutuksiin Natura-alueen perustana oleviin luonnonarvoihinsekä <strong>satama</strong>n vaihtoehtoihin.Vastauksessaan komissiolle 16. 6. 2003 [22]ympäristöministeriö korosti Natura-arvioinnissa <strong>ja</strong>siitä annetuissa lausunnoissa esiintyneitä ristiriito<strong>ja</strong>.Lisäksi todettiin, että kaavan laatimisen jälkeen tehdyissäyksityiskohtaisissa suunnitelmissa on voitumerkittävästi vähentää hankkeen aiheuttamia haitto<strong>ja</strong>.Pääosin samoihin asioihin kohdistuneet valituksetoli jo aiemmin ratkaistu Suomessa korkeimmassahallinto-oikeudessa.Vastauksia täsmennettiin komission esittämienlisäkysymyksiin perustuen. Viimevaiheessa nousiesille erityisesti eri hankkeiden yhteisvaikutustenhuomioiminen Natura-arvioinnissa. Tältä osinministeriö perusti vastauksensa luontodirektiivin6 artiklan tulkintaohjeeseen [2], jonka mukaanyhteisvaikutuksina on mahdollista ottaa huomioonjo päätökseen saatettujen tai aiemmin hyväksyttyjentoteuttamattomien suunnitelmien <strong>ja</strong> hankkeidenTaulukko 5.3<strong>Vuosaaren</strong> <strong>satama</strong>a<strong>ja</strong> sen liikenneyhteyksiäkoskevaan seutukaavaanliittyneitäkäsittelyjä08. 07. 1997Korkein hallinto-oikeus palautti taa<strong>ja</strong>maseutukaavan <strong>Vuosaaren</strong> <strong>satama</strong>n aluevarauksen<strong>ja</strong> liikenneyhteyksien osalta Uudenmaan liitolle uudelleen valmistelua varten.09. 02. 1998 Kaavaluonnos nähtäville rakennusasetuksen 154 §:n mukaisesti.15. 04. 1998<strong>Helsingin</strong> <strong>satama</strong>n teettämä luonnonsuojelulain 65 §:n mukainen selvitys valmistui. Selvityksen mukaan<strong>satama</strong>hanke heikentäisi merkittävästi <strong>satama</strong>n viereisen Natura 2000 -alueen luonnonarvo<strong>ja</strong>.17. 08. 1998 Kaavaehdotus nähtäville rakennusasetuksen 21 §:n mukaisesti.20. 08. 1998Valtioneuvosto teki päätöksen Natura 2000 -verkostoon Suomen ehdotuksesta, johon sisältyiMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet -aluekokonaisuus.28. 12. 1998 Seutukaava hyväksytty maakuntavaltuustossa.19. 03. 199926. 04. 199928. 12. 199914. 06. 200020. 12. 200010. 01. 200103. 04. 200111. 05. 200129. 06. 200114. 11. 200113. 12. 2001Uudenmaan ympäristökeskus antoi tehdystä arvioinnista luonnonsuojelulain 65§:n tarkoittamanlausunnon. Sen mukaan <strong>Vuosaaren</strong> <strong>satama</strong>hanke heikentäisi merkittävästi Natura-alueen luonnonarvo<strong>ja</strong>.Arvioinnista antoivat lausuntonsa myös <strong>Helsingin</strong> <strong>ja</strong> Vantaan kaupungit.Valtioneuvosto päätti, että seutukaavaehdotus ei heikennä merkittävästi Natura-alueenluonnonarvo<strong>ja</strong> <strong>ja</strong> hylkäsi liiton hakemuksen tarpeettomana.Uudenmaan liiton maakuntavaltuusto hyväksyi <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskevanseutukaavan.Korkein hallinto-oikeus antoi ratkaisunsa valtioneuvoston 20. 8. 1998 tekemästä Natura päätöksestä<strong>ja</strong> hylkäsi Mustavuoren lehto <strong>ja</strong> Östersundomin lintuvedet -aluetta koskevat valitukset.Korkein hallinto-oikeus katsoi, ettei valtioneuvostolla ollut toimivaltaa ratkaista Natura-alueenluonnonarvojen heikentymistä koskevaa asiaa vaan toimivalta kuuluu kaavan vahvistuspäätöksentekevälle ympäristöministeriölle.Ympäristöministeriö pyysi liikenne- <strong>ja</strong> viestintäministeriöltä sekä sosiaali- <strong>ja</strong> terveysministeriöltälausunnon <strong>satama</strong>n vaikutuksista.Liikenne- <strong>ja</strong> viestintäministeriö totesi lausunnossaan, että <strong>Vuosaaren</strong> <strong>satama</strong> on merkittävävaltakunnallinen hanke eikä <strong>satama</strong>lle ole olemassa riittävää vaihtoehtoa <strong>Helsingin</strong> seudullaeikä muuallakaan Suomessa.Sosiaali- <strong>ja</strong> terveysministeriö piti lausunnossaan 11. 5. 2001 kansanterveydellisistä syistä<strong>ja</strong> yleisen turvallisuuden vuoksi <strong>satama</strong>toimintojen pikaista siirtoa <strong>Helsingin</strong> ydinalueeltaVuosaareen välttämättömänä.Ympäristöministeriö pyysi Euroopan Unionin komissiolta luonnonsuojelulain 66 §:n tarkoittamanlausunnon.Komissio totesi vastauksessaan, että komission lausunto ei ole tarpeen, koska hankeei todennäköisesti vaikuta alueen ensisi<strong>ja</strong>isesti suojeltaviin luontotyyppeihin tai lajeihin.Oikeuskansleri totesi, että <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskevan seutukaavan tarvittavalleluonnonsuojelulain 66§:n mukaiselle valtioneuvoston päätökselle ei ollut riittäviä perusteita.Tämän jälkeen ministeri Hassi ilmoitti, että hän itse ei voi päätyä muuhun kuin kaavan hylkäämiseen,mutta suostuvansa siihen, että seutukaavan vahvistamisen voi tehdä si<strong>ja</strong>inen, joka tulkitsee <strong>satama</strong>nNatura-vaikutukset toisin.24. 01. 2002 Ministeri Siimes vahvisti seutukaavan.26. 06. 2002 Korkein hallinto-oikeus hylkäsi seutukaavasta tehdyt valitukset.20. 07. 2004Komissio ilmoitti lopettaneensa <strong>Vuosaaren</strong> <strong>satama</strong>sta tehtyjen kantelujen käsittelyn<strong>Vuosaaren</strong> <strong>satama</strong>n osalta.48SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 5.6Euroopan parlamentinvetoomusvaliokunnanlähettämän tutkimusryhmänjäseniäPorvarinlahden kävelysillalla25. 3. 2004.Kuva: HS/Liisa Takala/Lehtikuvavaikutukset. Tulkintaohjeen mukaan oikeusvarmuudenvuoksi näyttäisi tarpeelliselta rajoittaa säännöksensoveltaminen sellaisiin hankkeisiin, joiden suunnitteluon jo päättynyt. Vastauksessaan komissiolleympäristöministeriö katsoi, että kanteluissa esitetyistäÖstersundomin kauppakeskuksesta <strong>ja</strong> muistahankkeista ei ollut kaavaa vahvistettaessa selkeitäpäätöksiä. Niitä koskevien lupien myöntämisessä<strong>ja</strong> suunnitelmien hyväksymisessä tai vahvistamistakoskevassa harkinnassa viranomaiset joutuvat ottamaanhuomioon sen, että <strong>Vuosaaren</strong> <strong>satama</strong>hankkeensuunnitelma alueelle on hyväksytty.EU:n parlamentin vetoomusvaliokunta vieraili<strong>satama</strong>-alueella <strong>ja</strong> tutustui <strong>Vuosaaren</strong> <strong>satama</strong>hankkeeseen24.–26. 3. 2004. Valiokunta kiinnitti huomiotaerityisesti <strong>satama</strong>n Natura-alueelle aiheuttamiinvaikutuksiin sekä TBT-pitoisten massojenruoppausten aiheuttamiin vaikutuksiin kalastukselle.Komissio ilmoitti 20. 7. 2004 lopettaneensa <strong>Vuosaaren</strong><strong>satama</strong>sta tehtyjen kantelujen käsittelyn <strong>Vuosaaren</strong><strong>satama</strong>n osalta.5.5 <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaava5.5.1 Kaavan sisältö<strong>Vuosaaren</strong> <strong>satama</strong>n asemakaava- <strong>ja</strong> asemakaavanmuutos [5] on laadittu <strong>Helsingin</strong> yleiskaavan,taa<strong>ja</strong>maseutukaavan sekä <strong>satama</strong>a <strong>ja</strong> sen maaliikenneyhteyksiäkoskevan seutukaavaehdotuksenyhdyskuntarakenteellisten tavoitteiden mukaisesti.Asemakaavan laatimisen poh<strong>ja</strong>na on näiden lisäksiollut <strong>Helsingin</strong> kaupunginvaltuuston 1996 hyväksymä<strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelma,jossa on tutkittu <strong>satama</strong>n mitoitusta, <strong>ja</strong> <strong>Vuosaaren</strong>kaavarunkoluonnos, jossa on tarkemmin selvitetty<strong>satama</strong>n aluevarauksen liittymistä sen viereiseentyöpaikka-alueeseen.Suunnittelun aikana katsottiin tarkoituksenmukaiseksisisällyttää kaava-alueeseen myös <strong>satama</strong>antoiminnallisesti liittyvä työpaikka-alue sekä lähiympäristönsuojelu-, maisemanhoito- <strong>ja</strong> virkistysalueet.Asemakaava käsittää kaikkiaan 684 hehtaarinsuuruisen alueen <strong>Vuosaaren</strong>lahden, Niinilahden,Porvarinlahden <strong>ja</strong> Mustavuoren välisellä alueella.Asemakaavassa on varattu kaupungin tarpeisiin<strong>Vuosaaren</strong> kappaletavara<strong>satama</strong>a varten 172 ha suuruinen<strong>satama</strong>-alue, josta ohjeellisesti on osoitettuvesialueena säilytettäväksi noin 21 ha. <strong>Satama</strong>n työpaikka-aluettavarten on varattu korttelialueita (T,TS, KT, KY) 52 ha <strong>ja</strong> <strong>satama</strong>n vieressä jo si<strong>ja</strong>itsevaavoimalaitosta varten alue (ET) 33 ha. Asemakaavankokonaisrakennusoikeus on noin 760 000 k-m², josta<strong>satama</strong>-alueella 250 000 k-m².Työpaikka-alue on liitetty toiminnallisesti<strong>satama</strong>-alueeseen siten, että mahdollistetaan logistisestisujuva <strong>ja</strong> saumaton yhteys <strong>satama</strong>n kauttapäätie- <strong>ja</strong> rataverkkoon. Tätä varten on varattu myössuora työkoneyhteys <strong>satama</strong>-alueelta teollisuus- <strong>ja</strong>varastokortteleiden alueelle. <strong>Satama</strong>n <strong>ja</strong> siihen liittyväntyöpaikka-alueen ra<strong>ja</strong> on suunniteltu siten, ettäse on joustavasti siirrettävissä <strong>satama</strong>toiminnan <strong>ja</strong>logistiikkatekniikan muutoksien myötä. Välittömästi<strong>satama</strong>-alueeseen liittyvät korttelit työpaikka-alueenSATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö49


pohjoisosassa on tarkoitettu pääasiassa <strong>satama</strong>n asiakkaille<strong>ja</strong> <strong>satama</strong>logistiikkaan liittyville yrityksille.Kaavan liikenteelliset ratkaisut perustuivat <strong>satama</strong>n<strong>ja</strong> sen maaliikenneyhteyksien yleissuunnitelmiinsekä olemassa olevaan katuverkkoon. Tien <strong>ja</strong>radan aluevaraukset on osoitettu siltä osin kuin nesijoittuvat <strong>Helsingin</strong> kaupungin alueelle LR- <strong>ja</strong> LTvarauksinasekä tien maanalaisen osan osalta ma-ltmerkinnällä. <strong>Satama</strong>-alueelle on osoitettu myösaluevaraus metron rataverkkoon yhdistävälle huoltoraiteelle<strong>ja</strong> otettu huomioon metron <strong>ja</strong>tkamismahdollisuusVuosaaresta eteenpäin. Meriväylää eisisällytetty asemakaavaan, mutta kaavaan on merkittyvesioikeuden päätöksen mukainen <strong>satama</strong>n liikennöintialueenra<strong>ja</strong> (ls). <strong>Vuosaaren</strong>lahden rantaanosoitettu vene<strong>satama</strong>-alue (LV) on osa yleiskaavanmukaista suurempaa vene<strong>satama</strong>-aluetta.<strong>Satama</strong>n sisäiset järjestelyt on kaavan mukaantarkoitus toteuttaa siten, että kaikki raskas liikennekäyttää <strong>satama</strong>n pohjoista porttia. Eteläisen portinkautta sallittaisiin vain henkilö- <strong>ja</strong> pakettiautoliikenne.Järjestelyn tavoitteena on varmistaa, että<strong>satama</strong>n raskas liikenne käyttää yleisen tieverkonpääteitä <strong>ja</strong> Kehä III:a eikä oh<strong>ja</strong>udu katuverkkoon.<strong>Satama</strong>n pääportin läheisyyteen on osoitettu rahtiliikenteentarpeita palvelevat pysäköinti- <strong>ja</strong> levähdysalueetsekä korttelialueet hotellille <strong>ja</strong> <strong>satama</strong>n toimistorakennukselle.Kaavassa on osoitettu luonnonsuojelualueita,suo<strong>ja</strong>viheralueita <strong>ja</strong> maisemanhoitoalueita (SL, VL,EM, EV) yhteensä noin 200 ha. Asemakaavakarttaanon merkitty myös valtioneuvoston päätöksenmukainen Natura 2000 -alueen ra<strong>ja</strong> (sl-n). Kulttuurihistoriallisestimerkittävät kohteet, kalkkilouhokset<strong>ja</strong> ensimmäisen maailmansodan linnoituslaitteeton merkitty asemakaavaan muinaismuistolain rauhoittaminahistoriallisen a<strong>ja</strong>n muinaisjäännöksinälukuun ottamatta niitä osia linnoituslaitteisiin kuuluvistatykkiteistä, jotka jäävät <strong>satama</strong>n <strong>ja</strong> <strong>satama</strong>radanaluevarauksen alle.Virkistysalueen pienenemistä kompensoitiinosoittamalla luonnonalueita korvaavia uusia virkistysalueitamääräämällä entisiä maisemavaurioalueitakunnostettavaksi maisemanhoitoalueeksi.Kunnostettuina ne muodostavat aktiivisen osanUutelasta Vantaan Mustavuoreen <strong>ja</strong> Sipoon Talosaareenulottuvaa virkistys- <strong>ja</strong> suojelualuekokonaisuutta.Samalla varmistettiin <strong>satama</strong>ntoimintojen <strong>ja</strong><strong>Vuosaaren</strong> asuntoalueen välissä olevan alueen säilyminenvirkistyskäytössä.Asemakaavassa on siinä esitettyjen ratkaisujen<strong>ja</strong> kaavamääräysten avulla pyritty vähentämäänympäristölle aiheutuvia haitto<strong>ja</strong>. Asemakaavassa onannettu myös ympäristön hoitoon, luonnonsuojeluun<strong>ja</strong> toteuttamiseen liittyviä seuraavassa esitettyjämääräyksiä:• <strong>Satama</strong>tie alittaa Natura-alueen tunnelissa.• <strong>Satama</strong>rata ylittää Porvarinlahden sillalla <strong>ja</strong> kulkeeVantaan puolella Labbackan mäen alittavassatunnelissa.• Sillan rakenteellisissa ratkaisuissa on meluntorjuntaotettava huomioon <strong>ja</strong> silta on varustettavamelukaiteella.• Sillan rakenteet on suunniteltava <strong>ja</strong> rakennettavasiten, että luonnonsuojelualueiden arvo <strong>ja</strong> maisemallinenmerkitys säilyy.• Ratapihan <strong>ja</strong> luonnonsuojelualueen väliset osat,joissa kumpareinen metsämaasto toimii melusuo<strong>ja</strong>na,on merkitty luonnontilassa säilytettäviksisuo<strong>ja</strong>viheralueiksi.• <strong>Satama</strong>-alueen yleisjärjestelyjen tavoitteena onvähentää melua alueen sisäisin järjestelyin muunmuassa sijoittamalla meluesteeksi alueen pohjoiskulmaankonttivarastot <strong>ja</strong> koillissivulle varastorakennustenrivi. Asemakaavassa on <strong>satama</strong>n koillisreunallemäärätty rakenteellinen melunsuo<strong>ja</strong>ussekä pohjoispuolelle <strong>satama</strong>-alueen <strong>ja</strong> luonnonsuojelualueenväliin meluvalli.• Liikenne- <strong>ja</strong> erityisalueille on annettu määräys,jonka mukaan meluesteet on rakennettava ennenalueen ottamista asemakaavan mukaiseen käyttöön.• Asemakaavassa on määräys maaperän kunnostamisestaennen rakennustöihin ryhtymistä.• <strong>Satama</strong>kentän sovittamiseksi saaristomaisemaanon sen Porvarinlahden puoleinen koillissivu määrättyistutettavaksi <strong>ja</strong> rakennettavaksi luonnonympäristöönsoveltuvaksi.Natura-arvioinnissa esitetyt varotoimet sisällytettiinasemakaavaan seuraavassa muodossa:• Rakentamisen Natura-alueella tulee tapahtua lintujenpesimisa<strong>ja</strong>n ulkopuolella.• <strong>Satama</strong>radan rakennusaikaista louhinta-, maansiirto-<strong>ja</strong> muuta liikennettä ei saa oh<strong>ja</strong>ta luonnonsuojelu-<strong>ja</strong> virkistysalueitten tai luonnontilaisinasäilytettävien suo<strong>ja</strong>viheralueiden kautta.• Ratasilta <strong>ja</strong> sen tukipilarit tulee sijoittaa <strong>ja</strong> rakentaasiten, etteivät ne muuta Porvarinlahden virtausolosuhteita.• Tunnelin rakentaminen Natura-alueella tuleetoteuttaa siten, että yläpuolelle jäävän maaperänkosteusolot eivät muutu kasvillisuuden kannaltahaitallisesti.50SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Lisäksi kaavaan sisällytettiin rakentamista oh<strong>ja</strong>avia,luonnonsuojeluarvojen huomioon ottamiseen velvoittaviamääräyksiä. Rakentamisen sovittamiseksiympäristöön on lisäksi annettu seuraavassa esitettyjämaisemanhoitoon liittyviä määräyksiä:Suo<strong>ja</strong>viheralueella (EV) <strong>ja</strong> suo<strong>ja</strong>viheralueella, jolletulee rakentaa melueste (EV-1):• tulee alue istuttaa puilla <strong>ja</strong> pensailla siten, että nemuodostavat tiheän suo<strong>ja</strong>kasvillisuuden.• luonnonsuojelualueisiin rajoittuvat osat on muotoiltava<strong>ja</strong> istutettava niin, että luonnonsuojelualueidenarvo <strong>ja</strong> maisemallinen merkitys säilyy.• tulee meluesteet toteuttaa siten, että ne eivätmuuta luonnonsuojelualueiden vesiolosuhteita.Maisemanhoitoalueella, joka on varattu tutkimusopetus-<strong>ja</strong> luonnonseuranta-alueeksi (EM):• alue on kunnostettava jätelainsäädännön no<strong>ja</strong>lla.• alue on hoidettava pääasiassa avoimena.• alueelle ei sallita syvälle juurtuvia istutuksia.• alueen hoidon yhteydessä on jätetäytön päälläsäännöllisesti vesottava alueelle luontaisesti levinneetsyväjuuriset kasvit.• ulkoilureittien rakentaminen ei saa vaarantaa alueengeoteknistä kantavuutta eikä aiheuttaa haittaaalueen biokaasun keräilyjärjestelmälle.• luonnonsuojelualueisiin rajoittuvat osat on muotoiltava<strong>ja</strong> istutettava niin, että luonnonsuojelualueidenarvo <strong>ja</strong> maisemallinen merkitys säilyy.Maisemanhoitoalueella, joka on varattu tutkimus-,opetus- <strong>ja</strong> luonnonseuranta-alueeksi (EM) <strong>ja</strong> lähivirkistysalueella(VL):• aluetta on hoidettava siten, että luonnonsuojeluasetuksenliitteessä 5 mainittujen alueella esiintyvienlajien säilymisen edellytykset turvataan.Kuva 5.7<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong>ympäristön asemakaavaSATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö51


Näitä määräyksiä täydentävät vielä tie- <strong>ja</strong> ratasuunnitelmissaesitetyt yksityiskohtaiset ratkaisut <strong>ja</strong> määräykset.5.5.2 Vaikutusten arviointi<strong>Satama</strong>hankkeen <strong>ja</strong> <strong>Vuosaaren</strong> täyttömäen lisätäyttöhankkeenympäristövaikutukset on arvioitu YVAmenettelyssä,<strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksienNatura-vaikutukset luonnonsuojelulain edellyttämällätavalla seutukaavoituksen yhteydessä. Näidenlisäksi on tehty lukuisia ympäristövaikutuksia koskeviaerillisselvityksiä mm. tie- <strong>ja</strong> ratahankkeidensekä meriväylän suunnittelun yhteydessä. Asemakaavoituksenyhteydessä on tehty erillisselvityksiämm. alueen maaperähygieniasta, liikennemelusta<strong>ja</strong> <strong>Vuosaaren</strong>lahdelle suunnitellun pienvene<strong>satama</strong>nympäristövaikutuksista.Asemakaavan selostuksessa todetaan, että rakentaminenmuuttaa alueen luonnonmaisemaa <strong>ja</strong> -olosuhteita.<strong>Satama</strong>n täyttöalue, maaliikenneyhteydet <strong>ja</strong>uudet korttelialueet pienentävät virkistysalueita <strong>ja</strong>niiden rakentaminen muuttaa alueen topografiaa <strong>ja</strong>maisemakuvaa. Liikenne- <strong>ja</strong> <strong>satama</strong>melu voivat häiritävirkistysalueiden käyttöä liikenne-, työpaikka<strong>ja</strong><strong>satama</strong>-alueen reunavyöhykkeellä sekä aiheuttaahaittaa lähiympäristön suojelualueilla.<strong>Vuosaaren</strong> asuntoalueelle kohdistuvat ympäristöhäiriötjäävät vähäisiksi. Asukkaiden kannaltamerkittävin haitta on Niinilahden pohjukan poistuminenvirkistyskäytöstä. Vuosaarelaisten käyttöönjäävät kuitenkin edelleen laa<strong>ja</strong>t merelliset virkistysalueetUutelan lisäksi myös esimerkiksi Kallahdessa<strong>ja</strong> Vartiokylän lahden rantamilla.Kaavalla katsottiin olevan <strong>Vuosaaren</strong> kannaltamyös positiivisia vaikutuksia. <strong>Satama</strong>n <strong>ja</strong> siihen liittyvienmuiden toimintojen mukanaan tuomat uudettyöpaikat nostavat <strong>Vuosaaren</strong> työpaikkaomavaraisuutta<strong>ja</strong> monipuolistavat tarjontaa. <strong>Vuosaaren</strong> palveluihintukeutuvina alueen yritykset myös edesauttavat<strong>Vuosaaren</strong> palveluiden kehittämistä.Kaava-alueen ulkopuolelle ulottuvista vaikutuksistamerkittävimmät ovat kantakaupungin asumiskelpoisuudenparaneminen <strong>ja</strong> siellä avautuvat uudetrakentamismahdollisuudet sekä tavaraliikenteen painopisteensiirtyminen katuverkosta Kehä III:lle <strong>ja</strong>yleisen tieverkon pääteille.Entisen telakka-alueen laajentaminen <strong>satama</strong>alueeksisekä pienvene<strong>satama</strong>n rakentaminen muuttavatlähirantojen <strong>ja</strong> saarten maisemakuvaa, joskinsaaristo ra<strong>ja</strong>a vaikutukset merimaisemassa suppeiksi.Mantereen puolella telakka-alueen rakentamisenaikainen maaston tasaaminen, telakan tuntumassasi<strong>ja</strong>itsevat voimalaitokset, hiilivarasto <strong>ja</strong>täyttömäki ovat jo muuttaneet alueen luonnonmaisemaa.Luonnontilaiseen maisemaan kohdistuvistakaavan toteuttamisen vaikutuksista merkittävimmätovat liikenneyhteyksien <strong>ja</strong> työpaikka-alueen rakentamisenvaatimat maaston leikkaukset, louhinnat <strong>ja</strong>täytöt sekä entisen maankaatopaikan lisätäyttö.Paikallisesti arvokkaista kasvillisuus- <strong>ja</strong> kasvistokohteistaosa jää muiden aluevarausten alle. Näitäovat Fotängenin <strong>ja</strong> Niinisaaren eteläosan korpialueet,voimalan itäpuolen lehto, Käärmeniemen kallio <strong>ja</strong>uloke, Lehdessaaren pohjoisosan lehtokorpilaikku,Ruusuniemen rantarinne sekä yleiskaavassa suojeltavaksiesitetty Varisluoto. Muut paikallisesti arvokkaatkohteet säilyvät virkistys- tai luonnonsuojelualueittenosina. Näistä Skillberget on merkitty asemakaavaanlähivirkistysalueena, jolla on luonnonsuojelullistaarvoa, <strong>ja</strong> tyynylaavaesiintymä alueen osana,jolla oleva geologinen muodostuma on säilytettävä.5.5.3 Kaavan käsittely<strong>Helsingin</strong> kaupunginvaltuusto hyväksyi 24. 4. 1996<strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelman <strong>ja</strong>päätti samalla asemakaavan laatimisesta <strong>Vuosaaren</strong><strong>satama</strong>a <strong>ja</strong> sen maaliikenneyhteyksiä varten. Kaavaon laadittu vuorovaikutteisesti tien <strong>ja</strong> radan yleissuunnittelunkanssa yhteistyössä Tielaitoksen <strong>ja</strong>Ratahallintokeskuksen sekä naapurikuntien kanssa.Kaavaa laadittaessa on oltu yhteydessä myös Uudenmaanliittoon, Uudenmaan ympäristökeskukseen <strong>ja</strong>museovirastoon.Asemakaavaluonnokset olivat mielipiteitä vartennähtävillä kaksi kertaa. Ensimmäinen nähtävilläolojärjestettiin helmikuussa 1997 <strong>satama</strong>n maaliikenneyhteyksienyleissuunnittelun yhteydessä. Nähtävilläolivat tuolloin eri lin<strong>ja</strong>usvaihtoehto<strong>ja</strong> vastaavat luonnoksetsekä asemakaavasta että Kaakkois-Vantaanosayleiskaavasta. Asiasta järjestettiin myös Vantaankaupungin kanssa yhteinen kaavakokous.Mielipiteitä esitettiin yhteensä 32. Niiden johdostasuunnittelualuetta laajennettiin käsittämäänmyös <strong>Vuosaaren</strong> huipun alue <strong>ja</strong> tutkittiin sen saamistavirkistyskäyttöön.Tie- <strong>ja</strong> ratajärjestelyjen yleissuunnitelmien valmistuttuaasemakaavan valmistelua <strong>ja</strong>tkettiin ratkaisuksisuositellun Porvarinlahden lin<strong>ja</strong>usvaihtoehdonpoh<strong>ja</strong>lta. Tämä lin<strong>ja</strong>usvaihtoehto oli myös vuonna1997 käynnistyneen <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen maaliikenneyhteyksiäkoskevan seutukaavan valmistelunpoh<strong>ja</strong>na asemakaava-alueella.Asemakaavaluonnos oli toisen kerran nähtävillä<strong>satama</strong>a <strong>ja</strong> sen maaliikenneyhteyksiä koskevan seutu-52SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


kaavaluonnoksen valmistuttua huhtikuussa 1998.Asemakaavaluonnokseen oli sisällytetty myös <strong>Vuosaaren</strong>huipun maisemanhoitoalueet. Asiasta järjestettiinmyös tuolloin kaavakokous. Luonnoksestalähetettiin 35 mielipidettä.Ehdotus oli julkisesti nähtävänä 19. 3.–16. 4. 1999,jolloin sitä vastaan tehtiin yksi muistutus. Muistutuksessakatsottiin, ettei kaavassa ole otettu huomioonkaavan <strong>ja</strong> sen toteuttamisen vaikutuksia muistutuksentekijänmahdollisuuksiin käyttää Uutelassaomistamaansa aluetta.Saaduissa lausunnoissa pidettiin tarkoituksenmukaisenakaava-alueen ulottamista käsittämään<strong>satama</strong>- <strong>ja</strong> työpaikka-alueen sekä niiden tarvitsemienliikenneyhteyksien lisäksi ympäristön suojelu<strong>ja</strong>virkistysalueet. Näin katsottiin voitavan kokonaisvaltaisestiyhteensovittaa rakentaminen alueenarvokkaaseen luonnonympäristöön sekä samallaeri toimenpitein vähentää ympäristöön kohdistuviahaitto<strong>ja</strong>.Useissa lausunnoissa kiinnitettiin myös huomiotaasemakaavoituksen kytkentään <strong>Vuosaaren</strong> <strong>satama</strong>a<strong>ja</strong> maaliikenneyhteyksiä koskevan seutukaavan laatimisprosessiinsekä suunnitelmien suhteeseen Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien ehdotettuunNatura-alueeseen.Asemakaava- <strong>ja</strong> asemakaavan muutosehdotuksenkaavamääräyksiä <strong>ja</strong> aluemerkintöjä esitettiin tarkistettavaksiluonnonsuojelu-, virkistys-, suo<strong>ja</strong>viher<strong>ja</strong>maisemanhoitoalueiden osalta niin, että kaavantoteuttamisen vaikutukset ympäristöön voitaisiinminimoida myös rakentamisen aikana. Naapurikuntienlausunnoissa kiinnitettiin lisäksi huomiotakaavan toteuttamisen itse kaava-alueen ulkopuolelleulottuviin ympäristövaikutuksiin. Lisäksi esitettiinkuivatelakan <strong>ja</strong> merenkulkupiirille varatunalueen toimintaedellytyksiin liittyviä huomautuksia,<strong>satama</strong>-alueen aluera<strong>ja</strong>uksen tarkistamista sekätyöpaikka-alueen riittävyyttä <strong>ja</strong> toiminnallista luonnettakoskevia huomautuksia.Kaavaehdotukseen tehtiin muistutuksen <strong>ja</strong> lausuntojenjohdosta vähäisiä aluera<strong>ja</strong>usten tarkistuksiasekä tarkistettiin <strong>ja</strong> täydennettiin kaavamääräyksiä.Kaavaselostuksen liitteeksi lisättiinmeluhaitto<strong>ja</strong> koskevat lisäselvitykset <strong>ja</strong> maisemavaikutuksiahavainnollistavat kuvasovitukset sekä Östersundominlintuvesien linnustoselvitys <strong>ja</strong> käyttö- <strong>ja</strong>hoitosuunnitelma.Lausuntojen käsittelyn aikana <strong>Vuosaaren</strong> huipunalueella havaittiin merkkejä uhanalaisesta perhoslajista.Yhteistyössä Uudenmaan ympäristökeskuksenkanssa selvitettiin lajin elinpaikkavaatimukset <strong>ja</strong>tehtiin sen suojelu- <strong>ja</strong> hoitosuunnitelma. Kaavaa olitässä vaiheessa vielä mahdollista tarkistaa <strong>ja</strong> siihensisällytettiin määräys, jonka mukaan aluetta on hoidettavasiten, että luonnonsuojeluasetuksen liitteessä5 mainittujen alueella esiintyvien lajien säilymisenedellytykset turvataan.<strong>Helsingin</strong> kaupunginvaltuusto hyväksyi <strong>Vuosaaren</strong><strong>satama</strong>n <strong>ja</strong> sen ympäristön asemakaavan8. 12. 1999. Kaavasta jätettiin ympäristöministeriöönkolme valitusta, jotka kohdistuivat seutukaavanoh<strong>ja</strong>usvaikutukseen, selvitysten puutteisiin <strong>ja</strong> kaavanvaikutuksiin Natura-alueeseen sekä asemakaavansisältövaatimuksiin.<strong>Helsingin</strong> kaupunginvaltuuston päätös asemakaavanhyväksymisestä on tehty aikana, jolloin <strong>satama</strong>n<strong>ja</strong> sen liikenneyhteyksiä käsittävän seutukaavanmuutosta ei vielä ollut hyväksytty. Kun sittemminseutukaavan muutos alistettiin vahvistettavaksi <strong>ja</strong>siitä tehdyt valitukset hylättiin ympäristöministeriössä,ei ministeriön päätöksen mukaan ollut seutukaavanoh<strong>ja</strong>usvaikutuksesta johtuvaa estettä vahvistaanoudatettavaksi määrätyn seutukaavan mukaistaasemakaavaa.Muilta osin valitukset kohdistuivat pääosinsamoihin asiakokonaisuuksiin kuin seutukaavassa.Ympäristöministeriö hylkäsi kaavaan kohdistuneetvalitukset <strong>ja</strong> vahvisti asemakaavan seutukaavan vahvistamisenjälkeen 25. 1. 2002 [21].Korkeimmalle hallinto-oikeudelle tekivät valituksenyhteisellä valituskirjelmällä kaikki kolmeministeriölle asemakaavan hyväksymisestä erillisenvalituksen tehneet. Korkein hallinto-oikeus hylkäsisinne tulleen valituksen 26. 6. 2002 <strong>ja</strong> piti ympäristöministeriönpäätöksen voimassa [21].24. 04. 199603. 02. 199701. 04. 199819. 03. 199908. 12. 199925. 01. 200226. 06. 2002Kaupunginvaltuusto päätti asemakaavanlaatimisesta <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> senliikenneyhteyksiä varten.Alustavat luonnokset nähtäville rakennusasetuksen154 §:n mukaisesti.Kaavaluonnos nähtäville rakennusasetuksen154 §:n mukaisesti.Kaavaehdotus nähtäville rakennusasetuksen39 §:n mukaisesti.Asemakaava hyväksytty kaupunginvaltuustossa.Asemakaava vahvistettu ympäristöministeriössä.Valitukset hylätty korkeimmassa hallintooikeudessa.Taulukko 5.4<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong>ympäristön asemakaavankäsittelyn aikatauluSATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö53


5.6 Kaakkois-Vantaan osayleiskaavaTaulukko 5.5Kaakkois-Vantaanosayleiskaavankäsittelyn aikataulu5.6.1 Kaavan sisältöKaakkois-Vantaan osayleiskaava perustuu ympäristöminiteriön24. 1. 2002 vahvistamaan <strong>Vuosaaren</strong><strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksiä koskevaan seutukaavaan<strong>ja</strong> tarkentaa sitä.Osayleiskaavassa [15] osoitetaan Vuosaareen<strong>satama</strong>n tarvitsemat maaliikenneyhteydet Vantaanalueella. <strong>Satama</strong>n ratavaraus on osoitettu radan alustavassayleissuunnitelmassa tutkitun Keravan tunnelivaihtoehdonmukaisena muilta osin, paitsi Leppäkorvessa,jossa ratatunneli on osoitettu nykyisenasutuksen itäpuolelle yleissuunnitelman jälkeen laaditunselvityksen perusteella.Rata erkanee pääradasta Keravan puolella <strong>ja</strong> kulkeekalliotunnelissa Porvoonväylän eteläpuolelleasti. Tästä rata <strong>ja</strong>tkaa maan pinnalla Kehä III:a <strong>ja</strong><strong>satama</strong>an johtavaa tietä seuraten Österängenin eteläreunaan,alittaa Labbackan tunnelissa <strong>ja</strong> ylittää Porvarinlahdensillalla. <strong>Satama</strong>tie alittaa kalliotunnelissaLabbackan <strong>ja</strong> Porvarinlahden.Kaava-alue on muutoin suurelta osin osoitetturetkeily-, virkistys- <strong>ja</strong> ulkoilualueiksi. Luonnonsuojelualueidenra<strong>ja</strong>ukset on kaavassa tarkistettu vastaamaanNatura 2000 -alueen rajo<strong>ja</strong>.5.6.2 Kaavan vaikutuksetTavarasatamien siirtyminen <strong>Helsingin</strong> keskustastaVuosaareen <strong>ja</strong> <strong>satama</strong>kapasiteetin kasvu voimistavatVantaan logistista asemaa <strong>ja</strong> tehostavat seudunlogistista vyöhykettä yhdessä lentoaseman <strong>ja</strong> E 1818. 01. 199503. 02. 199719. 05. 199905. 11. 199910. 11. 1999Kaavoituslautakunta päätti käynnistääympäristövaikutusten arviointityönkannalta tarpeellisten vaihtoehtojenlaatimisen.Alustavat luonnokset nähtävillerakennusasetuksen 154 §:n mukaisesti.Osayleiskaavaluonnos RakL 125 §:n<strong>ja</strong> RakA 154 §:n no<strong>ja</strong>lla nähtäville.Maankäyttö- <strong>ja</strong> rakennuslain mukainenensimmäinen viranomaisneuvottelu.Osayleiskaavaehdotus nähtävilleMRA 29§ mukaisesti.16. 04. 2002 Toinen viranomaisneuvottelu.17. 06. 2002Osayleiskaava hyväksyttiinkaupunginvaltuustossa.11. 06. 2003 Valitukset hylättiin hallinto-oikeudessa.03. 03. 2004Valitukset hylättiin korkeimmassahallinto-oikeudessa lukuun ottamattaWesterkullan kartanon länsipuolellasi<strong>ja</strong>itsevalle yleiskaavassa lähivirkistysalueeksi(VL) osoitetulle alueelle merkittyäulkoilureittiä.28. 04. 2004 Osayleiskaava tuli voimaan.-liikennekäytävän kanssa. Vantaan työpaikka-alueidenvetovoima kansainvälisten yritysten sijoituspaikkanakasvaa.Porvarinlahden ratasilta tunneliaukkoineen häiritseemuuten rauhallista luonnonaluetta <strong>ja</strong> ehjäämaisemakuvaa. Uudet väylät <strong>ja</strong> liittymäjärjestelytpienentävät pelto- <strong>ja</strong> metsäalaa sekä muuttavatmaisemakuvaa Porvoonväylän eteläpuolella. Vaikutuksetovat suurimmat Österängenin pellolla, jossajärjestelyllä on haittavaikutuksia myös Vikkulan asutukselle.Meluvalleilla, aidoilla <strong>ja</strong> -kaiteilla voidaanmelutaso liikenteen lisääntymisestä huolimatta pitääkuitenkin asuin-, virkistys-, retkeily- <strong>ja</strong> suojelualueillamelko alhaisena.Kaakkois-Vantaa osayleiskaava on osa niitä suunnitelmia,joiden tarkoituksena on toteuttaa <strong>Vuosaaren</strong><strong>satama</strong>hanke maa- <strong>ja</strong> vesiliikenneyhteyksineen.Sen vuoksi osayleiskaavan vaikutusten yhteydessäoli otettava huomioon koko hankkeen vaikutuksetMustavuoren lehdon <strong>ja</strong> Östersundomin lintuvesienNatura 2000 -alueeseen. <strong>Satama</strong>hankkeen käsittänytlausunto- <strong>ja</strong> arviointimenettely osoitti, että hankkeellaei ole merkittäviä vaikutuksia Natura-alueenperusteena oleviin luonnonarvoihin. Tältä osin asiaaon tarkemmin selostettu edellä <strong>Vuosaaren</strong> <strong>satama</strong>n<strong>ja</strong> sen liikenneyhteyksiä koskevan seutukaavan yhteydessä<strong>ja</strong> luvussa 4.5.6.3 Kaavan käsittelyVantaan kaupunginvaltuusto päätti hyväksyessäänkoko Vantaata käsittävän yleiskaavan 14. 9. 1992, ettäKaakkois-Vantaalle laaditaan osayleiskaava. Päätöksentaustana oli se, ettei yleiskaavaa laadittaessaollut riittävää selvyyttä <strong>Helsingin</strong> <strong>satama</strong>ratkaisusta.Osayleiskaavan alustavat luonnokset olivat esilläyhtä aikaa tie- <strong>ja</strong> ratasuunnitelmien lin<strong>ja</strong>usvaihtoehtojen<strong>ja</strong> niitä vastaavien alustavien asemakaavaluonnostenkanssa helmikuussa 1997. Kaavan laatiminenaloitettiin siten rakennuslain ollessa voimassa.Kaavan loppuvaiheet on käsitelty vuonna 1999 voimaantulleen maankäyttö- <strong>ja</strong> rakennuslain mukaisesti.Kaava on hyväksytty Vantaa kaupunginvaltuustossa17. 6. 2002. Korkein hallinto-oikeus ratkaisikaavaan kohdistuneet valitukset 3. 3. 2004. Valituksissakeskeisinä aiheina olivat <strong>satama</strong>n vaikutuksetMustavuoren lehto <strong>ja</strong> Östersundomin lintuvedetNatura 2000 -alueen luonnonarvoihin samoin kuin<strong>satama</strong>-alueen käsittävässä seutukaavassa <strong>ja</strong> asemakaavassa.54SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 5.8Kaakkois-VantaanosayleiskaavaL ä h t e e t:1. Biota BD Oy; Sami Kurki <strong>ja</strong> Sakari Mykrä 1998. Mustavuorenlehto <strong>ja</strong> Östersundomin lintuvedet. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen vaikutukset NATURA 2000 -alueeseen.2. Euroopan komissio 2000. Luontodirektiivin 92/43/ETY 6artiklan säännökset.3. Euroopan komissio 14. 11. 2001. Euroopan komissionvastaus ympäristöministeriön lausuntopyyntöön <strong>Vuosaaren</strong><strong>satama</strong>hankkeesta.4. <strong>Helsingin</strong> kaupunki, kaupunginkanslian julkaisusar<strong>ja</strong>A 31/1992. <strong>Helsingin</strong> Yleiskaava 1992: selostus.5. <strong>Helsingin</strong> kaupunkisuunnitteluvirasto, kaavoitusosasto1998. <strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö. Asemakaavan <strong>ja</strong>asemakaavan muutoksen selostus N:o 10640.6. <strong>Helsingin</strong> seutukaavaliitto 1993. <strong>Helsingin</strong> seudun seutukaava.Taa<strong>ja</strong>ma-alueet, liikenneväylät <strong>ja</strong> -alueet.7. Insinööritoimisto Paavo Ristola Oy. Ympäristövaikutustenarviointiselostus, <strong>Helsingin</strong> <strong>satama</strong>hanke 29. 9.1995. <strong>Helsingin</strong> kaupunki.8. Korkeimman hallinto-oikeuden päätös 8. 7. 1997. <strong>Helsingin</strong>seudun seutukaava. Taa<strong>ja</strong>ma-alueet, liikenneväylät<strong>ja</strong> -alueet.9. Korkeimman hallinto-oikeuden valtioneuvoston päätöstä3. 12. 1999 koskeva päätös 20. 12. 2000.10. Korkeimman hallinto-oikeuden päätös 26. 6. 2002. <strong>Vuosaaren</strong><strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskeva seutukaava<strong>ja</strong> seutukaavan muutos.11. Korkeimman hallinto-oikeuden päätös 26. 6. 2002. <strong>Vuosaaren</strong><strong>satama</strong> <strong>ja</strong> ympäristö, Asemakaavan <strong>ja</strong> asemakaavanmuutoksen vahvistaminen.12. Uudenmaan liitto 28. 12. 1999. <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong>sen liikenneyhteyksiä koskeva seutukaava <strong>ja</strong> seutukaavanmuutos.13. Uudenmaan ympäristökeskus 13. 3. 1996. Lausunto ympäristövaikutustenarviointiselostuksesta, <strong>Helsingin</strong> <strong>satama</strong>hanke.14. Valtioneuvoston päätös 3. 12. 1999. Luonnonsuojelulain66 §:n 2 momentissa tarkoitettua poikkeusta koskevanUudenmaan liiton hakemuksen käsittely.15. Vantaan kaupunki 3. 6. 2002. Kaakkois- Vantaa. Osayleiskaavaehdotuksenselostus.16. Ympäristöministeriön päätös 18. 6. 1996. <strong>Helsingin</strong> seudunseutukaava. Taa<strong>ja</strong>ma-alueet, liikenneväylät <strong>ja</strong> -alueet.17. Ympäristöministeriön päätös 1. 10. 1996. <strong>Helsingin</strong> Yleiskaava1992.18. Ympäristöministeriö 29. 6. 2001. Lausuntopyyntö Euroopankomissiolta <strong>Vuosaaren</strong> <strong>satama</strong>hankkeesta.19. Ympäristöministeriö 2002. Osallistuminen <strong>ja</strong> vaikutustenarviointi maakuntakaavoituksessa. Maankäyttö <strong>ja</strong>rakennuslaki 2000 -julkaisusar<strong>ja</strong>.20. Ympäristöministeriön päätös 24. 1. 2002. <strong>Vuosaaren</strong> <strong>satama</strong>a<strong>ja</strong> sen liikenneyhteyksiä koskeva seutukaava <strong>ja</strong>seutukaavan muutos.21. Ympäristöministeriön päätös 25. 1. 2002. <strong>Vuosaaren</strong> <strong>satama</strong><strong>ja</strong> ympäristö. Asemakaavan <strong>ja</strong> asemakaavan muutoksenvahvistaminen.22. Ympäristöministeriö 16. 6. 2003. Vastaus komission selvityspyyntöön,joka koskee Mustavuori–ÖstersundominNatura 2000 -aluetta koskevaa vetoomusta <strong>ja</strong> kanteluita.SATAMAN SUUNNITTELUUN LIITTYNEET KAAVAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö55


6Maaliikenneyhteyksiensuunnittelu6.1 Suunnitteluvaiheet <strong>ja</strong> lainsäädännön kehittyminenLaki yleisistä teistä 10 §, 2 momentti (51/1981)Teitä ei saa tehdä siten, että hyväksytyn tai vahvistetun asema- rakennus- tairantakaavan toteuttaminen vaikeutuu. Tien suunnittelussa on mahdollisuuksienmukaan otettava huomioon myös muut alueiden käytön suunnitelmat. Vahvistetunseutu- <strong>ja</strong> yleiskaavan oikeusvaikutteista on säädetty erikseen.Maantielaki 17 §, 1 <strong>ja</strong> 2 momentit (503/2005)Yleissuunnitelman <strong>ja</strong> tiesuunnitelman tulee perustua maankäyttö- <strong>ja</strong> rakennuslainmukaiseen oikeusvaikutteiseen kaavaan, jossa maantien si<strong>ja</strong>inti <strong>ja</strong> suhde muuhunalueiden käyttöön on selvitetty. Alueella, jolla on laadittavana tai muutettavanaoikeusvaikutteinen kaava, voidaan ryhtyä toimenpiteisiin kaavan tavoitteisiinperustuvan yleis- tai tiesuunnitelman laatimiseksi.Valtakunnalliset alueidenkäyttötavoitteet sekä maakuntakaava <strong>ja</strong> yleiskaavaon otettava huomioon siten, kuin maankäyttö- <strong>ja</strong> rakennuslaissa säädetään. Yleissuunnitelmaaei saa hyväksyä vastoin maakuntakaavaa tai oikeusvaikutteistayleiskaavaa. Yleissuunnitelma voidaan hyväksyä vastoin voimassa olevaa asemakaavaa,jos kunta <strong>ja</strong> alueellinen ympäristökeskus sitä puoltavat. Tiesuunnitelmaaei saa hyväksyä vastoin oikeusvaikutteista kaavaa.<strong>Helsingin</strong> vaikutusalueella si<strong>ja</strong>itsevia <strong>satama</strong>paikko<strong>ja</strong>on haettu <strong>ja</strong> tutkittu useissa selvityksissä viimeistenkolmenkymmenen vuoden aikana. 1990-luvulla <strong>satama</strong>selvitykset keskittyivät nykyistensatamien uudelleenjärjestelyihin sekä <strong>Vuosaaren</strong><strong>ja</strong> Pikkalanlahden satamien suunnitteluun <strong>ja</strong> vaihtoehtojenvertailuun.Vuonna 1992 <strong>Vuosaaren</strong> <strong>satama</strong>hanke sai nykyisenmuotonsa, kun <strong>Helsingin</strong> kaupunginvaltuusto joulukuussahyväksyi Yleiskaava 1992:n. Siinä nykyisettavara<strong>satama</strong>-alueet päätettiin varata pääasiassa asumiseen<strong>ja</strong> Vuosaaresta varattiin entisen telakan alueeltatilaa uudelle kappaletavara<strong>satama</strong>lle. Liikenneyhteydetovat kaikissa vaiheissa olleet kiinteä osa<strong>satama</strong>paikkojen vertailussa <strong>ja</strong> <strong>Vuosaaren</strong> <strong>satama</strong>nsuunnittelussa.Suomen ympäristölainsäädännön kehittyminenon antanut uusia haasteita myös liikenneväyliensuunnittelulle. Vuonna 1981 lakiin yleisistä teistä(243/1954) tuli muutos (51/1981), joka velvoittitien suunnittelussa ottamaan huomioon ympäristönäkökohdat<strong>ja</strong> alueella voimassa olevat kaavat.Tämä vaatimus korostui ympäristövaikutustenarviointimenettelystä vuonna 1994 annetussa laissa(468/1994) sekä samaan aikaan voimaan tulleessarakennuslain (469/1994) muutoksessa. Lainsäädäntööntuli tällöin myös selvä velvoite asukkaiden <strong>ja</strong>muiden asianosaisten osallistumisen järjestämisestä<strong>ja</strong> mielipiteiden esittämisestä suunnittelun aikana.Yleissuunnitelman sisältö <strong>ja</strong> merkitys määriteltiinvasta vuonna 1999 voimaan tulleessa yleisistä teistäannetun lain muutoksessa (342/1998). Tätä aiemminyleissuunnitelmalla ei ollut lainsäädännössä määriteltyäasemaa. Käytännössä kuitenkin kaikista merkittävistätiesuunnitelmista laadittiin alustavia selvityksiä<strong>ja</strong> yleissuunnitelma ennen yksityiskohtaisentiesuunnitelman laatimista. Näin meneteltiin myös<strong>Vuosaaren</strong> <strong>satama</strong>n suunnittelussa.Vuonna 2000 voimaan tulleessa yleisistä teistäannetun lain muutoksessa (133/1999) vahvistettiinedelleen kaavoituksen merkitystä siten, että jo tiensuunnittelun tuli perustua kaavaan. Nämä kaavoitusta<strong>ja</strong> tien suunnittelua koskevat periaatteet ovatvoimassa myös nykyisessä vuonna 2006 voimaantulleessa Maantielaissa (503/2005).Rautateiden suunnittelua käsittävä laki tuli voimaanvasta 1. 1. 2008. Tätä ennen <strong>ja</strong> siten myös <strong>Vuosaaren</strong><strong>satama</strong>n rautatieyhteyden suunnittelu onperustunut lunastuslakiin. Rautatieyhteyksien suunnitteluon käytännössä kuitenkin ollut koko a<strong>ja</strong>nmukana <strong>satama</strong>paikkojen hausta <strong>ja</strong> alustavista lin<strong>ja</strong>usvaihtoehtojensuunnittelusta lähtien.<strong>Vuosaaren</strong> <strong>satama</strong>n suunnittelussa ratkaisevaanasemaan nousi vuonna 1997 voimaan tullut luonnonsuojelulaki(1096/1996) <strong>ja</strong> siinä määritellyt Natura2000 -verkostoa koskevat säännökset. Käytännössänämä säännökset johtivat väistämättä tunnelienhyväksikäyttöön <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksiensuunnittelussa.<strong>Vuosaaren</strong> maaliikenneyhteyksien suunnitteluajoittui siten a<strong>ja</strong>n<strong>ja</strong>ksoon, jolloin ympäristökysymykset,vuorovaikutteinen suunnittelu <strong>ja</strong> liikennejärjestelmäntarkastelu maankäytön suunnittelunyhteydessä tulivat mukaan suunnitteluun. Tunnelienkäyttö ympäristöllisesti vaikeissa paikoissa alkoimyös saada <strong>ja</strong>lansi<strong>ja</strong>a Suomessa.56MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j at6.2 Maaliikenneyhteydet <strong>Helsingin</strong> Yleiskaavassa 1992Mauri Heikkonen, DI, on osallistunut ympäristöministeriössä<strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteyksien suunnittelun <strong>ja</strong> ympäristövaikutustenarvioinnin oh<strong>ja</strong>ukseen <strong>ja</strong> kaavojen vahvistuspäätösten valmisteluun.Ronald Westermark, DI, on toiminut vuodesta 1991 alkaenTiehallinnon Vuoli-projektin päällikkönä vastuualueenaan suunnittelu.Vuodesta 2002 lähtien hän on toiminut myös projektin johta<strong>ja</strong>n si<strong>ja</strong>isena.<strong>Helsingin</strong> kaupungin yleiskaavan poh<strong>ja</strong>ksi tutkittiinvuonna 1992 erilaisia maaliikennevaihtoehto<strong>ja</strong>ns. VUOMA-työryhmässä [8]. Tien osalta tutkittiinkolme päävaihtoehtoa, jotka olivat: Porvarinlahdenylitse sillalla kulkeva vaihtoehto <strong>ja</strong> kaksi Mustavuoreneteläpuolitse Kehä III:lle kiertävää vaihtoehtoa.Radan osalta tutkittiin Pasilaan, Tapanilaan <strong>ja</strong> Tikkurilaanjohtavat vaihtoehdot.Työryhmä suositteli tien viemistä sillalla Porvarinlahdenyli Kehä III:lle <strong>ja</strong> radan johtamista Porvarinlahdenyli Tikkurilaan. Suosituksen mukaisetyhteydet esitettiin <strong>Helsingin</strong> Yleiskaava 1992:ssa,jonka kaupunginvaltuusto hyväksyi joulukuussa1992. Taa<strong>ja</strong>maseutukaavan aluevaraukset <strong>Vuosaaren</strong><strong>satama</strong>n liikenneyhteyksien osalta perustuivat myösVUOMA-työryhmän suosituksiin.Ympäristöministeriö jätti vahvistamatta taa<strong>ja</strong>maseutukaavassaosoitetut <strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteyksienaluevaraukset <strong>ja</strong> kumosi <strong>Helsingin</strong>Yleiskaava 1992:n <strong>satama</strong>n maaliikenneyhteyksienosalta 1996. Ministeriö katsoi, että kaavan mahdollistamatmaanpäälliset yhteydet olisivat olleet arvokkaanluonnonympäristön kannalta tuhoisia [16].Ympäristöministeriöllä oli tällöin käytettävissään jo<strong>satama</strong>hankkeen YVA-menettelyn tulokset. Asiaa onselostettu myös luvussa 5.RatavaihtoehdotRata 4Rata 3B1B1ARata 6Rata 2Rata 5RataRata 1A/1B3B/4/5/6HELI-rataMaanpäällinen rataTunnelissa kulkeva rataTIE 1TIE 2TIE 3Kuva 6.1VUOMA-työryhmäntutkimat rata- <strong>ja</strong> tievaihtoehdot.Kehä IIKehä IIKehä IIIPorvoonväyläPorvoonväyläPorvoonväyläKehä IItäväyläNiini saarentieKehä IItäväyläItäväyläNiini saarentieNiini saarentieKehä IVuotieVuotieVuotieMAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö57


6.3 Maaliikenneyhteyksien vaihtoehtotarkastelu 1994<strong>Helsingin</strong>, Vantaan <strong>ja</strong> Sipoon korkeimmista luottamusmiehistämuodostettiin vuonna 1994 <strong>Vuosaaren</strong><strong>satama</strong>n neuvottelukunta (VUOLI). Neuvottelukunnantehtävänä oli löytää kaikkia osapuolia tyydyttävämaaliikenneyhteysvaihtoehto. Tätä varten ns.VUOLI-työryhmä selvitteli eri vaihtoehto<strong>ja</strong> tielle<strong>ja</strong> radalle.VUOLI-työryhmä otti tarkempaan tarkasteluunneljä tievaihtoehtoa: Porvarinlahden siltavaihtoehto,Porvarinlahden alitus tunnelissa, Mustavuoren kiertävävaihtoehto <strong>ja</strong> Sipoon kautta Labbackan mäenitäpuolitse kulkeva vaihtoehto [13].Radan osalta käytiin läpi toistakymmentä erilaistavaihtoehtoa. Niistä tarkempaan tarkasteluun valittiineteläpäässä kolme lin<strong>ja</strong>usvaihtoehtoa <strong>ja</strong> pohjoispäässäTapanilaan, Tikkurilaan <strong>ja</strong> Koivukylään johtavatvaihtoehdot.VUOLI-työryhmä suositteli 1995 tien johtamistaPorvarinlahden ali tunnelissa Kehä III:lle <strong>ja</strong> radanjohtamista Koivukylään.Kuva 6.2VUOLI-työryhmäntutkimat ratavaihtoehdot58MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


6.4 Maaliikenneyhteydet ympäristövaikutusten arviointimenettelyssä 1994 – 1996<strong>Vuosaaren</strong> <strong>satama</strong>n ympäristövaikutusten arviointimenettelykäynnistyi heti uuden YVA-lain tultuavoimaan syksyllä 1994 [4].6.4.1 Maaliikenneyhteyksien vaihtoehdotsuunnittelualueen eteläpäässä<strong>Satama</strong>an johtavan päätieyhteyksien suunnittelunlähtökohtana oli Kehä III:n <strong>ja</strong>tkaminen Itäväylältä<strong>satama</strong>-alueelle. Tie rakennetaan joko tunnelissaPorvarinlahden alitse (vaihtoehto B <strong>ja</strong> C) tai vaihtoehtoisestisillalla Porvarinlahden yli <strong>ja</strong> tunnelissaLabbackan mäen läpi (vaihtoehto A).Rautatie <strong>satama</strong>sta oh<strong>ja</strong>utuu vaihtoehdoissa A <strong>ja</strong>C suoraan sillalle Porvarinlahden yli <strong>ja</strong> Labbackanmäen lävitse. Vaihtoehdossa B rautatie suuntautuuPorvarinlahden eteläpuolitse Mustavuoren tunneliin.Radan vieminen tunnelissa Porvarinlahden ali ei tullutkyseeseen, koska <strong>satama</strong>n tarvitsema järjestelyratapihaulottuu lähelle Porvarinlahtea, josta sitä eiole enää mahdollista viedä lahden alitse.Vaihtoehtojen vertailua on kuvattu ympäristövaikutustenarviointiraportissa seuraavasti:Vaihtoehdossa A rata <strong>ja</strong> tie sillalla Porvarinlahdellamuuttavat merkittävästi lahden maisemakuvaa.Vaihtoehto johtaa suuriin maisemamuutoksiin myösÖsterängenin peltoaukeaman kohdalla.Ratapiha <strong>ja</strong> maantie muodostavat leveän <strong>ja</strong> pitkänesteen, joka eristää Porvarinlahden eteläpuolenAB<strong>ja</strong> Skillbergetin muista virkistyskäytössä olevistaalueista. Vaihtoehto jättää Porvarinlahden perukannykytilaan.Meluvaikutukset ulottuvat Porvarinlahden <strong>ja</strong>Bruksvikenin lintuvesialueille. Meluntorjunta ontässä vaihtoehdossa vaikeinta.Vaihtoehdon B tärkein etu on siinä, että Porvarinlahtimaisematilana <strong>ja</strong> linnustoalueena jää rakentamisenulkopuolelle. Toisaalta radan <strong>ja</strong> tien maisemavaikutuksetleviävät kahteen maastokäytävään <strong>ja</strong> sitenvaihtoehtoa A laajemmalle alueelle. Vaihtoehto saattaavaikuttaa myös Västerkullan kulttuurimaisemaan.Ratapenger saattaa muuttaa Porvarinlahden pohjukassaolevan kosteikon hydrologisia olo<strong>ja</strong>. Poh<strong>ja</strong>vesienkannalta Mustavuoren kautta kulkeva vaihtoehtoon myös huono.Vaihtoehdossa C pelkän rautatien rakentaminen Porvarinlahdenyli keventää oleellisesti siltaratkaisuavaihtoehtoon A nähden.Rautatiesillalle on kohtuullisen helppo rakentaatehokkaat melusuo<strong>ja</strong>ukset. Sillasta saattaa tulla kuitenkinmassiivinen <strong>ja</strong> maisemaa hallitseva.Vaihtoehto C:n etu vaihtoehtoon B nähden onse, että rakentamistoimenpiteet sijoittuvat samaanmaastokäytävään <strong>ja</strong> Mustavuoren alue jää kokonaankoskemattomaksi.CKuva 6.3MaaliikenneyhteydetPorvoonväyläneteläpuolellaMAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö59


Kuva 6.4Ratavaihtoehdot välilläPorvoonväylä – päärataUudenmaan ympäristökeskuksen eli YVA-yhteysviranomaisenlausunnon mukaan <strong>satama</strong>n <strong>ja</strong> maaliikenneyhteyksienvälittömässä läheisyydessä onkasvistollisesti <strong>ja</strong> linnustollisesti arvokkaita alueita,jotka tulevat olemaan osa Natura 2000 -verkostosta[11]. Mikäli hankkeen vaikutukset kohdistuvat tällaisellealueelle, on kaikki keinot käytettävä haittojenlieventämiseksi. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksissätämä tarkoittaa luonnonympäristöäsäästävien tunneliratkaisujen valintaa. Tällöin myösrakennustöiden aikana on kiinnitettävä huomiota siihen,etteivät työmaan haitat leviä toimenpidealueenulkopuolelle.KoivukylänratavaihtoehtoTikkurilanratavaihtoehtoKeravanratavaihtoehtoHeli-radanvaraus itään6.4.2 Maaliikenneyhteyksien vaihtoehdot välilläPorvoonväylä – päärataYVA-menettelyssä oli mukana neljä pääradallesuuntautuvaa vaihtoehtoa. Seuraavassa on esitettyYVA-selostuksen mukaan vaihtoehtojen merkittävimmätvaikutukset ympäristöön.Rata 1 KoivukyläKoivukylään päättyvässä vaihtoehdossa rakennetaantunneli Hanabölen peltoaukeamalle saakka, jossarata sijoittuu peltoaukeaman keskelle <strong>ja</strong> kaartuu pääradanvarteen Koivukylän eteläpuolella. Peltoalueon luokiteltu kulttuurihistoriallisesti arvokkaaksimaisema-alueeksi.Rata 2 Heli länteenRatavaihtoehdossa 2 ratayhteys Vuosaareen rakennetaanHeli-radan lin<strong>ja</strong>usta noudattaen LångmossabergenistäTapanilaan <strong>ja</strong> siitä edelleen pääradanitäpuolta Koivukylään. Vaihtoehdon ongelmallisinpaikka on Puistolan omakotialue, jonka lounaiskulmaaradan lin<strong>ja</strong>us pahasti rikkoo. Jakomäen kohdallaratavaihtoehto johtaa koulun urheilualueidenpienenemiseen.Rata 3 TikkurilaRatavaihtoehdossa 3 rata suuntautuu tunnelissaKuninkaalan teollisuusalueelle <strong>ja</strong> liittyy sieltä Santalanteollisuusraiteen lin<strong>ja</strong>ukseen. Lin<strong>ja</strong>us ei aiheutamaisemallisia haittatekijöitä Kuninkaalan teollisuusalueella.Myöhemmin vaihtoehto osoittautui Tikkurilankaavoituksen kannalta ongelmalliseksi.Rata 4 KeravaRatavaihtoehdossa 4 rautatie suuntautuu pitkässätunnelissa Keravan eteläosiin <strong>ja</strong> nousee maanpinnallehyvin lähellä päärataa. Vaihtoehto on muitakalliimpi.60MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


6.5<strong>Vuosaaren</strong> <strong>satama</strong>n perustamissuunnitelma<strong>ja</strong> maaliikenneyhteyksien tavoitteetYleiskaavapäätöksen perusteella alettiin Helsingissävalmistella valtuuston hyväksyttäväksi perustamissuunnitelmaa,joka valmistui helmikuussa 1994.Suunnitelma jäi käsittelemättä, koska valtuustopäätti, että hankkeesta tehdään silloin tulossa olevanYVA-lain mukainen ympäristövaikutusten arviointi.YVA-menettelyn päätyttyä <strong>Vuosaaren</strong> <strong>satama</strong>nperustamissuunnitelma saatettiin a<strong>ja</strong>n tasalle. Maaliikennevaihtoehdotesitettiin siinä edellä mainitunVUOLI-työryhmän suositusten mukaisesti. <strong>Helsingin</strong>kaupunginvaltuusto hyväksyi 24. 4. 1996 <strong>Vuosaaren</strong><strong>satama</strong>n perustamissuunnitelman selvällä ääntenenemmistöllä äänin 53 –28. Samalla kaupunginvaltuustopäätti <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen ympäristönasemakaavan laatimisesta.Perustamissuunnitelman hyväksymisen jälkeenTielaitos käynnisti tien yleissuunnitelman [2] laatimisen<strong>ja</strong> Ratahallintokeskus vastaavan tarkkuudenomaavan radan alustavan yleissuunnitelman laatimisen[14]. Maaliikenneyhteyksien suunnitteluun liittyvätyleiset tavoitteet olivat:• Luoda sujuvat yhteydet <strong>satama</strong>sta päätieverkkoon<strong>ja</strong> rataverkkoon.• Saada aikaan toimivat väyläratkaisut, joiden haitatovat mahdollisimman vähäiset.• Parantaa hankkeen hyväksyttävyyttä edellisessäsuunnitteluvaiheessa saatujen lausuntojen perusteella.• Varmistaa toteuttamisen edellytykset <strong>ja</strong> kustannustenhyväksyttävyys.6.6 <strong>Satama</strong>tien yleissuunnitelma 1997Tieliikennejärjestelyjen yleissuunnittelu käynnistyilokakuussa 1996. Suunnittelun verkollisena lähtökohtanaoli <strong>satama</strong>n perustamissuunnitelmassaesitetty periaateratkaisu. <strong>Satama</strong>an johtavan tieyhteyden<strong>ja</strong>tkosuunnittelun lähtökohtana oli Porvarinlahdentunnelissa alittava ratkaisu.Suunnitelma valmistui <strong>ja</strong> lähetettiin lausunnolletoukokuussa 1997. Suunnitelmaa esiteltiin sidosryhmille<strong>ja</strong> yleisölle sekä käytiin sidosryhmien <strong>ja</strong> asukkaidenkanssa lukuisia neuvottelu<strong>ja</strong>.Laaditun suunnitelman mukaan tieyhteys <strong>satama</strong>antoteutetaan kaksiajorataisena tienä tunnelissaPorvarinlahden <strong>ja</strong> Labbackanmäen alitse ItäväylälleKehä III:n liittymän kohdalle. Kehä III parannetaansiitä eteenpäin kaksiajorataiseksi. Lisäksi myös ItäväyläNiinisaarentieltä Kehä III:lle parannetaankaksiajorataiseksi.Ensimmäisen rakennusvaiheen suunnitelmassaluovuttiin Kehä III:n <strong>ja</strong> Porvoonväylän liittymänsujuvoittamisesta sekä tingittiin melusuo<strong>ja</strong>uksista<strong>ja</strong> kevyen liikenteen väylistä.<strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskevaseutukaava <strong>ja</strong> <strong>satama</strong>n <strong>ja</strong> sen ympäristön asemakaavaperustuvat tieliikennejärjestelyjen osaltayleissuunnitelman mukaisiin ratkaisuihin. Toisaaltakaavojen laadinta <strong>ja</strong> mm. Natura-alueeseen liittyvätselvitykset ovat osaltaan täsmentäneet tiejärjestelyjentoteuttamisen lähtökohtia <strong>ja</strong> perusteita.Kuva 6.5YleissuunnitelmaratkaisuMAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö61


6.7 <strong>Satama</strong>radan alustava yleissuunnitelma<strong>Satama</strong>radan alustava yleissuunnittelu käynnistyilokakuussa 1996 <strong>ja</strong> suunnitelmaraportti valmistuikesään 1997 mennessä [1].6.7.1 Eteläosa <strong>satama</strong>sta ItäväylälleSuunnittelu käynnistyi <strong>satama</strong>n <strong>ja</strong> Itäväylän välistenratavaihtoehtojen selvittämisellä. Toiminnallisten<strong>ja</strong> taloudellisten tekijöiden ohella suunnittelussaoli erityisen tärkeä paino ympäristötekijöillä, koskamolemmat eteläosan tutkitut vaihtoehdot sijoittuivatNatura 2000 -alueelle <strong>ja</strong> myös merkittävälle virkistysalueelle.Vaihtoehdoista toinen, ns. Mustavuori-vaihtoehto,alitti Mustavuoren tunnelissa <strong>ja</strong> suuntautuiedelleen joko betonitunnelissa tai osittain avoratanaItäväylän yli pohjoiseen.Toinen vaihtoehto, ns. Porvarinlahti-vaihtoehto,ylitti Porvarinlahden sillalla <strong>ja</strong> alitti Labbackanmäen kallio/betonitunnelissa <strong>ja</strong> suuntautui edelleentulevaa <strong>satama</strong>tietä seuraten avoratana pohjoiseen.Molempien ratavaihtoehtojen si<strong>ja</strong>intia tarkistettiinedellisistä suunnitteluvaiheista siten, että ne voitaisiintoteuttaa luonnon <strong>ja</strong> ympäristön kannalta mahdollisimmanvähin haitoin.Tehdyn vertailun perusteella Porvarinlahdenvaihtoehto todettiin kokonaisvaikutuksiltaan ympäristönkannalta paremmaksi.6.7.2 <strong>Satama</strong>rata Itäväylältä päärataverkolleItäväylän pohjoispuolella <strong>satama</strong>rataa suunniteltiinjoko pintaratana Kehä III:n vieressä <strong>ja</strong> tunnelissaPorvoon moottoritien ali tai syvässä tunnelissaGubbackan mäen alitse. Vaihtoehdot yhtyvät Hakunilanalla <strong>ja</strong> <strong>ja</strong>tkuvat edelleen tunnelissa pohjoiseenjoko Hanabölen peltoaukealle tai Keravalle. <strong>Satama</strong>rataliittyisi päärataan joko Koivukylässä tai Saviolla.Vaihtoehtona tutkittiin myös Kehä III:n vierestäkääntyminen itään Porvoonväylää seuraten Etelä-Sipoon halki Kerava–Sköldvik-radalle.Tunneliosuuksilla vaihtoehtojen toteuttamiskelpoisuusvarmistettiin maaperä- <strong>ja</strong> kalliotutkimuksilla.Vertailussa Sipoon vaihtoehdon haittavaikutuksetosoittautuivat suurimmiksi <strong>ja</strong> suositukseksi tuliKoivukylän vaihtoehto, jonka toteuttamisen kustannussäästötolisivat suuret verrattuna ympäristövaikutuksiin.<strong>Satama</strong>ratavaihtoehdot olivat laa<strong>ja</strong>sti yleisön nähtävinä<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavan<strong>ja</strong> Kaakkois-Vantaan osayleiskaavan valmisteluvaiheissa.<strong>Satama</strong>ratavaihtoehto<strong>ja</strong> esiteltiin myösyleisötilaisuuksissa <strong>satama</strong>suunnittelun käytössäolleessa Itäkeskuksen esittelytilassa <strong>ja</strong> Vantaan kouluilla.Syksyn 1997 aikana tutkittiin Ratahallintokeskuksen,Vantaan <strong>ja</strong> <strong>Helsingin</strong> yhteistyönä uudelleenKuva 6.6<strong>Satama</strong>radanlin<strong>ja</strong>usvaihtoehdotSavioMaanpäällinen rataTunnelissa kulkeva rataKoivukyläHELI-ratavarausKilpilahden rata62MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


tarkemmin Tikkurilan lin<strong>ja</strong>usta. Ratahallintokeskus<strong>ja</strong> Helsinki selvittivät osaltaan Tapanilan lin<strong>ja</strong>usta,jolle tutkittiin myös paikallisia vaihtoehto<strong>ja</strong>. Mitäänmerkittävää uutta ei selvityksissä löydetty.Syyskuussa 1997 Vantaan <strong>ja</strong> <strong>Helsingin</strong> välisissäneuvotteluissa todettiin, että Koivukylän lin<strong>ja</strong>uksensuunnittelua ei voida <strong>ja</strong>tkaa, koska ratalin<strong>ja</strong>us kulkikulttuurihistoriallisesti arvokkaiden Hanabölen peltojenpoikki. <strong>Satama</strong>a <strong>ja</strong> maaliikenneyhteyksiä koskevaanseutukaavaan ehdotettiin otettavaksi Tapanilan,Tikkurilan <strong>ja</strong> Savion lin<strong>ja</strong>ukset.Vantaan <strong>ja</strong> <strong>Helsingin</strong> kaupunginjohta<strong>ja</strong>t katsoivat27. 1. 1998 antamassaan kannanotossa, että suunnitteluatulisi <strong>ja</strong>tkaa Savion lin<strong>ja</strong>uksen poh<strong>ja</strong>lta ympäristön<strong>ja</strong> maankäytön kannalta vähiten haittaa aiheuttavanajoskin kalliina vaihtoehtona. Vantaa <strong>ja</strong> Helsinkiantoivat seutukaavaluonnoksesta myös tämän sisältöisenlausunnon.Savion lin<strong>ja</strong>uksen nouseminen päävaihtoehdoksisynnytti laa<strong>ja</strong>a vastustusta Leppäkorven alueellaVantaalla, jossa ratatunneli olisi tullut kulkemaanomakotiasutuksen alla.Ratahallintokeskus teki uusia maastotutkimuksia<strong>ja</strong> esitti alustavaan yleissuunnitelmaan tarkennuksen,jossa ratatunnelin lin<strong>ja</strong>us kiertää olemassa olevanasutuksen. <strong>Satama</strong>a <strong>ja</strong> sen maaliikenneyhteyksiäkoskevassa seutukaavaehdotuksessa ratatunneliesitettiin Ratahallintokeskuksen esittämällä tavallatarkennettuna.Joulukuussa 1998 Ratahallintokeskus teetti Savionns. itäisen tunnelivaihtoehdon riskejä koskevan tarkastelun.Riskiraportissa todetaan, että on hyvinepätodennäköistä, että Savion tunnelin rakentaminenaiheuttaisi Ruotsissa <strong>ja</strong> Nor<strong>ja</strong>ssa esiintyneitäpoh<strong>ja</strong>veden saastumiseen liittyneitä ongelmia, koskakallioperän ominaisuudet ovat erilaisia.6.8 <strong>Satama</strong>tien tiesuunnitelma6.8.1 Tiesuunnitelman laatiminen <strong>ja</strong> käsittelyt<strong>Vuosaaren</strong> <strong>satama</strong>n tiejärjestelyjen tiesuunnitelman<strong>ja</strong> <strong>satama</strong>radan yleissuunnitelman laatiminen käynnistyivättoukokuussa 2000 <strong>Helsingin</strong> <strong>Satama</strong>n, Tiehallinnon<strong>ja</strong> Ratahallintokeskuksen yhteisenä maaliikenneprojektina[9].Tiesuunnitelma on laadittu vuonna 1997 valmistuneen<strong>Vuosaaren</strong> <strong>satama</strong>n tieliikenneyhteyksien yleissuunnitelmanmukaiseen järjestelyyn perustuen siten,että ensimmäisessä vaiheessa toteutetaan vain <strong>satama</strong>nliikenteen kannalta välttämättömät toimenpiteet.Tiesuunnitelma valmistui 30. 4. 2001. Tiesuunnitelmalähetettiin tielain mukaiseen käsittelyyn 28. 2. 2002alueen seutukaavaa <strong>ja</strong> asemakaavaa koskevienympäristöministeriön vahvistamispäätösten jälkeen.Suunnitelmaan ei ole sovellettu 15. 5. 1998 annettuavuoden 1999 alusta voimaan tullutta tielain säännöstöäyleissuunnitelmasta. Tielain mukaisen yleissuunnitelmanlaatiminen ei ollut tarpeen, koskatiejärjestelyjen vaikutukset oli selvitetty jo kaavoituksenyhteydessä tapahtuneessa suunnittelussa.Kuva 6.7<strong>Satama</strong>tie alittaaPorvarinlahdenPorvarinlahtiPorvarinlahdentietunneliMAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö63


Kuva 6.8Liikenteenoh<strong>ja</strong>us<strong>ja</strong>turvallisuusvarusteitaPorvarinlahdentietunnelissa.Kuva: Juka Kuokkanen/ Illusia.bizSuunnitelmaa laadittaessa varattiin maanomistajille<strong>ja</strong> muille asianosaisille sekä niille, joiden asumiseen,työntekoon tai muihin oloihin suunnitelmasaattaa vaikuttaa, tilaisuus mielipiteen lausumiseenasiasta. Suunnitelmasta hankittiin <strong>Helsingin</strong> <strong>ja</strong> Vantaankaupunkien, Sipoon kunnan, Uudenmaan ympäristökeskuksen,Uudenmaan liiton, Museoviraston,Keski-Uudenmaan maakuntamuseon, Ratahallintokeskuksen<strong>ja</strong> YTV:n lausunnot. Lisäksi niille, joidenoikeutta tai etua suunnitelma koskee, varattiin tilaisuusmuistutusten tekemiseen.Suunnitelmasta tehtiin kaksi muistutusta <strong>Helsingin</strong>kaupungin alueelta <strong>ja</strong> yhdeksän Vantaan kaupunginalueelta.Liikenneministeriö vahvisti tiesuunnitelman3. 2. 2003. Päätöksessä myönnettiin oikeus täytäntöönpanoonmuutoksenhausta huolimatta.Korkein hallinto-oikeus hylkäsi sinne tulleet valituksettiesuunnitelmasta 3. 3. 2004. Valituksissa <strong>ja</strong>myös aiemmin jätetyissä muistutuksissa keskeisenäaiheena olivat hankkeen aiheuttamat vaikutuksetMustavuoren lehdon <strong>ja</strong> Östersundomin lintuvesienNatura 2000 -alueeseen. Tältä osin korkein hallintooikeusoli ratkaissut kantansa jo <strong>Vuosaaren</strong> <strong>satama</strong>a<strong>ja</strong> sen liikenneyhteyksiä käsittävien kaavapäätöstenyhteydessä vuonna 2002.6.8.2 Suunnitelman sisältö<strong>Vuosaaren</strong> <strong>satama</strong>n päätieverkkoon yhdistävä <strong>Satama</strong>tieon kaksiajoratainen pääväylä, joka johdetaannoin 1,6 km pitkässä tunnelissa Porvarinlahden <strong>ja</strong>Labbackan mäkialueen ali. Tie liittyy päätieverkkoonKehä III:n päässä Itäväylän liittymässä. KehäIII:n osuus Porvoonväylän <strong>ja</strong> Itäväylän välillä rakennetaankaksiajorataiseksi.<strong>Satama</strong>tien <strong>ja</strong> Laivanrakenta<strong>ja</strong>ntien liittymä olitiesuunnitelmassa esitetty <strong>Helsingin</strong> kaupunginrakennettavaksi tulevana tasoliittymänä. Kaavassaoli varaus myöhemmälle eritasoliittymälle. Välityskykytarkastelujen<strong>ja</strong> teknis-taloudellisten selvitystenpoh<strong>ja</strong>lta liittymä muutettiin kuitenkin heti kaupunginrakennettavaksi eritasoliittymäksi.<strong>Satama</strong>tien <strong>ja</strong> Itäväylän liittymä toteutetaan joensimmäisessä vaiheessa eritasoliittymänä. RamppiliittymätItäväylällä sijoittuvat porrastetusti. Itäpuolenramppiliittymässä on Itäväylällä kiertoliittymä,jonka tarkoituksena on osaltaan oh<strong>ja</strong>ta liikennettäkäyttämään Porvoonväylää maantien 170 si<strong>ja</strong>sta.Porvoonväylän liittymässä sujuvoitetaan Helsinkiinsuuntautuvaa liikennesuuntaa rakentamalla silmukkaramppiliittymän koillisneljännekseen. Aiemminkäytössä ollut Helsinkiin suuntautuva ramppioli tiesuunnitelmassa esitetty purettavaksi, koskaliittymäalue saadaan siten selkeämmäksi <strong>ja</strong> ramppiakäyttävä liikennevirta on hyvin pieni. Päätös purkaako. ramppi kuitenkin peruttiin myöhemmässä rakennusvaiheessa.Kuva 6.9<strong>Satama</strong>tie <strong>ja</strong> rataalittavat vierekkäinLabbackan mäkialueen.Kuva:Ronald Westermark64 MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 6.10MaaliikenneyhteydetVärien selityksetSuunnitellut tiet:Suunnitelmanmukaan rakennettavattai parannettavattiet <strong>ja</strong> kadutTunneliosuusSuunnitelturautatieYleinen tieKatuNykyiset tiet:MaantiePaikallistieYksityinen tieKatu <strong>ja</strong>rakennuskaavatieMAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö65


Kuva 6.11Maaliikenneyhteydetvälillä Itäväylä – <strong>Vuosaaren</strong><strong>satama</strong> 4. 9. 2008.Kuva: Sami Kurikka /SkylinefotoKuva 6.12Ennuste Kehä III:nliikennemääristävuonna 2020 Hämeenlinnanväylältäitään.VihdintieHämeenlinnan väyläTurunväyläESPOOLänsiväyläVANTAA92 0005 %Kehä IIITuusulanväyläKehä IHELSINKI68 0006 %Lahdenväylä40 00017 %SIPOO30 00039 % 20 00072 %ItäväyläPorvoonväyläVUOSAARENSATAMA0 1 2km6.8.3 Vaikutukset liikenteeseen<strong>Satama</strong>hanke vaikuttaa liikenteeseen välittömästi<strong>satama</strong>liikenteen muutosten <strong>ja</strong> toisaalta välillisestiyhdyskuntarakenteen muutosten kautta. <strong>Satama</strong>liikenteenosalta tapahtuu seuraavat muutokset:• tavarasatamien liikenne siirtyy Vuosaareen• satamien välinen liikenne poistuu• tiekuljetuksista osa siirtyy juniin<strong>Vuosaaren</strong> <strong>satama</strong>n junakuljetusten osuuden tavoitteeksion asetettu noin 30 %, kun se nykyisissä satamissaon 12 %.<strong>Satama</strong>n kaikki raskas liikenne kulkee <strong>satama</strong>npohjoisen portin <strong>ja</strong> <strong>Satama</strong>tien kautta. <strong>Satama</strong>n raskaanliikenteen kulkeminen <strong>Vuosaaren</strong> asuinalueidenläpi kielletään.Ylisuurten kuljetusten reitti <strong>Vuosaaren</strong> <strong>satama</strong>anjohdetaan Laivanrakenta<strong>ja</strong>ntien (nykyisin <strong>Satama</strong>kaari)<strong>ja</strong> Niinisaarentien kautta. Tietunnelin mitoitusei salli ylikorkeita kuormia. <strong>Satama</strong>n vaarallistenaineiden kuljetus tapahtuu <strong>Satama</strong>tietä Porvarinlahdentunnelin kautta.<strong>Satama</strong>n käyttöönottovuotena <strong>Satama</strong>tien liikennemääräksion arvioitu noin 10 000 ajoneuvoa.Vuonna 2020 <strong>Satama</strong>tien päivittäisen liikennemääränon arvioitu nousevan noin 20 000 ajoneuvoon.Raskaiden ajoneuvojen osuuden arvioidaan olevannoin 33 % koko <strong>satama</strong>n liikenteestä.<strong>Satama</strong>liikenteen siirtyminen Vuosaareen suuntautuvillereiteille <strong>ja</strong> satamien välisen liikenteenpoistuminen vähentää liikennettä Länsiväylällä,Kehä I:llä <strong>ja</strong> <strong>Helsingin</strong> kantakaupungissa. Liikennevastaavasti kasvaa Kehä III:n itäosalla sekä työmatka-<strong>ja</strong> asiointiliikenteen osalta myös Itäväylällä.6.8.4 Vaikutukset ympäristöönTiesuunnitelmassa on kehitetty edelleen yleissuunnitelmanratkaisu<strong>ja</strong> niin, että ympäristöhaitat on saatumahdollisimman pieniksi. Tiesuunnitelmaan liittyvänympäristösuunnitelman yleisenä tavoitteena onollut tien, radan <strong>ja</strong> meluesteiden sovittaminen maisemaan,väylien aiheuttamien haittojen minimointisekä kaikille tienkäyttäjille levollisen <strong>ja</strong> selkeänväylätilan muodostaminen. Ympäristön suunnittelussaon kiinnitetty erityistä huomiota maiseman <strong>ja</strong>Natura-alueen kannalta kriittisimpiin kohtiin. Näitäovat ratapihan ra<strong>ja</strong>aminen Porvarinlahden maisemasta,tietunnelien eteläiset suuaukot, ratasillanPorvarinlahden ylitys, tunnelien suuaukkojen liittyminenympäristöön Labbackassa sekä Gubbackanliittymäalueen sijoittuminen maisemaan.Tien sijoittaminen Natura-alueen kohdalla tunneliinpoistaa käytännössä tien haitalliset vaikutuksetNatura-alueen kannalta. Sijoittamalla <strong>satama</strong>tie <strong>ja</strong>66MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


<strong>satama</strong>rata tiesuunnitelman mukaisesti samaan tiiviiseenliikennetilaan saavutetaan seuraavia vaikutuksiayleissuunnitelmaan verrattuna:• Liikenneväylien tarvitsema tila on pienentynyt.Meluntorjuntaa on voitu tehostaa.• Labbackan tie- <strong>ja</strong> ratatunnelit on voitu suunnitellaosittain yhteisellä suuaukkoperiaatteella, jolloinniiden vaikutukset Natura-alueeseen ovat lieventyneet.• Rakentamisen vaikutukset ovat lieventyneet.Ympäristöriskejä on suunnitelmassa vähennettymyös tieltä tulevien hulevesien puhdistamiseen tarkoitetuillapatoratkaisuilla.Rakentamisen oleellisena reunaehtona oli, ettäPorvarinlahden alue pysyy häiriintymättömänä lintujenpesimäkauden aikana. Työnaikaisia meluhaitto<strong>ja</strong>rajoitettiin ajoittamalla Porvarinlahden läheisyydessämelua tuottavat rakennusvaiheet lintujenpesimäa<strong>ja</strong>n ulkopuolelle.Toinen pääperiaate tiesuunnitelmassa oli, ettämassakuljetukset <strong>satama</strong>an hoidetaan mahdollisuuksienmukaan normaaliliikenteen väylien ulkopuolellakäyttäen rakenteilla olevia teitä <strong>ja</strong> rataväyliätyömaateinä. Massansiirrot optimoitiin kokonaisuudenkannalta edullisimmalla tavalla <strong>Vuosaaren</strong> <strong>satama</strong>nrakentamiseen kytkeytyvien muiden hankkeidenkanssa. <strong>Satama</strong>n massatarpeen mukaan kaikkimaaliikenneväylien rakenteisiin kelvolliset ylijäämämassaton sijoitettu <strong>satama</strong>n täyttöihin. Niilläkorvattiin merihiekan käyttöä.<strong>Satama</strong>rata <strong>ja</strong> <strong>Satama</strong>tie yhdessä katkaisevat koillinen–lounas-suunnassakulkuyhteydet Österängeninpeltoalueen yli <strong>ja</strong> haittaavat retkeilyä <strong>ja</strong> talvisin hiihtoa.Pitkämatkaiset ulkoiluyhteydet on kuitenkinmahdollista järjestää alueella.Kehä III:n parantaminen kaksiajorataiseksi eiaiheuta merkittäviä ympäristövaikutuksia. Liikennekäytäväkuitenkin levenee huomattavasti, sillä myös<strong>satama</strong>rata kulkee tällä kohdin samassa maastokäytävässä.Maisemavaikutukset ovat merkittävimmät Österängeninpeltoaukealla, joka nyt on luonnonalueisiinrajoittuvaa kulttuurimaisemaa. Liikenneympäristömuuttuu nykyistä hallitsevammaksi <strong>ja</strong> maaseutumaisestarakennetummaksi.<strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksien vaikutuksiapoh<strong>ja</strong>vesiin, kasvillisuuteen <strong>ja</strong> linnustoonseurataan erillisen seurantaohjelman mukaisesti.6.9 <strong>Satama</strong>radan yleissuunnitelma 20016.9.1 Yleissuunnitelman laatiminen <strong>ja</strong> käsittelyt<strong>Satama</strong>radan yleissuunnitelman <strong>ja</strong> tiejärjestelyjen tiesuunnitelmanlaatiminen käynnistyivät toukokuussa2000 <strong>Helsingin</strong> <strong>Satama</strong>n, Tiehallinnon <strong>ja</strong> Ratahallintokeskuksenyhteisenä maaliikenneprojektina [14].Asukkaiden <strong>ja</strong> yleisön mielipiteitä <strong>ja</strong> näkemyksiähankkeesta kuultiin useissa yleisötilaisuuksissa.Esille tulleita asioita on otettu huomioon seuraavasti:• Labbackan rautatietunneli siirrettiin tietunnelinviereen, jolloin vaikutukset Natura-alueelle saadaanentistäkin vähäisemmiksi.• Päiväkummun <strong>ja</strong> Leppäkorven alueella selvitettiintunnelin lin<strong>ja</strong>usvaihtoehto<strong>ja</strong>.• Tunnelin vaikutusalueella tehdyn kaivokartoituksen,koepumppaustietojen <strong>ja</strong> poh<strong>ja</strong>vesimallinnuksenperusteella arvioidaan vesioikeudellisen lupamenettelyn<strong>ja</strong> lunastustoimituksen yhteydessämahdolliset haitat <strong>ja</strong> korvaukset.• Työnaikainen liikenne on suunniteltu siten, että seei kulje asuinalueiden kautta. Työmaaliikenne käyttääpäätiestöä <strong>ja</strong> rakennettavia tie- <strong>ja</strong> ratapohjia.• Tunneliosuuksilla varaudutaan tärinän vaimentamiseen.• Louhimisen yhteydessä vapautuvat räjähdyskaasutoh<strong>ja</strong>taan niin, että niistä ei ole terveydellistävaaraa. Tunneleiden louhinnan yhteydessä ei käytetäterveydelle tai luonnolle haitallisia tiivisteaineita.<strong>Satama</strong>radan yleissuunnitelma valmistui huhtikuussa2001.Yleissuunnitelman valmistumisen jälkeen tehtiinvielä täydentäviä maa- <strong>ja</strong> kallioperätutkimuksiaLahden moottoritien maastokäytävässä Kuusijärven<strong>ja</strong> Keravanjoen välisellä tunneliosuudella.Tavoitteena oli selvittää voidaanko ratalin<strong>ja</strong>a siirtäälähemmäksi moottoritietä poispäin asutuksesta ns.Myraksen ruhjealueen kohdalla. Selvitys valmistuihelmikuussa 2002 [15]. Selvityksessä todettiin tutkittuvaihtoehtoinen lin<strong>ja</strong>us rakennettavuudeltaan<strong>ja</strong> ympäristövaikutuksiltaan toteuttamiskelpoiseksi.Radan lin<strong>ja</strong>us siirtyi noin 100 metriä kauemmaksiPäiväkummun pientaloalueelta.<strong>Satama</strong>radan hallinnolliseen käsittelyyn tarkoitetutsuunnitelmat koostuivat varsinaisesta yleissuunnitelmasta<strong>ja</strong> edellä kuvatusta yleissuunnitelman tarkistuksesta.MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö67


Kuva 6.13<strong>Satama</strong>rata yhdistää<strong>Vuosaaren</strong> <strong>satama</strong>npäärataan.Ratahallintokeskus pyysi liikenne- <strong>ja</strong> viestintäministeriölle18. 2. 2003 saapuneessa kirjeessäänvaltioneuvostolta lunastuslupaa <strong>Vuosaaren</strong> <strong>satama</strong>radanrakentamiseen vuosina 2003 –2008 tarvittavienmaa- <strong>ja</strong> vesialueiden lunastamiseksi omistusoikeuksinSuomen valtiolle <strong>ja</strong> lupaa hankkia lunastamallaSuomen valtiolle pysyvä käyttöoikeus <strong>Vuosaaren</strong><strong>satama</strong>rataa varten rakennettaviin tunneleihin tarvittavaanalueeseen sekä erityistä oikeutta irrottaarakentamisessa käytettäväksi tunneleista saa-tava kiviaines sekä lunastamalla rajoittaa pysyvästikiinteistön omistajien oikeutta käyttää kiinteistöääntunneleiden päällä. Lisäksi Ratahallintokeskus pyysilupaa hankkia lunastamalla Suomen valtiolle käyttöoikeusläjitysalueisiin rakentamistyön a<strong>ja</strong>ksi [5].Ratahallintokeskus pyysi myös valtioneuvostoltaennakkohaltuunottolupaa koko hankkeen osalta<strong>satama</strong>radan rakennustöiden kiireellisen aloittamisenvuoksi <strong>ja</strong> töiden keskeytymättömän <strong>ja</strong>tkumisenturvaamiseksi.Valtioneuvosto myönsi 12. 6. 2003 Ratahallintokeskukselleradan rakentamista <strong>ja</strong> käyttöä vartentarvittavat lunastusluvat. Lunastettavia alueita olikaikkiaan 73,4 hehtaaria, joista omistusoikeudellalunastettavia alueita oli noin 25,8 hehtaaria <strong>ja</strong> käyttöoikeudellalunastettavia alueita noin 47,6 hehtaaria.Päätöksestä valittivat yksityinen maanomista<strong>ja</strong><strong>ja</strong> yhtiö. Valituksissa keskeisinä asioina olivat hankkeenvaikutukset Natura 2000 -alueeseen <strong>ja</strong> YVAmenettelyssälaadittujen selvitysten puutteet <strong>ja</strong> kiinteistöjenkäyttörajoitukset. Korkein hallinto-oikeushylkäsi valitukset 3. 3. 2004.6.9.2 Suunnitellut toimenpiteet<strong>Satama</strong>rata on sähköistetty, kauko-oh<strong>ja</strong>ttu sekä turvalaitteillavarustettu yksiraiteinen tavaraliikennerata,jolla junien nopeus on enintään 80 km/h. Radanpituus on noin 19 km, josta tunneliosuudet ovatyhteensä 14,2 km. <strong>Satama</strong>rata tehdään <strong>satama</strong>n tavarakuljetuksiavarten. Henkilöliikennettä ei radalle tule.Radan liikenne on <strong>satama</strong>n käynnistysvaiheessa 10junaa vuorokaudessa <strong>ja</strong> <strong>satama</strong>n toimiessa täydelläkapasiteetilla 16 –20 junaa vuorokaudessa.<strong>Vuosaaren</strong> 8-raiteinen ratapiha sijoittuu <strong>satama</strong>n<strong>ja</strong> Porvarinlahden väliin Tryvikin pellonlänsipuolelle. Ratapihan pohjoispuolella rata kulkeePorvarinlahden–Mustavuoren Natura-alueenkautta. <strong>Satama</strong>rata ylittää Porvarinlahden sillalla<strong>ja</strong> alittaa Labbackan kallioalueen tunnelissa. Labbackan620 metriä pitkä rautatietunneli lujitetaan <strong>ja</strong>lämpöeristetään koko matkalta. Tunnelin molemmatsuuaukkoalueet <strong>ja</strong> painannealue tunnelin keskiosallasekä pohjoisosan ohut kalliokatto-osuus tiivistetääninjektoimalla. Tiivisteaineena käytetään sementti<strong>ja</strong>/tai polyuretaanipoh<strong>ja</strong>isia viranomaisten hyväksymiätiivistysaineita, jotka ovat turvallisia käytettäväksijopa juomavesisäiliöiden rakenteissa.Labbackan <strong>ja</strong> Porvoonväylän välillä rata seuraapintaratana Kehä III:a <strong>ja</strong> siitä <strong>satama</strong>an rakennettavaauutta <strong>Satama</strong>tietä.Porvoonväylän eteläpuolelta Saviolle rata on pitkässätunnelissa. Tunneliosuus päättyy Savion ete-68MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 6.14<strong>Satama</strong>rata ylittääPorvarinlahden sillalla.Kuva:Ronald Westermarkläpuolella ennen liittymistä päärataan. <strong>Satama</strong>rataliittyy pääradan suunniteltuun 4. lin<strong>ja</strong>raiteeseenSavion aseman eteläpuolella. Savion rautatietunnelinpituus on 13,5 km. Pienimmät kalliokattopaksuudetovat Leppäkorvessa asutun alueen ulkopuolella4,5 metriä. Tunneli lujitetaan koko pituudeltaan <strong>ja</strong>suuaukkoalueet lämpöeristetään noin yhden kilometrinmatkalta. Lämpöeristettyä osuutta voitiinlyhentää tunnelin eteläpäähän sijoittuvan automattisestisulkeutuvan oven avulla. Poh<strong>ja</strong>vesi- <strong>ja</strong> ympäristösyistäsekä rikkonaisen kallion tiivistämiseksiinjektointe<strong>ja</strong> varauduttiin tekemään yhteensä noin5 km:n matkalla.Tunneleissa liikennöidään sähköjunilla, joten liikenteenpäästöt eivät aiheuta ilmanvaihtotarvetta.Junien mukanaan kuljettama ilmapatsas saa aikaanriittävän ilmanvaihdon ratatunnelissa. Ilma tunneleissavaihtuu ratatunneleiden suuaukkojen kautta.Ratatunneliin liittyvät pystykuilut ovat normaaliliikenteenaikana suljetut.Labbackan rautatietunneliin ei rakenneta savunpoistoa,Savion rautatietunnelista savu poistetaanonnettomuustilanteissa erillisillä savunpoistopuhaltimillaratatunnelin suuaukkojen <strong>ja</strong> pystykuilujenkautta.Ratatunnelit valaistaan. Normaalisti valaistustakäytetään vain tunneleiden suuaukkojen läheisyydessäsekä onnettomuus- <strong>ja</strong> huoltotilanteissa.Kaikissa rautatietunnelin liityntäkohdissa maanpintaanon kameravalvontaa <strong>ja</strong> tunneleissa riittävätviestintäyhteydet. Ajotunneleiden pystykuilujenovet varustetaan kulunvalvonnalla. Rautatietunneliinasennetaan hätäpuhelimet <strong>ja</strong> palohälytyspainikkeet.<strong>Satama</strong>n tie- <strong>ja</strong> ratayhteydet rakennetaan yhtenäkokonaisuutena. Massansiirrot on järjestetty koko<strong>satama</strong>hankkeen kannalta edullisimmalla tavalla.80604020PorvoonväylänsuuaukkoHakunilanpystykuiluKaskelanajotunneliSavuverhokiinniPUHALTIMETKÄYTÖSSÄSavuverhoaukiKuninkaanmäenpystykuiluSavuverhoaukiPUHALTIMETKÄYTÖSSÄKuninkaanmäenajotunneliSavuverhokiinniMyraksenpystykuiluJokivarrenajotunnelileppäkorvenpystykuiluSavionsuuaukkoKuva 6.15Savunpoiston järjestelynperiaatekaavio0Ensisi<strong>ja</strong>inenpoistumissuunta4 5 6 7 8 9 10 11 12 13 14 15 16 17 18MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö69


6.9.3 Haitallisten ympäristövaikutustenlieventäminenKuva 6.16Melu <strong>ja</strong> meluntorjunta<strong>satama</strong>n <strong>ja</strong> Porvoonväylänvälillä.Suunnitelmaratkaisu<strong>ja</strong> kehitetäänYleissuunnitelmaa laadittaessa on suunnitelmaratkaisu<strong>ja</strong>kehitetty haitallisten vaikutusten lieventämiseksi<strong>ja</strong> haittojen torjuntaedellytysten parantamiseksimm seuraavilla keinoilla:• Porvarinlahden siltatyypin valinta siten, ettei vesialueelletule välitukia vesialueeseen kohdistuvienvaikutusten pienentämiseksi.• Ratatunnelin sijoittaminen tietunnelin viereenLabbackassa Natura-alueeseen kohdistuvien vaikutusten<strong>ja</strong> poh<strong>ja</strong>vesivaikutusten sekä aluetarpeenpienentämiseksi.• Radan <strong>ja</strong> tien risteämisalueen korkeusasemannostaminen Itäväylän – Gubbackan alueella noin4 m <strong>ja</strong> sijoittaminen lähemmäksi toisiaan poh<strong>ja</strong>vesi-<strong>ja</strong> maisemavaikutusten sekä aluetarpeen pienentämiseksi.• Savion rautatietunnelin lin<strong>ja</strong>uksen täsmentäminensiten, että poh<strong>ja</strong>veden aleneminen voidaan estäämahdollisimman luotettavasti, vaikutusalue jäämahdollisimman suppeaksi <strong>ja</strong> rakentamisen aikaisethaitat jäävät mahdollisimman lyhytaikaisiksi.• Tunnelin si<strong>ja</strong>innin täsmentäminen Leppäkorvenkohdalla siten, että tunneli voidaan toteuttaa kalliotunnelinapäältä avaamatta työaikaisten haittojenpienentämiseksi.dB( A75706560555045 EsteetMelun leviämistä ehkäistäänMelulaskennassa <strong>ja</strong> meluntorjunnan suunnittelussa<strong>satama</strong>rataa <strong>ja</strong> <strong>satama</strong>n tieyhteyttä on käsiteltyyhtenä kokonaisuutena. Valtaosa melusta aiheutuutieliikenteestä. Raideliikenteen aiheuttama melu onmääräävänä vain osalla ratapiha-aluetta <strong>ja</strong> Porvarinlahdenkohdalla, millä alueella <strong>Satama</strong>tie on tunnelissa.Ratapihan melu idän suuntaan torjutaan asemakaavanmukaisesti valleilla. Tie- <strong>ja</strong> raideliikenteestäaiheutuva melualue ei torjuntatoimenpiteiden jälkeenulotu luonnonsuojelualueille eikä asuinalueille.Melu ei myöskään leviä kaavoissa virkistykseen taiulkoiluun tarkoitetuille alueille niin, että se haittaisitai rajoittaisi niiden käyttöä.Porvarinlahden ratasillalla melukaiteen muodostavatsillan kantavaan rakenteeseen kuuluvat reunapalkit.Virkistysalueille valtioneuvoston antamapäivämelutason ohjearvo on 45 dBA <strong>ja</strong> yömelutasonohjearvo 40 dBA. Päivällä 45 dBA ylittävä melualueyltää 30 metrin päähän radan keskiviivasta <strong>ja</strong> yöllä40 dBA ylittävä melualue leviää enimmillään 120 mpäähän radan keskilin<strong>ja</strong>sta. Tämän tasoisen melunei voida katsoa myöskään vaikuttavan olennaisestilintuihin.Österängenin peltoalueella Vikkulan omakotialuepystytään suo<strong>ja</strong>amaan melulta lähes kokonaan meluvalleilla.Junaliikenteen tärinän aiheuttama runkomelunsyntyminen rakennuksissa estetäänLiikkeenä havaittavaa tärinää junaliikenteestä voiaiheutua, jos sekä rata että rakennus on perustettumaan varaan esimerkiksi savikolle. Mikäli joko ratatai rakennus on perustettu kallion varaan, ei havaittavaatärinää pääse syntymään. Näin ollen rautatietunnelinkohdalla ei ole missään riskiä, että junaliikenteenaiheuttama tärinä vahingoittaisi rakennuksiatai ihminen voisi havaita tärinää.Junaliikenteen aiheuttama pieni tärinä voi kuitenkinaiheuttaa häiritsevää runkomelua lähellä rataasi<strong>ja</strong>itsevissa rakennuksissa. Riski runkoäänen syntymisestäon suurin suoraan kallion varaan perustettujenkivi- tai betonirakenteisten kerrostalojen ylimmissäkerroksissa.Runkomelun syntyminen voidaan estää asentamallaratarakenteen <strong>ja</strong> kalliopinnan väliin kumimattotai muu vaimentava materiaali. Yleissuunnitelmassaon varauduttu tärinävaimennukseen kohteissa, missä70MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 6.17Tärinän torjunnantyyppiratkaisuTärinänvaimennusmattojoko nykyisiä asuinrakennuksia tai kaavoissa osoitettu<strong>ja</strong>asuinalueita on niin lähellä rataa, että tärinästäaiheutuvien runkoäänihaittojen syntyminen onmahdollista ilman vaimennustoimenpiteitä.Vaikutukset pinta- <strong>ja</strong> poh<strong>ja</strong>vesiin estetäänPorvarinlahden sillan pilareita ei sijoiteta avoveteen,joten niillä ei ole vaikutusta lahden virtausolosuhteisiin.Ratapiha-alueen, Porvarinlahden sillan <strong>ja</strong> Labbackanrautatietunnelin eteläisen suuaukkoalueenkuivatusvedet johdetaan pois Porvarinlahden valumaalueeltaLabbackan rautatietunnelin <strong>ja</strong> sen pohjoispuolisenpintarataosuuden vedet johdetaan tien kuivatusvesienkanssa padoin varustetun järjestelmänkautta Porvarinlahteen. Mahdolliset pintavesiojiinpäässeet vuodot, esimerkiksi onnettomuustapauksissa,voidaan padota <strong>ja</strong> likaantuneet vedet poistaaennen vesistöön johtamista.Labbackan alueella olevien puustoisten soiden,Kuusijärven <strong>ja</strong> Keravanjoen alituksen kohdalla kalliotunnelitiivistetään esi-injektoinnilla.Poh<strong>ja</strong>veden alenemisen vaikutusalueet ra<strong>ja</strong>taaninjektointitoimenpiteillä enimmillään 100 – 150 metriintunnelin molemmin puolin. Tunneli rakennetaankallion ruhjealueilla tarvittaessa vesitiiviinä tunnelina.L ä h t e e t:1. <strong>Helsingin</strong> <strong>Satama</strong>, Ratahallintokeskus. <strong>Satama</strong>rata. Alustavayleissuunnitelma 1997.2. <strong>Helsingin</strong> <strong>Satama</strong>, Tielaitos. Tieliikennejärjestelyt. Yleissuunnitelma1997.3. <strong>Helsingin</strong> <strong>Satama</strong>, Tielaitos, Ratahallintokeskus. <strong>Vuosaaren</strong><strong>Satama</strong>n <strong>ja</strong> sen maaliikenneyhteyksien meluselvitys1997.4. Insinööritoimisto Paavo Ristola Oy. Ympäristövaikutustenarviointiselostus. <strong>Helsingin</strong> <strong>satama</strong>hanke. <strong>Helsingin</strong>kaupunki 29. 9. 1995.5. Korkeimman hallinto-oikeuden päätös 3. 3. 2004 <strong>satama</strong>radanlunastuslupaa koskevasta valtioneuvoston päätöksestä12. 6. 2003.6. Korkeimman hallinto-oikeuden päätös 3.3.2004 tiesuunnitelmanhyväksymistä koskevasta liikenneministeriönpäätöksestä 3. 2. 2003.7. Liikenneministeriö. <strong>Vuosaaren</strong> <strong>satama</strong>hanke, tutkitutvaihtoehdot. Muistio 8. 11. 19998. Suunnittelukeskus Oy. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksienvaikutusten arviointi. <strong>Helsingin</strong> kaupunginkanslianjulkaisusar<strong>ja</strong> A16/1992, 15. 6. 1992.9. Tiehallinto, Uudenmaan tiepiiri. <strong>Vuosaaren</strong> <strong>satama</strong>nmaaliikenneyhteydet, tiesuunnitelma 30. 4. 2001. HyväksyttyLVM:ssä 3. 2. 200310. Tielaitos, Uudenmaan tiepiiri. <strong>Vuosaaren</strong> <strong>satama</strong>n tieliikennejärjestelyt.Ensimmäisen rakentamisvaiheen ratkaisujensuunnittelu. Helsinki 199811. Uudenmaan ympäristökeskus 13. 3. 1996. Lausuntoympäristövaikutusten arviointiselostuksesta, <strong>Helsingin</strong><strong>satama</strong>hanke.12. Vantaan kaupunki. Kaakkois-Vantaa. Osayleiskaavaehdotuksenselostus 3. 6. 200213. VUOLI-työryhmä. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteydet.Vaihtoehtotarkastelu 26. 10. 1994.14. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneprojekti. <strong>Vuosaaren</strong> <strong>satama</strong>nmaaliikenneyhteydet. <strong>Satama</strong>radan yleissuunnitelma2001.15. <strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneprojekti. <strong>Vuosaaren</strong> <strong>satama</strong>nmaaliikenneyhteydet, <strong>Satama</strong>radan yleissuunnitelma2001, Yleissuunnitelman tarkistus osuudella Kuninkaanmäki– Jokivarsi 2002.16. Ympäristöministeriön päätös 18. 6. 1996. <strong>Helsingin</strong> seudunseutukaava. Taa<strong>ja</strong>ma-alueet, liikenneväylät <strong>ja</strong> -alueet.MAALIIKENNEYHTEYKSIEN SUUNNITTELU<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö71


7Ympäristönäkökulmamaaliikenneyhteyksien rakentamisessa7.1 Ympäristövastuullisuus rakentamisen lähtökohtanaRakennushankkeen menestyksellinen toteuttaminenedellyttää nykyisin ympäristövastuullisuutta <strong>ja</strong>ympäristönäkökohtien huomioon ottamista laa<strong>ja</strong>alaisestihankkeen kaikissa vaiheissa. Liikenneyhteyksienrakentamista on oh<strong>ja</strong>nnut ympäristöönkohdistuvien riskien tunnistaminen <strong>ja</strong> niiden välttäminen.Ennen rakennustöiden aloitusta tehtiin laa<strong>ja</strong> riskikartoitus<strong>ja</strong> sen poh<strong>ja</strong>lta suunnitelma riskien eliminoimiseksi.Tätä suunnitelmaa on päivitetty kolmenkuukauden välein koko rakennusprojektin a<strong>ja</strong>n.Lisäksi erityisesti tunnistetuista riskikohteista ontehty tarkempia vaihtoehtoisia suunnitelmia <strong>ja</strong> toimintamalle<strong>ja</strong>mahdollisten epätoivottujen tapahtumienvaralta.7.2 Tunnelien louhinta7.2.1 Tunnelien lujittaminen<strong>ja</strong> sortumien ehkäisy työn aikanaProjektissa tutkittiin kalliolaatua mahdollisimmanpaljon ennen louhimista sekä louhinnan aikana.Kalliolaatu vaihteli hankkeeseen kuuluvilla tunneliosuuksillahyvin paljon jopa muutaman metrinpituisella tunneliosuudella. Ehjässä hyvälaatuisessakalliossa tunneli on hyvin vakaa <strong>ja</strong> kestää ilman lujituksiasato<strong>ja</strong> vuosia, mutta ruhjeisessa kalliossa tunnelivoi sortua heti räjäytyksen jälkeen.Urakoitsi<strong>ja</strong>n <strong>ja</strong> tilaa<strong>ja</strong>n ammattilaiset tarkastivatjokaisen uuden tunneliosuuden heti räjäytyksen <strong>ja</strong>tyhjennyksen jälkeen sekä päättivät välittömästi tarvittavistalujitustoimenpiteistä. Havaintojen perustellatehtiin myös esilujituksia <strong>ja</strong> lyhennettiin yhdelläkertaa räjäytettävän tunneliosuuden pituutta.Rakentamisen <strong>ja</strong> urakkasopimuksen periaatteenaoli, että tilaa<strong>ja</strong> vastaa kalliolaadusta <strong>ja</strong> tarvittavastalujituksesta. Tästä oli useita etu<strong>ja</strong>. Tilaa<strong>ja</strong>n ei tarvinnutmaksaa turhaan urakkahinnassa sellaisesta riskistämikä ei toteutunut. Tilaa<strong>ja</strong> säilytti tällöin itselläänmyös vallan <strong>ja</strong> vastuun lujitussuunnitteluun <strong>ja</strong>muihin sortumia ehkäiseviin toimiin. Lujitussuunnittelussakäytettiin epävarmoissa kohdissa tavallistasuurempaa varmuuskerrointa. Kaikki kattopinnatvahvistettiin ruiskubetonoinnilla, vaikka kalliolaatuolisi ollut niin hyvää, että alan yleiset ohjeet eivätsitä olisi vaatineet.Tunneli jouduttiin lin<strong>ja</strong>uksensa vuoksi rakentamaanns. Myraksen ruhjeen läpi. Ruhje on reilut200 m pitkä siirrosvyöhyke, jossa alkuperäinen kiviaineson <strong>ja</strong>uhaantunut saveksi joitakin sato<strong>ja</strong> miljooniavuosia sitten. Ruhje oli löydetty jo esisuunnitteluvaiheessa,mutta se oli niin laa<strong>ja</strong>, ettei sitä voinutkiertää. Ruhjeen päällä on 50 metriä paksu jääkaudenmuodostama savikko, jonka varaan on rakennettuLahdenväylä.Myraksen ruhjeen tunnelirakentamista varten olilaadittu erikoissuunnitelma. Urakoitsi<strong>ja</strong>valinnan jälkeensuunnitelmaa vielä hiottiin yhdessä toteuttajienkanssa. Tunnelia louhittiin suunnitelman mukaisestipienissä osissa kerrallaan <strong>ja</strong> louhittu tunneli lujitettiinvälittömästi. Louhittavaa tunnelia myös esilujitettiineteenpäin asennettavilla vaakapulteilla. Jo1. Mittaus2. Tunnusteluporaus3. Esi-injektointi4. Poraus5. PanostusKuva 7.1.Tunnelin louhintaetenee vaiheittain.Vaiheitten pituus riippuukallion laadusta.1 tuntiKuva: Heini Kar<strong>ja</strong>nmaa2–4 tuntia0–16 tuntia4–6 tuntia3–5 tuntia72YMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aPekka Kontiala, DI, on toiminut Vuoli-projektin johta<strong>ja</strong>na vuodesta 2002alkaen. Sitä ennen hän on seurannut hankkeen suunnittelua Uudenmaantiepiirin suunnittelupäällikkönä.tehtyä lujitusta vahvennettiin koko a<strong>ja</strong>n eteenpäinmentäessä. Tunnelin seinien vakavuutta tarkkailtiinmahdollisen ruiskubetonin halkeilun varalta.Ruhje osoittautui niin heikoksi kuin tutkimuksienperusteella oli arvioitukin. Läpäisy onnistui kuitenkintyösuunnitelman mukaisesti. Läpäisyn jälkeenlopullisena lujitusrakenteena rakennettiin massiivinenteräsbetonitunneli kalliotunnelin sisälle. Kalliotunnelinpoikkileikkauksen suuruus on noin 100 m²<strong>ja</strong> korkeus huimat 10 m. Betonitunnelin paksuus onnoin 1 metri. Betonitunnelin valua varten rakennettiinsuuret telineet <strong>ja</strong> tukirakenteet.Toinen haasteellinen kohta oli Labbackan tunnelinpohjoispäässä, missä kalliokaton paksuus pienimmilläänoli 1,5 metriä, yläpuolella Natura-alue <strong>ja</strong>boreaalinen metsäluhta. Eteneminen oli noin 2 metriäviikossa, koska ennen uutta räjäytystä tarvittiinuseita ruiskubetonilujituksia.7.2.2 Louhintavesien käsittelyPoh<strong>ja</strong>veden alaisesta tunnelista joudutaan pumppaamaan<strong>ja</strong>tkuvasti vettä pois. Vesi on sekä tunneliinvaluvaa poh<strong>ja</strong>vettä, että tunnelin poraamiseen tarvittavaavettä. Rakentamisen aikana veteen sekoittuumonia vieraita aineita kuten sementtiä, öljyä <strong>ja</strong>räjähdysaineiden reaktiotuotteita sekä tarkkuuslouhintapatruunoidenpalaneiden muovikuorien jäämiä.Pitoisuudet olivat veden suuresta määrästä johtuensuhteellisen pieniä, mutta vettä ei kuitenkaan voidasuoraan johtaa maastoon.Kaikki tyhjennysvedet joko puhdistettiin tai pumpattiinviemäriin. Ratatunnelin poistovesistä neljänurakka-alueen vedet johdettiin viemäriin <strong>ja</strong> vainyhden urakan vedet puhdistettiin maastossa. Puh-Kuva 7.2.Tunnelinlouhi<strong>ja</strong>tsaivat kokea esteettisiäelämyksiä louhinnanedetessä. Valitettavastikaikki tämä kaunispunainen marmoripeitettiin ruiskubetonillaturvallisuussyistä.Kuva: Timo KotinevaKuva 7.3.Myyraksen ruhjeenbetonitunnelinraudoitusta.Kuva: Jakke HuovinenKuva 7.4.Myyraksen ruhjeenvalmis betonitunneli.Kuva: Jakke Huovinen6. Räjäytys <strong>ja</strong> tuuletus7. Kuormaus8. Rusnaus9. Lujitus(pulttaus <strong>ja</strong> ruiskubetonointi)0,5 tuntia6–7 tuntia1 tunti0–8 tuntiaYMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö73


distamiseen käytettiin kolmea eri periaatetta: kemikalisointia,otsonointia <strong>ja</strong> saostusta. Puhdistuksenjälkeen veden laatua tarkkailtiin laboratoriokokeinennen sen päästämistä ojiin.7.2.3 Melu <strong>ja</strong> tärinäRäjäytys on varsin armoton rakennusmenetelmä,koska se pyrkii rikkomaan kallion lisäksi kaikkeamuutakin ympäristössä. Louhintatärinävahinkojenvälttämiseksi kaikki ympäristön yli 2000 asuntoa <strong>ja</strong>rakennusta katselmoitiin <strong>ja</strong> luokiteltiin tärinälle herkätkohteet. Katselmustulokset luovutettiin urakoitsijoille,jotka suunnittelivat räjäytykset ympäristönehtojen mukaan. Tärinää mitattiin kymmenillä mittareilla,joiden tulokset analysoitiin ennen seuraavaräjäytyssuunnittelua.Varsin haasteellinen ympäristö tärinän kannaltaoli Hakunilan alitus. Siellä kallio oli poikkeuksellisentiivistä <strong>ja</strong> tärinän välittyminen siinä oli jopa 10-kertaista normaaliin verrattuna. Työaiko<strong>ja</strong> jouduttiinrajoittamaan.Asukkaat ilmoittivat usein vaurioepäilyistä, jollointilaa<strong>ja</strong>n asiantunti<strong>ja</strong> kävi tarkistamassa kohteen.Pääasiassa ilmoitukset johtuivat siitä, että ihminentuntee hyvinkin pienen tärinän voimakkaasti <strong>ja</strong>pelästyy, vaikka varsinaista vahinkoa ei rakennuksellesyntyisikään.Melun osalta mittauksia tehtiin kaikissa louhintakohteissalukuisilla mittareilla. Lupaehdoissa olimäärätty työskentelya<strong>ja</strong>t asutuksen läheisyydessä.Lisäksi asukkaiden valitusten perusteella tehtiinmelusta lisämittauksia. Kaikki räjäytystapahtumatkir<strong>ja</strong>ttiin tarkasti työmaapäiväkir<strong>ja</strong>an, josta häiriönaiheutta<strong>ja</strong>t voitiin myös jälkikäteen tarkistaa.7.2.4 Louheen kuljetusLouheen kuljetus tunnelista <strong>satama</strong>an muodosti liikenteellisenriskin alueen asukkaille <strong>ja</strong> tien käyttäjille.Erityisen riskialttiiksi kohdaksi arvioitiinKuusijärven kohta kesäaikana. Louheautot oh<strong>ja</strong>ttiinmahdollisimman suoraan pääteille vaikka pienempiäteitä myöten matka olisikin ollut lyhyempi. Autoissaoli työmaiden tunnisteet <strong>ja</strong> valvo<strong>ja</strong>t seurasivat pistokokeinautojen reittejä. Väärästä reitistä sakotettiinurakoitsi<strong>ja</strong>a. Ajonopeuksien seurantaa varten olikäytössä siirrettäviä nopeusnäyttöjä. Myös poliisivalvoi aktiivisesti lastien kokoa <strong>ja</strong> ajonopeuksia.7.3 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien hallinta7.3.1 TunnelilouhinnatTunneli si<strong>ja</strong>itsee kymmeniä metrejä poh<strong>ja</strong>vedenpinnanalapuolella <strong>ja</strong> paikoin meren alla, joten tunneliinolisi saattanut vuotaa huomattavia määriä vettäkallioraoista. Riskinä oli, että poh<strong>ja</strong>vedenpinta laskee.Suunnittelun lähtökohtana oli, että tunnelirakentaminensuoritetaan siten, että poh<strong>ja</strong>veden pinta eilaske haitallisesti.Tunnelin yläpuolisen poh<strong>ja</strong>veden muodostumat<strong>ja</strong> niiden varaan perustetut rakenteet kartoitettiin.Poh<strong>ja</strong>vesitason seuraamiseksi rakennettiin noin 200tarkkailuputkea, joiden seuranta aloitettiin jo vuonna2001 <strong>ja</strong> tarkkailu <strong>ja</strong>tkuu tunnelin valmistumisen jälkeen.Vuotavan poh<strong>ja</strong>veden määrää mitattiin <strong>ja</strong>tkuvastitunnelissa louhinnan edetessä. Vuotavissatunneliosuuksissa porattiin pitkiä tunnustelureikiä(20 m) eteenpäin, joilla selvitettiin vuoto<strong>ja</strong> vielä louhimattomallatunneliosuudella. Tarvittaessa injektoitiinetukäteen eli pumpattiin sementtiä kallioon vuotojentukkimiseksi.Hankkeeseen kuuluva rautatietunneli kulkee pitkiämatko<strong>ja</strong> sellaisten maapeitteisten alueiden ali,joissa poh<strong>ja</strong>veden lasku voisi aiheuttaa suurta vahinkoakuten teiden, kunnallisteknisten linjojen <strong>ja</strong> talojenpainumista. Alueella on myös runsaasti pieniätalousvesikaivo<strong>ja</strong> sekä joitakin suurehko<strong>ja</strong> vedenottamoita(Fazerila), joihin poh<strong>ja</strong>veden lasku olisivaikuttanut haitallisesti. Poh<strong>ja</strong>veden laskuun varauduttiinrakentamalla erityisiä imeytyskaivo<strong>ja</strong>, joihinimeytettiin tarpeen mukaan vettä poh<strong>ja</strong>veden tasonsäilyttämiseksi. Tunneli tiivistettiin injektoimallavuotavista kohdista.Tunneleista saatiin tehtyä varsin kuivia <strong>ja</strong> vuotovedenmäärä oli vain joitakin litro<strong>ja</strong> minuutissa sadanmetrin tunnelipituudella. Rakennustyön aikana eihavaittu poh<strong>ja</strong>veden laskua eikä muita vahinko<strong>ja</strong>.Labbackan mäessä si<strong>ja</strong>itsevat puustoiset suotaiheuttivat louhinnan aikana varautumisen kuivumisenvaralta. Urakoitsi<strong>ja</strong> oli varautunut imeyttämäänvettä näille alueille, mikäli poh<strong>ja</strong>veden pinnanolisi todettu alentuneen. Louhinta <strong>ja</strong> tunnelin tiivistysonnistui kuitenkin niin hyvin, että näihin toimenpiteisiinei tarvinnut ryhtyä.Va<strong>ja</strong>an puolen kilometrin päässä tunnelista si<strong>ja</strong>itsevaKuusijärvi on erittäin suosittu virkistyskohdeVantaalla. Järvi on siitä erikoinen, että siihen ei virtaamikään joki vaan sen vesitasapaino perustuu74YMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


sadantaan. Täten pieni järvi on erityisen herkkä kuivumiselle,mikäli poh<strong>ja</strong>vettä pääsee virtaamaan tunneliinkalliorako<strong>ja</strong> myöten.Kuusijärven hydrogeologia tutkittiin tarkoin <strong>ja</strong> järven<strong>ja</strong> tunnelin väliin asennettiin useita poh<strong>ja</strong>vedentarkkailuputkia. Tunnelirakentamisen aikana vuotovedenmäärämitattiin tarkasti <strong>ja</strong> pyrittiin havainnoimaan<strong>ja</strong> tukkimaan kaikki vuodot tunnelissa.Kuusijärven vesipinta ei muuttunut tunnelinrakentamisen takia. Itse asiassa kyseinen tunneliosuustukittiin tiiviimmäksi kuin mikään muu osuustunnelista. Onni oli myös rakentajien puolella, koskakalliolaatu osuudella oli tiivis <strong>ja</strong> ehjä.7.3.2 Österängenin paineellinen poh<strong>ja</strong>vesiÖsterängenin alueella oli tutkimuksissa todettu paineellistapoh<strong>ja</strong>vettä, painekorkeus noin 1 –2,5 metriä.Alueelle piti rakentaa pinta-alaltaan 67 000 m²:nsuuruinen paalulaatta, johon tarvittiin noin 160 kmteräsbetonipaalu<strong>ja</strong>. Riskinä oli poh<strong>ja</strong>veden pinnanaleneminen, millä olisi haitallisia vaikutuksia viereiselleomakotialueelle. Paalutuksen aikana tarkkailtiinpoh<strong>ja</strong>veden pinnan tasoa <strong>ja</strong> veden purkautumistapaalujen vartta pitkin. Kaikki alkavat vuotokohdatonnistuttiin tukkimaan eikä painumia tapahtunut.7.3.3 Keravan kaatopaikan valumavedetKeravalla ratatunnelin pohjoispäässä, suuaukonlähistöllä oli entinen, käytöstä jo poistettu kaatopaikka.Riskinä oli, että tunnelin louhinta muuttaapoh<strong>ja</strong>veden virtaussuuntia <strong>ja</strong> samalla kallioperässäliikkuvia haitta-aineita alkaa valua tunneliin. Louhinta<strong>ja</strong> tiivistystyöt onnistuivat kuitenkin niinhyvin, että minkäänlaisia muutoksia virtauksissa eitapahtunut.7.4 Rakentamisen laatu <strong>ja</strong> ympäristön seurantajärjestelmäRakentamisen laatu ei ole itsestään selvyys. Laadunheikentymisen syynä voi olla muun muassa huolimattomuus,kiire, väärin ymmärretyt ohjeet, taloudellisetristiriidat, osaamattomuus, vahingot tai huonotsuunnitelmat.Tilaa<strong>ja</strong>n valvo<strong>ja</strong>t seurasivat rakennustyön laatuasekä <strong>ja</strong>tkuvalla työtapatarkkailulla että moninkokein <strong>ja</strong> mittauksin. Myös urakoitsi<strong>ja</strong>n velvollisuudeksioli asetettu huomattava määrä laadun varmistustoimenpiteitä.Havaitut poikkeamat käsiteltiintyömaakokouksissa.Laadun varmistamiseksi pidettiin urakoitsi<strong>ja</strong>nkanssa määräajoin suunnitelmakatselmuksia, joissaurakoitsi<strong>ja</strong> sai mahdollisuuden esittää omia parannusehdotuksiaantilaa<strong>ja</strong>n suunnitelmille. Monestityön suorittajilta saatiinkin arvokkaita neuvo<strong>ja</strong> laadunvarmistamiseksi <strong>ja</strong> parantamiseksi.Räjäytystyössä on monia asioita, jotka voivatepäonnistua <strong>ja</strong> aiheuttaa vaaraa. Tällaisia tekijöitäovat muun muassa väärä panosmäärä, kalliolaadun<strong>ja</strong>tkuva vaihtelu, inhimilliset erehdykset panostuksessatai nallien viallisuus. Räjäytystöiden suunnitelmattarkistutettiin tilaa<strong>ja</strong>n asiantunti<strong>ja</strong>lla sen jälkeen,kun urakoitsi<strong>ja</strong>n ammattimies oli ne laatinut.Valvo<strong>ja</strong>t arvioivat louhinnan jälkeä, <strong>ja</strong> panostustamuutettiin tarvittaessa.Koska projektissa oli samaan aikaan käytettävissähuomattava määrä louhinnan huippuammattilaisia,oli mahdollisuus kokeilla uutta emulsioräjähdysainetta.Aiemmin sitä oli käytetty vain kaivoksillatäysin erilaisissa olosuhteissa. Urakoitsi<strong>ja</strong> onnistuikokeilussa hyvin <strong>ja</strong> valvojien käsityksen mukaanlopputuotteen laatu jopa parani. Hyvien kokemustenjälkeen emulsion käyttö on nopeasti yleistynyt kalliorakennuskohteissa.Eräs erikoinen yksityiskohtakokeilussa oli se, että VR oli kieltänyt patruunoimattomanräjähdysaineen käytön aiempien huono-Kuva 7.5YIT Rakennus Oy:nkehittämän emulsiopanostuslaitteenprototyyppi työssä.Kuva:Patrik RastenbergerYMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö75


Kuva 7.6Ympäristötietojärjestelmänavullavoitiin antaa reaaliaikaistatietoa työnetenemisestä <strong>ja</strong> seurannoistaeri osapuolille.jen kokemusten perusteella, mutta kun tilaa<strong>ja</strong>n valvo<strong>ja</strong>tasettuivat kokeilun takuumiehiksi, VR myönsikokeilulle poikkeusluvan.Rakennustyön aikana kehitettiin erityinen SpatialWeb-tekniikallatoteutettu interaktiivinen ympäristötietopalvelu(YTP). Sillä voidaan havainnollisestiraportoida hankkeen ympäristöseurannoistakerättyä tietoa sekä hallita <strong>ja</strong> arkistoida niitä. Palvelunavulla voitiin antaa reaaliaikaista tietoa seurannoistarakentajille, valvojille, viranomaisille <strong>ja</strong>asukkaille. Kaikki voivat palvelun avulla myös itsetarkastella tuloksia interaktiivisesti.Ympäristötietopalvelu sisältää ympäristötietojenlisäksi monia muita käyttäjiä palvelevia toiminto<strong>ja</strong>kuten työmaan etenemistiedon, osoitehaun sekämatkan <strong>ja</strong> pinta-alan mittaamisen.7.5 Viranomais- <strong>ja</strong> asukasyhteistyöHyvin hoidetusta yhteistyöstä on paljon hyötyä kaikille.Yhteistyön epäonnistuessa isokin rakennushankevoi takkuilla pahasti.Ympäristöviranomaisten kanssa pidettiin kuukausittainpalaveri, jossa tarkasteltiin seurantojentuloksia <strong>ja</strong> niiden lupaehtojen mukaisuutta. Ympäristöviranomaisillaoli myös pääsy projektin ympäristötietojärjestelmään.Yhteistyö asukkaiden kanssa aloitettiin jo ennenrakentamista laajoilla asukasilloilla, jossa urakoitsi<strong>ja</strong>t<strong>ja</strong> tilaa<strong>ja</strong>n edusta<strong>ja</strong>t kertoivat suunnitelmista,töistä <strong>ja</strong> niiden vaikutuksista ympäristöön. Asukkaatsaivat tilaisuuksissa vapaasti esittää kysymyksiä.Projektissa oli kokopäivätoimisesti tiedotusvastaava,joka vastasi puhelimeen <strong>ja</strong> sähköposteihin.Kaikki kysymykset <strong>ja</strong> vastaukset listattiin <strong>ja</strong> käsiteltiintilaa<strong>ja</strong>n organisaatiossa.Yhteistyö asukasyhdistysten kanssa <strong>ja</strong>tkui kokorakentamisen a<strong>ja</strong>n. Asukasyhdistyksillä oli pääsyprojektin ympäristötietojärjestelmään, mistä voiseurata reaaliaikaisesti töiden etenemistä.Kuva 7.7Vuoropuheluasukkaiden kanssa olivilkasta. Yleisöpäivänä7. 10. 2007 tuhansiaihmisiä tutustuihankkeeseen.Kuva: Juha Kuokkanen/ Illusia.biz76YMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 7.9Tasavallan presidenttiTar<strong>ja</strong> Halonen <strong>ja</strong> tohtoriPentti Arajärvi saapuivat<strong>Vuosaaren</strong> <strong>satama</strong>maan26. 5. 2005 seurassaan<strong>Helsingin</strong> kaupunginvaltuustonpuheenjohta<strong>ja</strong>Rakel Hiltunen<strong>ja</strong> ylipormestariEva-Riitta Siitonen.Kuva:Petri Artturi AsikainenKuva 7.8Eduskunnan puhemies Paavo Lipponen kävi tutustumassa<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen edistymiseen 19. 11. 2004.Kuvassa vasemmalta VUOSA-projektin johta<strong>ja</strong>Antti Mäkinen, Paavo Lipponen, VUOLI-projektin johta<strong>ja</strong>Pekka Kontiala sekä projektipäällikkö Ronald Westermark.Kuva: Jonas Kaiser7.6 TyöturvallisuusRakennustyö sisälsi erityisen paljon turvallisuudenkannalta riskialttiita töitä. Tunnelirakentaminen onväärin suoritettuna hyvin vaarallista työtä.Työturvallisuuteen kiinnitettiin erityistä huomioitakaikkien osapuolten taholta. Tilaa<strong>ja</strong> asetti työturvallisuudenmuiden intressien edelle (aikataulu,kustannukset). Tämä vähensi myös urakoitsi<strong>ja</strong>n tarpeitariskinottoon. Työturvallisuusasiat käsiteltiinaina työmaakokouksessa sekä erillisessä työsuojelupiirinvalvomassa työsuojelutarkastuksessa.Turvallisuuden kannalta on tärkeää henkilöstönosaaminen <strong>ja</strong> motivaatio. Heti projektin alusta astialettiin määrätietoisesti rakentaa tunneliorganisaatiota,johon rekrytoitiin riittävä määrä asiantunti-joita. Hallintoa varten laadittiin vastuu<strong>ja</strong>ot, suunnitelmattiedon <strong>ja</strong>kamiseksi <strong>ja</strong> arkistoimiseksi sekäkokousmenettelyt sille, missä mikin asia käsitellään.Sama tunneliorganisaatio suoritti työn alustaloppuun ilman henkilövaihdoksia.Pelastusviranomaisten kanssa järjestettiin harjoituksiasekä heille laadittiin kartat työmaiden si<strong>ja</strong>inneista<strong>ja</strong> niiden nimistä. Tulipalojen varalta työkohteisiinhankittiin happipullot henkilöstöä varten.Työmaalla ei tapahtunut yhtään erittäin vakavaa(kuolema, pysyvä invaliditeetti) onnettomuutta.Eräitä lievempiä työtapaturmia kylläkin sattui, muttasuhteessa tehtyyn työmäärään hyvin vähän.Kuva 7.10Pyhä Barbara suojelitietunnelin pohjoisellasuuaukolla tunnelinrakentajia.Kuva: Mer<strong>ja</strong> Vilska7.7 Rakentamisen vaikutuksiaLiikenneväylien rakentamiseen liittyi hyvin moniariskikohteita. Huolellisella suunnittelulla <strong>ja</strong> varovaisellaetenemisellä suurilta ongelmilta vältyttiin.Rakentamisen vaikutukset luontoon olivat <strong>ja</strong> ovattulevaisuudessakin hyvin vähäisiä. Ihmisiin rakentamisellaoli melusta <strong>ja</strong> tärinästä johtuvia vaikutuksiarajoitetun a<strong>ja</strong>n. Pysyviä vaurioita ei syntynyt.Kuva 7.11PelastusharjoitusLångmossabergeninajotunnelin suuaukolla14. 9. 2005.Kuva: Juha Kuokkanen/ Illusia.bizL ä h t e e t:1. Sanna Lehtonen. Ympäristöseurantatietojen interaktiivinenraportointi. Insinöörityö <strong>Helsingin</strong> ammattikorkeakouluStadia. 20. 4. 2007.2. Ympäristötietopalvelu. http://map5.centroid.fi/ytp. 29. 3.2007.YMPÄRISTÖNÄKÖKULMA MAALIIKENNEYHTEYKSIEN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö77


8Meriväylän suunnittelu<strong>ja</strong> rakentaminen8.1 Väylävaihtoehdot<strong>Vuosaaren</strong> <strong>satama</strong>an johtavan meriväylän suunnittelukäynnistyi 1990-luvun alussa eri väylävaihtoehto<strong>ja</strong>koskeneella esiselvityksellä. Jo varhaisessasuunnitteluvaiheessa todettiin, ettei <strong>Vuosaaren</strong> telakallejohtanut 7,5 metrin väylä voinut palvella tulevan<strong>satama</strong>n tarpeita, vaan <strong>satama</strong>an tuli rakentaakokonaan uusia väylä. Telakalle johtaneen väylänparantaminen vastaamaan <strong>satama</strong>n liikennetarpeitaolisi ollut merkittävästi kokonaan uutta väylää kalliimpiratkaisu.Uudelle meriväylälle laadittiin yleissuunnitteluvaiheessavuonna 1996 kolme eri vaihtoehtoa:Ulkomatalan, Itä-Tontun <strong>ja</strong> Isosaaren vaihtoehdot.Laadittujen suunnitelmien toimivuutta tarkasteltiinsimulaattoritutkimuksissa, joiden perusteella Ulkomatalanlin<strong>ja</strong>usvaihtoehdon todettiin olevan navigoitavuudeltaanselvästi huonoin. Isosaaren vaihtoehtooli taasen erittäin ongelmallinen puolustusvoimientoiminnan kannalta, sillä se kulki suoraan Isosaareneteläpuolisen ampuma-alueen halki. Vaihtoehdoistakallein, Itä-Tontun lin<strong>ja</strong>usvaihtoehto todettiin tarkasteluissaparhaaksi vaihtoehdoksi. Itä-Tontun lin<strong>ja</strong>usvaihtoehdonkustannusarvio oli 70 milj. mk, kunmuiden väylävaihtoehtojen kustannusarviot olivatnoin 30 milj. mk. Selvitysten perusteella Itä-Tontunlin<strong>ja</strong>usvaihtoehto valittiin väylän <strong>ja</strong>tkosuunnittelunperustaksi.Isosaarenlin<strong>ja</strong>usIsosaariKuva 8.1.Tutkitut vaihtoehdotVUOSAARILänsi-TonttuItä-Tontunlin<strong>ja</strong>usMusta HevonenKuivaHevonenEestiluotoItä-TonttuUlkomatalanlin<strong>ja</strong>usUlkomatala8.2 Väyläsuunnitelma8.2.1 MitoitusalusVäylän mitoitusalukseksi valittiin suurin väylää normaalistikäyttävä valtameriliikenteeseen soveltuvakonttialus, jonka päämitat ovat:Syväys, t = 11,0 mPituus, L = 230 mLeveys, b = 33 mVuoden 1996 suunnitelmassa tarkasteltiin väylänmitoitusta lisäksi väylää useimmin käyttävän Roroaluksenmukaisesti. Tämän aluksen mitat ovat:Syväys, t = 7,4 mPituus, L = 183 mLeveys, b = 28,7 m.8.2.2 MitoitusvaihtoehdotVäylän mitoitus perustuu Merenkulkulaitoksen Laivaväyliensuunnitteluohjeisiin. Väyläsuunnitelmaa koskeviasimulaattoritutkimuksia täydennettiin väylänpohjoisosaa <strong>ja</strong> <strong>satama</strong>a koskeneilla tutkimuksilla,joilla voitiin muun muassa varmistaa alusten turvallinennavigoitavuus Pikku Niinisaaren kohdallaolevassa jyrkähkössä mutkassa. Väylänsuunnitteluohjeidenmukaisesti yksikaistaisen väylän minimileveydeksion suositeltu 4–5 kertaa mitoitusaluksenleveys. Yksikaistaista väyläosuutta oli suunnitelmassa36 kilometriä pitkällä väylällä n. 5 km. Ulko-osallaväylä oli suunniteltu jopa n. 2,5 kilometriä leveäksi.78MERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aOlli Holm, DI, työskentelee Merenkulkulaitoksessa Väylänpidossavastuualueenaan väylätoiminnan kehittäminen, TTS-koordinointi <strong>ja</strong>ympäristöasiat. Hän toimii myös Merenkulkulaitoksen ympäristökoordinaattorina.<strong>Vuosaaren</strong> väyläprojektissa hän on osallistunut väylänsuunnitteluun, lupa-asioiden hoitoon <strong>ja</strong> rakentamisen valmisteluun.Suunnittelussa tarkasteltiin tarkemmin kahtavaihtoehtoa. Perusvaihtoehdossa <strong>Vuosaaren</strong> väylälläminimileveys oli 150 metriä, joka on 4,5 kertaamitoitusaluksen leveys. 150 metrin väylänleveydentoimivuus oli varmistettu vuoden 1996 simulaattoriajolla.Vaihtoehdossa B minimileveys oli 200 metriä.Minimileveys Bmin = 150 m (4,5*b), PerusvaihtoehtoBmin = 200 m (6,0*b), Vaihtoehto BVäylää useimmin käyttävän aluksen mukaisesti väylänleveys oli perusvaihtoehdossa 5,2*b <strong>ja</strong> B-vaihtoehdossa7,0*b.Väylien minimikaarresuositus on 5– 10 kertaaaluspituus (L). <strong>Vuosaaren</strong> väylän suunniteltu minimikaarresädeoli molemmissa vaihtoehdoissa 1500 metriä,mikä vastaa 6,5 kertaa mitoitusaluksen pituutta.Väylää useimmin käyttävälle alukselle minimikaarresädeoli 8,2*L.Vuoden 1996 suunnitelmassa väylän kulkusyvyydeksioli valittu 11.0 m <strong>ja</strong> haraussyvyydeksi –13,0 mMW2000. Kahden metrin varaveden katsottiin tällöinmuodostuvan kölivarasta (0,5 m), vedenkorkeudenvaihtelusta johtuvasta varmuudesta (0,5 m) <strong>ja</strong>aaltoilusta sekä nopeuspainumasta johtuvasta turvamarginaalista(1,0 m). Tarkemassa väyläsuunnittelussaperusvaihtoehdossa käytettiin haraussyvyytenäaikaisemman suunnitelman mukaista –13,0 metriä.Naantalin väylällä tehtyjen nopeuspainumamittaustenperusteella oli vaihtoehdossa B esitettyharaussyvyydeksi –12,5 m MW2000. Aluksennopeuspainumalaskennan perusteella mitoitusaluksennopeuspainuma oli 11 solmun nopeudella allemetri, <strong>ja</strong> 9 solmun nopeudella n. 0,5 metriä. Naantalinväylän tutkimusten perusteella nämä arvot olivattodennäköisesti varmalla puolella. Suurin nopeuspainumasaavutettaneen Krokholmenin kohdallaolevalla kohteella RK 3, jossa väylä on minimilevyinen<strong>ja</strong> molemmilla puolilla väylää on luiskat. Tässäkohteessa aluksen nopeuspainumaa arvioitiin väyläleveydellä150 metriä <strong>ja</strong> haraussyvyydellä –12,50 mMW2000. Laskelmien perusteella voitiin arvioida,että 10 solmun nopeudella aluksen painuma olisinoin 85 cm.Nopeuspainumalaskennan perusteella käytettiinvaraveden arvona 1,5 metriä. Väylälle oli tällöin asetettavayli 10,5 metrin kulkusyvyisille aluksille 10solmun nopeusrajoitus Östra Rödhällenistä sisäänpäin.Vedenkorkeuden ollessa 50 cm miinuksellatulisi nopeusrajoituksen olla 8 solmua.Kulkusyvyys KS = 11,0 m.Haraussyvyys HS = –13,0 m MW2000, PerusvaihtoehtoHS = –12,5 m MW2000, Vaihtoehto BVäylän sisäosalle Mustan Hevosen länsipuolelle olisuunniteltu ankkurointi- <strong>ja</strong> odotusalue. Alue ulottuukummallekin puolelle väylää. Väylän sisäosallatämä kohta oli ainoa, jossa alukset voivat kohdatatoisensa. Pyrkimyksenä oli ollut ottaa käyttöön mahdollisimmanlaa<strong>ja</strong> täyssyvä vesialue, jotta aluksillaolisi tuulisissakin olosuhteissa mahdollisuus odottaaväylän vapautumista. Ankkurialueen keskelläoleva, noin –3 metriin nouseva kalliomatala (RK 2)oli perusvaihtoehdossa esitetty jätettäväksi osittainruoppaamatta, koska kustannusten katsottiin nousevanliian suuriksi. Vaihtoehdossa B oli esitettytämän matalan poistamista haraussyvyydellä –12,5metriä, jolloin alueen käytettävyys olisi huomattavastiperussuunnitelmaa parempi.Lopulliseksi toteutettavaksi suunnitelmaksi valittiinpääosin väylän tulevien käyttäjien kommenttienpoh<strong>ja</strong>lta vaihtoehdon B mukainen suunnitelmavaihtoehto.Toteutettavaksi valitun väylävaihtoehdon kustannusarviooli noin 16 milj. euroa.8.2.3 RuoppauksetVäylällä oli yhteensä kuusi ruoppauskohdetta, jotkakaikki sijoittuivat väylän sisäosalle kaukaisimmankohteen ollessa noin kahdeksan kilometrin päässä<strong>satama</strong>sta. Kaikkiaan ruopattavia masso<strong>ja</strong> oliyhteensä noin 670 000 m³ktr, joista pääosa oli kallio-<strong>ja</strong> moreenimasso<strong>ja</strong>, joita voitiin käyttää hyväksi<strong>satama</strong>n täyttöihin.MERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö79


Taulukko 8.1RuoppausmäärätkohteittainKohde (paaluväli) Arvioitu maalaji m³ktrRK0 Mr 160Ka 119 502RK1Mr 31 818Sr/Hk 37 086Sa/Si 8 817Ka 119 328RK2Mr 51 575Sr/Hk 56 248Ka 60RK3Sr/Hk 27 200Sa/Si 168 740Ka 14 370RK4aMr 7 006Sr/Hk 3 200Sa/Si 4 220RK4b Sr/Hk 21 788Yhteensä: 671118RK4a <strong>ja</strong> 4bmaa 42 000 m³kallio 15 000 m³RK3maa 148 000 m³kallio 100 m³RK2maa 107 000 m³kallio 116 000 m³8.2.4 Väylän merkintäVäylän merkinnässä suunniteltiin käytettäväksisekä kelluvia että kiinteitä turvalaitteita. Väylälin<strong>ja</strong>tsuunniteltiin merkittäväksi maalle sijoitetuin lin<strong>ja</strong>merkein,<strong>ja</strong> lisäksi väylän ulko-osalle, joka on liikkuvienjäiden alueella, suunniteltiin yhteensä neljänkiinteän reunamerkin rakentamista. Kiinteidenmerkkien lisäksi väyläalueen merkinnässä suunniteltiinkäytettäväksi 23 valojääpoijua <strong>ja</strong> poijuviittaasekä kahta maalle sijoitettua tutkamerkkiä.(9.0)0 1 2 kmKuva 8.2RuoppauskohteetRK1maa 69 000 m³kallio 125 000 m³(9.0)Ruoppausmäärät yht.maa 367 000 m³kallio 225 000 m³8.3 LupakäsittelyRinnan teknisen suunnittelun kanssa oli käynnissäväylän rakentamisen vesilain mukainen lupakäsittelyyhdessä <strong>satama</strong>hankkeen kanssa. Lupahakemusperustui vuonna 1996 laadittuun yleissuunnitelmaan,joten <strong>ja</strong>tkosuunnittelun aikana tehdyille väyläsuunnitelmanmuutoksille jouduttiin hakemaan lupapäätöksenmuutosta rakennustöiden aikana. Väylän merkintääntehtiin myös hankkeen aikana muutos. Yhdestäkiinteästä reunamerkistä luovuttiin, koska se si<strong>ja</strong>itsipuolustusvoimien ampuma-alueella. Reunamerkinrakentamisen si<strong>ja</strong>sta suunniteltiin väylän ulko-osallasi<strong>ja</strong>itsevan väylän ulkopuolisen matalikon ruoppaamista,mikä edellytti myös ympäristöviraston lupaa.Lupa ruoppaukselle haettiin <strong>ja</strong> saatiinkin, muttaruoppauksesta luovuttiin sen kustannusten noustuakohtuuttomiksi.<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> meriväylän vesilain mukaisenhakemuksen tekeminen yhtenä hakemuksenajohti siihen, ettei lupaa väylän rakentamiselle voitukäytännössä antaa ennen kuin koko <strong>satama</strong>n raken-tamista koskeneet kaavoitus- ym. valitukset oli ratkaistu.Länsi-Suomen ympäristölupavirasto antoivesilain mukaisen luvan väylän <strong>ja</strong> <strong>satama</strong>n vesirakennustöidentoteuttamiseen 9. 7. 1998. Päätöksestätehtiin useita valituksia Vaasan hallinto-oikeuteen,joka antoi luvan rakennustöiden toteutukseen24. 2. 2000. Vaasan hallinto-oikeuden päätöksestävalitettiin edelleen valituslupahakemuksen kauttakorkeimpaan hallinto-oikeuteen. Korkein hallintooikeusmyönsi alueen kaavoitusta koskevien päätöstensäjälkeen 24. 10. 2002 luvan väylän <strong>ja</strong> <strong>satama</strong>nvesirakennustöiden toteuttamiseen. Väylän toteutuksenvalmistelu päästiin siten käynnistämään talvella2002–2003.Töiden toteutus edellytti vielä meluilmoituksenjättämistä Sipoon ympäristöviranomaisille, mikä onvarsin poikkeuksellinen menettely väyläruoppauksissa.Ilmoitus jätettiin huhtikuussa 2003, <strong>ja</strong> Sipoonkunnan päätös saatiin 6. 11. 2003. Päätöksen asettamatmelurajoitukset olisivat käytännössä estäneet80MERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


väylän rakentamiseen ruoppaustyöt Pikku Niinisaarenkohdalta, joten päätöksestä valitettiin Vaasanhallinto-oikeuteen. Ruoppaustöistä aiheutuvallemelulle oli päätöksessä asetettu seuraavat rajoitukset:”Ruoppaus-, poraus- <strong>ja</strong> räjäytystyöt <strong>Vuosaaren</strong> väylälläon toteutettava niin, etteivät ne aiheuta melutason 55 dB(LAeq) ylityksiä klo 07.00 – 22.00 <strong>ja</strong> 50 dB (LAeq) ylityksiäklo 22.00 – 07.00 lähellä olevilla asuin- <strong>ja</strong> vapaa-a<strong>ja</strong>nkiinteistöillä.Juhannuksesta alkaen <strong>ja</strong> heinäkuun loppuuntöiden aiheuttamat melutasojen ei tule ylittää 45dB (LAeq) klo 22.00 – 07.00 lähellä olevilla asuin- <strong>ja</strong> vapaaa<strong>ja</strong>nkiinteistöillä.”Vaasan hallinto-oikeus antoi päätöksensä 8. 6.2005. Päätöksessä lievennettiin melurajoituksiajonkin verran, mutta yhä edelleen ruoppaustöidentoteuttaminen olisi ollut käytännössä mahdotontaPikku Niinisaarta lähinnä olleessa ruoppauskohteessa.Korkein hallinto-oikeus antoi päätöksensäasiassa 24. 5. 2005 <strong>ja</strong> hylkäsi tehdyt valitukset. KoskaPikku Niinisaaren alueen ruoppaukset <strong>ja</strong> niiden vaikutuksetulottuivat meluilmoituksen täydennyksenperusteella Sipoon lisäksi <strong>Helsingin</strong> puolelle, korkeinhallinto-oikeus siirsi asian Uudenmaan ympäristökeskuksenpäätettäväksi. Väylän ruoppaustyötoli jo kuitenkin saatettu kokonaan loppuun kesän2005 aikana, joten ympäristökeskus teki päätöksenilmoituksen raukeamisesta 8. 11. 2005.8.4 Hankkeen toteutusTarkemman rakennussuunnittelun myötä hankkeenruoppausmääräksi täsmentyi noin 700 000 m³ktr.Hankkeen toteutuksesta järjestettiin EU:n laajuinentarjouskysely. Ruoppaustyöt käynnistyivät keväällä2004 <strong>ja</strong> valmistuivat vuonna 2005. Ruoppaustyötsujuivat pääosin suunnitelmien mukaan, sillä väylänruoppauskohteissa ei ollut merkittäviä haitallistenaineiden pitoisuuksia, jotka keskeyttivät <strong>satama</strong>nruoppaustyöt joksikin aikaa. Yhdellä ruoppauskohteellatodettiin kalliopinnan olevan poh<strong>ja</strong>tutkimustentuloksia korkeammalla, joten siitä aiheutui urakoitsi<strong>ja</strong>llekorvattava lisätyötä.Merimerkkien pystytys toteutettiin kesällä 2006.Merkittävän osan alusliikenteen turvallisuuteen tähtäävistätoimenpiteitä muodostaa väylän liikennettäseuraava <strong>ja</strong> tarvittaessa ohjeita antava VTS. Liikenteenvalvonta tapahtuu <strong>Helsingin</strong> VTS-keskuksesta.<strong>Vuosaaren</strong> väylän saaminen VTS-valvonnanpiiriin edellytti kahden tutkan rakentamista väylänvarrelle Eestinluotoon <strong>ja</strong> <strong>satama</strong>an sekä tarvittavientietoliikenneyhteyksien rakentamista. Samaanaikaan toteutettiin myös turvalaitteiden sähköistystyöt,joten valmis meriväylä saatettiin avata virallisestiliikenteelle joulukuussa 2007. Vuonna 2008luovuttiin vielä edellä mainitusta väylän ulko-osanulkopuolelle olevan matalan ruoppauksesta, <strong>ja</strong> merkittiinmatalikko kelluvalla merkillä. Väylähankkeenkokonaiskustannuksiksi muodostui yhteensä noin 12milj. euroa ilman arvonlisäveroa, joten alkuperäinenkustannusarvio alittui selkeästi.Kuva 8.3Ruoppaa<strong>ja</strong> meriväylälläsyyskuussa 2004.Kuva: <strong>Vuosaaren</strong><strong>satama</strong>n mediapankkiKuva 8.4Rajäytyksiä meriväylällä,vesipatsas kesäkuussa2005.Kuva: <strong>Vuosaaren</strong><strong>satama</strong>n mediapankkiKuva 8.5Reunamerkin asennuksenvalmisteluaheinäkuussa 2006.Kuva: Illusia.bizMERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö81


8.5 Väylän turvallisuus <strong>ja</strong> navigoitavuusKoko <strong>Vuosaaren</strong> väylähankkeen a<strong>ja</strong>n on aika ajoinnostettu esiin kysymyksiä väylän turvallisuudesta,navigoitavuudesta <strong>ja</strong> liikenteen ruuhkautumisesta.<strong>Vuosaaren</strong> väylä on lin<strong>ja</strong>ukseltaan hyvin suora verrattunauseimpiin muihin rannikkoväyliimme. Suoralin<strong>ja</strong>us helpottaa navigointia väylällä. <strong>Vuosaaren</strong>väylä vastaa mitoitukseltaan Suomen rannikon satamienmuita sisääntuloväyliä.<strong>Vuosaaren</strong> väylää suunniteltaessa on asiantuntijoinakäytetty mm. luotse<strong>ja</strong>. Väylällä tehtiin simulaattorikokeitayleissuunnitelman <strong>ja</strong> lin<strong>ja</strong>usvaihtoehtojenselvittämisen yhteydessä vuosina 1995–96.Simulointe<strong>ja</strong> on täydennetty 1999 siten, että malliinotettiin mukaan myös <strong>satama</strong>-alue. Viimeisessäsimuloinnissa keskityttiin nimenomaan väylän sisäosannavigoinnin <strong>ja</strong> <strong>satama</strong>operoinnin testaamiseeneri tuuliolosuhteissa <strong>ja</strong> eri alustyypeillä.<strong>Vuosaaren</strong> <strong>satama</strong> on si<strong>ja</strong>inniltaan melko avoinlounaan puoleisille tuulille. Lounaistuulet ovat <strong>Helsingin</strong>edustalla kaikkein yleisimpiä. Kovista lounaistuulistasaattaa <strong>satama</strong>lle <strong>ja</strong> väylälle johtua ope-rationaalisia rajoituksia, mutta tämä on Suomenolosuhteissa normaalia. Vastaavasti väylän käyttöäkaikkein vaikeimmissa jääoloissa ei voida taata sataprosenttisesti,mutta myöskään tämä ei ole missäännimessä ennenkuulumatonta Suomessa.Liikenteen sujuvuuden varmistamiseksi onsovittu myös menettelyistä, joita VTS-keskus noudattaaliikenteen oh<strong>ja</strong>uksessa. Liikennemäärien tulevaisuudenhuomattavan kasvun varalta Merenkulkulaitoson valmistellut suunnitelman, jonka avullakaksisuuntainen liikenne <strong>satama</strong>an on mahdollistavanhaa <strong>Vuosaaren</strong> telakan väylää hyödyntäen. Väylänparantamisen kustannuksiksi on arvioitu noin 12milj. euroa. <strong>Satama</strong>n tuleva liikennemäärä ei vieläkuitenkaan edellytä tämän väyläyhteyden toteuttamistatässä vaiheessa.Kaiken kaikkiaan voidaan todeta, että <strong>Vuosaaren</strong>väylä on perushyvä suomalainen meriväylä, jokaon suunniteltu voimassa olevien väylänsuunnitteluohjeidenmukaan <strong>ja</strong> täyttää yleisesti hyväksytyt kansalliset<strong>ja</strong> kansainväliset kriteerit.8.6 Väylän käytön aikaiset ympäristövaikutuksetUuden väylän käyttöönoton <strong>ja</strong> alusliikenteen siirtymisenuudelle väylälle oli useissa kannanotoissaesitetty aiheuttavan huomattava haittaa väylän lähiympäristössä<strong>ja</strong> estävän kalastusta alueella. Alustenaiheuttaman aallokon epäiltiin aiheuttavan rantaeroosiota<strong>ja</strong> rikkovan laitureita. Alusten esitettiinaiheuttavan myös meluhaittaa alueella.Uuden väylän perustaminen estää kalastamisenväyläalueella kiintein pyydyksin. Täten <strong>Vuosaaren</strong>väyläksi määrätyllä väyläalueella ei voi kalastaa esimerkiksiverkoilla, mutta sen si<strong>ja</strong>an uistelu ym. muukuin kiintein pyydyksin tapahtuva kalastus on sallittua.Alueen kalastus on pääosin vapaa-a<strong>ja</strong>n kalastusta,sekä muutaman ammattikalasta<strong>ja</strong>n väylänlähettyvillä, lähinnä Skatanselällä <strong>ja</strong> Granön ympäristössätapahtuvaa suomukalojen verkkokalastusta.Alusliikenteen aiheuttama haitta kalastukselle onsiten varsin vähäistä. Väylällä tapahtuva liikenne voiheikentää kalojen lisääntymistä väylän välittömässäläheisyydessä, mutta mahdollisesta vaikutuksesta eiole olemassa kattavia tutkimuksia lukuun ottamattasilakan lisääntymistä Airiston alueella. Siellä alusliikenteenon havaittu heikentävän silakan lisääntymistäväylän lähialueella. <strong>Vuosaaren</strong> väylän alueellaon kuitenkin varsin runsaasti kalojen lisääntymisalueita,joihin liikenteen vaikutus ei tule ulottumaan,joten liikenteen aiheuttamat haitat kalojen lisääntymiselleovat vähäisiä.Alusliikenteen aiheuttamaa aallokkoa on tutkittuAiriston alueella. Mittauksissa havaittiin alustenaiheuttaman aallon 50 metrin päässä väylältä vaihtelevan10 cm:stä 50 cm:iin alustyypin <strong>ja</strong> aluksenkäyttämän nopeuden mukaan. <strong>Vuosaaren</strong> väylälläalusten käyttämä nopeus väylän sisäosalla on 10 –15solmua, jolloin alusten aiheuttaman aallokon korkeuson 10 –30 cm, mikä ei ylitä normaalin tuulenaiheuttaman aallokon korkeutta. Siten alusten aiheuttamallaaallokolla ei ole haitallisia vaikutuksia väylänlähialueella.Alusten aiheuttamasta melusta ei ole kattavia selvityksiä,mutta yleensä melu on katsottu voimakkuudeltaanvähäiseksi <strong>ja</strong> lyhytkestoiseksi, <strong>ja</strong> merkittävyydeltäänhuomattavasti <strong>satama</strong>toimintojenaiheuttamaa melua vähäisemmäksi. Merkittävimmäksivesiliikenteen aiheuttamaksi meluhaitaksionkin katsottu veneily <strong>ja</strong> erityisesti vesiskootterit.<strong>Vuosaaren</strong> väylän rakentamisella ei ole vaikutustatähän liikenteeseen.82MERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 8.6Finnlinesin ropax-alusM/S Finnstar koeajoi<strong>Vuosaaren</strong> uudenmeriväylän 21. 7. 2008.Kuva: <strong>Vuosaaren</strong><strong>satama</strong>n mediapankkiKuva 8.7<strong>Vuosaaren</strong> meriväylänvalojääpoiju<strong>ja</strong>.Kuva: Leif Rosas/ Redstar PhotoagencyL ä h t e e t1. Länsi-Suomen vesioikeuden päätös 9. 7. 1998 n:o 48–52/1998/32. Vaasan hallinto-oikeuden päätös 24. 2. 2000 n:o 00/0010/23. Korkeimman hallinto-oikeuden päätös 24. 10. 2002 n:o2002:644. Sipoon kunnan ympäristösihteerin päätös tilapäistä meluakoskevasta ilmoituksesta 6. 11. 20035. Vaasan hallinto-oikeuden päätös tilapäistä melua koskevastailmoituksesta 8. 6. 2004 n:o 04/0183/36. Korkeimman hallinto-oikeuden päätös tilapäistä meluakoskevasta ilmoituksesta 21. 10. 2005 n:o 26957. Uudenmaan ympäristökeskuksen päätös tilapäistä meluakoskevan ilmoituksen raukeamisesta 8. 11. 2005 n:o YS14778. VTT, 2000b. Laivojen aiheuttama aalto- <strong>ja</strong> virtaushäiriörannassa. Aalto- <strong>ja</strong> virtausmittaukset Airistolla 2.– 5. 5.2000. Tutkimusraportti BVAL34-001016. VTT Valmistustekniikka2001.9. Merenkulkulaitos, Väylänpito. <strong>Vuosaaren</strong> väylän tarkennettuyleissuunnitelma 2001.10. <strong>Vuosaaren</strong> <strong>satama</strong>hanke. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseurantaraportit 2003–2006.MERIVÄYLÄN SUUNNITTELU JA RAKENTAMINEN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö83


9<strong>Satama</strong>-alueen merenpoh<strong>ja</strong>npuhdistaminen TBT:stä9.1 <strong>Satama</strong>n rakentamisen edellyttämät ruoppaukset<strong>Vuosaaren</strong> <strong>satama</strong>n rakentaminen käynnistyi vuoden2003 alussa. <strong>Satama</strong> on rakennettu osin entiselle<strong>Vuosaaren</strong> telakka-alueelle, osin Niinilahden,Käärmeniemen <strong>ja</strong> Lehdessaaren päälle <strong>ja</strong> osin entisentelakka-alueen edustalle mereen tehdyille täytöille.<strong>Satama</strong>n rakentaminen vaati noin 90 hehtaarintäyttämistä merestä (kuva 9.1). Täyttöjen toteuttamistavarten <strong>satama</strong>n itä- <strong>ja</strong> länsiosan täyttöalueidenkohdalta oli poistettava pehmeät savikerrokset <strong>ja</strong> laiturilinjojenkohdalta myös silttikerros ruoppaamalla.Tämän lisäksi <strong>satama</strong>n vesiliikennealue oli syvennettäväruoppaamalla haraussyvyyteen, joka on pääosin12,5 m (MW). <strong>Satama</strong>sta <strong>ja</strong> <strong>satama</strong>n vesiliikennealueeltaon jouduttu poistamaan pehmeitä masso<strong>ja</strong>ruoppaamalla kaikkiaan n. 5,4 miljoonaa m³.Kuva 9.1<strong>Vuosaaren</strong> <strong>satama</strong>nrakentamisenlähtötilanne vuoden2003 alussa.RuusuniemiNiinilahtiTelakka-alueTelakka-allasKalkkisaarenselkä<strong>Vuosaaren</strong>lahti<strong>Vuosaaren</strong>lahdenvene<strong>satama</strong>LehdessaariKäärmeniemiVarissaariKalkkisaari<strong>Satama</strong>allasKäringholmenPikkuNiinisaari9.2 <strong>Satama</strong>n <strong>ja</strong> väylän vesilupa 1998 <strong>ja</strong> TBT:n esillenousu<strong>Satama</strong>n <strong>ja</strong> väylän rakentamista koskevassa, Länsi-Suomen vesioikeuden vuonna 1998 antamassa vesiluvassa[1], joka tuli lainvoimaiseksi 24. 10. 2002, olimäärätty, että ruopattavien massojen laatu on tutkittavakussakin ruoppauskohteessa ennen ruoppaustyöhönryhtymistä Uudenmaan ympäristökeskuksenhyväksymällä tavalla. Keväällä 2003 Uudenmaanympäristökeskus edellytti mm. Suomen ympäristökeskuksessavalmistellun ruoppausmassojen läjityskelpoisuuttakoskevan hallinnollisen ohjeluonnoksen28. 2. 2003 [2] no<strong>ja</strong>lla, että ruopattavista massoistaoli tutkittava myös tributyylitinan eli TBT:n pitoisuudet.Suomessa ei ollut tällöin ainoatakaan laboratoriota,joka olisi tehnyt TBT-määrityksiä.TBT on orgaaninen tinayhdiste, jota on käytettymm. alusten poh<strong>ja</strong>maaleissa eli antifoulingmaaleissatehoaineena estämässä kasvillisuuden <strong>ja</strong>pieneliöiden kiinnittyminen veneen tai laivan poh<strong>ja</strong>an.Varsinaisen käyttötarkoituksensa ohella TBT:non todettu aiheuttavan lisääntymis- <strong>ja</strong> kasvuhäiriöitäerityisesti tietyissä vesieliöryhmissä, kuten kotiloissa<strong>ja</strong> simpukoissa. Korkeammille eliöille, kutennisäkkäille, sekä maaekosysteemissä TBT:n haitallisuudenon arvioitu olevan suhteellisen vähäistä.Orgaaniset tinayhdisteet eivät ole erityisen kertyviäravintoketjussa <strong>ja</strong> ne hajoavat luonnossa haitattomammiksiyhdisteiksi mm. valon <strong>ja</strong> bakteeritoiminnanseurauksena. Todettujen haitallisten vesiekosysteemivaikutustenvuoksi orgaanisten tinayhdisteidenkäyttö aluksissa kiellettiin EU-jäsenmaissa vuonna2003. Kaikissa kansainvälisen merenkulkujärjestön(IMO) jäsenmaissa orgaanisten tinayhdisteidenkäyttökielto aluksissa on astunut voimaan vuonna2008.Suomen ympäristökeskuksessa valmistellussahallinnollisessa ohjeluonnoksessa 28. 2. 2003 oli esitettyalustavasti, että standardisedimentin pitoisuudeksimuutetun eli normalisoidun TBT-pitoisuudenollessa enintään 3 μg/kg kuiva-aineessa (jäljempänäk.a.) ruopattava sedimentti luokitellaan haitatto-84SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aAri Piispanen, MMM (limnologia), työskentelee Ramboll FinlandOy:ssä. Hän toimi <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamisprojektinvesi- <strong>ja</strong> ympäristölupa-asioiden asiantunti<strong>ja</strong>na.maksi <strong>ja</strong> vesistöön läjityskelpoiseksi. NormalisoidunTBT-pitoisuuden ollessa yli 200 μg/kg k.a. ruopattavasedimentti luokitellaan saastuneeksi <strong>ja</strong> periaatteessavesistöön läjityskelvottomaksi. Edellä mainittujenpitoisuuksien välillä ruopattava sedimenttiluokitellaan likaantuneeksi <strong>ja</strong> sedimentin haitallisuus<strong>ja</strong> läjityskelpoisuus vesistöön tulee selvittäätapauskohtaisesti.9.3 TBT <strong>satama</strong>-alueen sedimenteissäKeväällä 2003, kun <strong>satama</strong>n rakentamisalueen poh<strong>ja</strong>sedimentistäoli otettu vesiluvan mukaiset sedimenttinäytteet<strong>ja</strong> <strong>satama</strong>n rakentamiseen liittyvätruoppaukset olivat jo käynnistyneet Niinilahdessa,saksalaisessa laboratoriossa analysoitujen sedimenttinäytteidenanalyysitulokset osoittivat, ettäsuunnitellulla ruoppausalueella esiintyi kohonneita,hallinnollisessa ohjeluonnoksessa 28. 2. 2003 esitetynhaitattoman tason ylittäviä TBT-pitoisuuksia.Uudenmaan ympäristökeskus kielsi ruoppaustöidentoteuttamisen <strong>ja</strong> edellytti <strong>Helsingin</strong> <strong>Satama</strong>ltalisäselvityksiä ruopattavan alueen sedimentin TBTpitoisuuksista.Kohonneiden TBT-pitoisuuksien löytyminenkäynnisti laa<strong>ja</strong>t lisätutkimukset, jotka osoittivat,että <strong>Vuosaaren</strong> entisen telakka-alueen edustan pintasedimentin<strong>ja</strong> pienellä alueella myös syvemmän sedimenttikerroksenTBT-pitoisuudet olivat siinä määrinkorkeita, että ruopattavaa sedimenttiä ei voitu läjittää<strong>satama</strong>hankkeen meriläjitysalueelle eikä ruoppaustyötävoitu toteuttaa aiempien suunnitelmien mukaisestikyseisellä alueella. TBT-pitoisuus oli korkeinentisen telakka-alueen edustalla n. 20 ha:n alueella(kuva 9.2). Korkein sedimenttinäytteistä määritettyTBT-pitoisuus oli n. 15 000 μg/kg k.a. normalisoituna.Likaantuneimmalla alueella sedimentissäesiintyi myös kohonneita polykloorattujen bifenyylieliPCB-yhdisteiden pitoisuuksia. Trifenyylitinan eliTPhT:n, jota on käytetty aikoinaan samoihin tarkoituksiinkuin TBT:tä, pitoisuustaso tutkituissa sedimenttinäytteissäoli keskimäärin vain n. 15 % TBT:npitoisuustasosta. Tulosten mukaan TBT oli selkeästimerkittävin <strong>satama</strong>n rakentamisalueella esiintynythaitta-aine.Oli ilmeistä, että TBT oli joutunut entisen telakkaalueenedustalle telakkatoiminnan yhteydessä tapahtuneenantifouling-maalien käsittelyn <strong>ja</strong> erityisestihiekkapuhaltamalla tehdyn vanhan maalin poistonseurauksena. Aikaisemmissa, 1990-luvulla tehdyissätulevan <strong>satama</strong>-alueen sedimenttitutkimuksissa olimääritetty sedimenttinäytteiden kokonaistinapitoisuudet.Silloinen käsitys oli, että mikäli <strong>Vuosaaren</strong>telakalta olisi päässyt suuria määriä orgaanisiatinayhdisteitä vesistöön, täytyisi näiden yhdisteidenesiintymisen ilmetä selvästi kohonneina sedimentinpintakerroksen kokonaistinapitoisuuksina (TBT:ssäon n. 40 % tinaa). Kokonaistinapitoisuudet olivatkuitenkin alhaisia <strong>ja</strong> pitoisuuksien syvyyssuuntainenvaihtelu vähäistä. Tulosten perusteella arvioitiin, ettämerialueelle telakkatoiminnasta joutuneet orgaanistentinayhdisteiden kuormat eivät ole voineet ollasuuria. Ottaen huomioon sittemmin tapahtuneenorgaanisia tinayhdisteitä koskevan tiedon lisääntymisen<strong>ja</strong> ympäristöviranomaisten 2000-luvullaesittämät mereen läjitettävien ruoppausmassojenTBT-pitoisuutta koskevat kriteerit kokonaistinapitoisuudenperusteella ei voida arvioida sedimentinTBT-pitoisuutta, koska kokonaistinaa esiintyy sedimentissäluonnostaan yli tuhatkertaisesti suhteessaorgaanisten tinayhdisteiden sisältämään tinamäärään.Kesällä 2003 toteutettujen sedimenttitutkimustenperusteella tulevalla <strong>satama</strong>-alueella oli n. 75 ha:nalue, jonka pintasedimentissä esiintyi hallinnollisessaohjeluonnoksessa esitetyn ylemmän ra<strong>ja</strong>-arvon(200 μg/kg k.a normalisoituna) ylittäviä TBT-pitoisuuksia,jotka estivät alueen ruoppaamisen <strong>ja</strong> ruoppausmassojenläjittämisen <strong>satama</strong>hankkeen meriläjitysalueelleLänsi-Suomen vesioikeuden vuonna1998 antaman vesiluvan [1] perusteella. Sedimenttitutkimustenperusteella kyseisen alueen sedimentissäoli n. 97,6 kg TBT:tä. Tulevan <strong>satama</strong>n koillisosassahaitta-ainepitoisuudet olivat hyvin alhaisia <strong>ja</strong>SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö85


Kuva 9.2<strong>Vuosaaren</strong> <strong>satama</strong>alueen<strong>ja</strong> lähiympäristönnormalisoidutTBT-pitoisuudetvuonna 2003.0–200 µg/kg k.a.201–500 µg/kg k.a.501–1000 µg/kg k.a.1001–5000 µg/kg k.a.>5000 µg/kg k.a.NiinilahtiTelakka-alueTelakka-allasRuusuniemiKäringholmen<strong>Vuosaaren</strong>lahti<strong>Vuosaaren</strong>lahdenvene<strong>satama</strong>KalkkisaarenselkäLehdessaariKäärmeniemiVarissaariKalkkisaariPikku Niinisaari<strong>satama</strong>an johtavan uuden väylän ruoppauskohteidensedimentit olivat haitta-aineiden suhteen puhtaita.Vesilain mukaisena valvontaviranomaisena toimivaUudenmaan ympäristökeskus antoi kesällä2003 useassa eri vaiheessa luvan ruoppaustöiden<strong>ja</strong>tkamiselle tutkimuksissa likaantuneeksi todetunalueen ulkopuolella sekä Niinilahden niissä osissa,joissa TBT-pitoisuudet oli tutkimuksissa todettualhaisiksi. Uudenmaan ympäristökeskuksen luvallaosalla Niinilahden aluetta TBT-pitoisin pintasedimenttikuorittiin suljetulla kahmarikauhalla <strong>ja</strong> siirrettiinvälivarastoon Niinilahden läheisyyteen tätätarkoitusta varten rakennettuun kallioaltaaseen(kuva 9.4). Kuorinnan laadunvarmistuksen jälkeenNiinilahdesta voitiin tavanomaisesti ruoppaamallapoistaa mereen läjityskelpoiset savimassat. Kaikkimeriläjityskelpoiset massat kuljetettiin <strong>satama</strong>hankkeenmeriläjitysalueelle.9.4 Puhdistamisratkaisun kehittäminenSamanaikaisesti Uudenmaan ympäristökeskuksenhyväksymien ruoppausten edetessä <strong>Helsingin</strong><strong>Satama</strong> kehitti yhdessä eri alojen asiantuntijoidenkanssa ratkaisua, jolla entisen telakka-alueen edustanTBT:llä likaantunut merenpoh<strong>ja</strong> voitaisiin puhdistaamahdollisimman ympäristöystävällisesti <strong>ja</strong>joka mahdollistaisi tämän jälkeen <strong>satama</strong>n rakentamisenedellyttämien ruoppausten toteuttamisen. Ratkaisunperiaatteista neuvoteltiin kehitystyön aikanaympäristö- <strong>ja</strong> lupaviranomaisten kanssa.Vallinneissa olosuhteissa toteuttamiskelpoisimmaksiarvioitu <strong>satama</strong>-alueen puhdistamisen kokonaisratkaisumuodostui kolmesta vaiheesta. Ensimmäisessävaiheessa likaantunut alue eristetäänympäröivästä merialueesta suo<strong>ja</strong>penkereillä <strong>ja</strong>suo<strong>ja</strong>verhorakenteella. Toisessa vaiheessa likaantunutsedimentti poistetaan merenpoh<strong>ja</strong>sta puhdistusruoppaamalla<strong>ja</strong> siirretään Niinilahteen rakennetulletäyttöalueelle. Kolmannessa vaiheessa täyttöalueellesijoitettu likaantunut sedimentti massastabiloidaansiten, että se voidaan hyötykäyttää <strong>satama</strong>kentänpoh<strong>ja</strong>rakenteena.9.5 Puhdistamisratkaisun edellyttämät luvatPuhdistamisratkaisun kuhunkin vaiheeseen sisältyielementtejä, joille oli haettava erilliset luvat Länsi-Suomen ympäristölupavirastosta. Näitä lupia koskevathakemukset jätettiin Länsi-Suomen ympäristölupavirastoon30.1.2004. Kaikissa hakemuksissa oliliitteenä erillinen riskinarvio. Tarvittavat uudet luvat<strong>ja</strong> niiden keskeiset päätösprosessit olivat seuraavat:1. Vesilain mukainen lupa koskien <strong>Vuosaaren</strong><strong>satama</strong>-alueen maapengerosuuksien rakentamiseenliittyvää lievästi TBT-pitoisten sedimenttienruoppaamista <strong>ja</strong> läjittämistä merialueelle,voimakkaimmin TBT-pitoisen alueen kuorimistasekä töiden aloittamista ennen lupapäätöksenlainvoimaiseksi tulemista (ns. suo<strong>ja</strong>pengerlupa)Päätösprosessi:Länsi-Suomen ympäristölupaviraston päätös7. 6. 2004 nro 41/2004/1Vaasan hallinto-oikeuden välipäätös 6. 7. 2004nro 04/0228/3Vaasan hallinto-oikeuden päätös 7. 9. 2004nro 04/0274/3Korkeimman hallinto-oikeuden päätös 19. 10. 2005taltionro 264886SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


2. Vesilain mukainen lupa koskien <strong>Vuosaaren</strong><strong>satama</strong>-alueen TBT:llä voimakkaimmin pilaantuneidensedimenttien ruoppaamista suo<strong>ja</strong>rakenteineristetyllä alueella sekä töiden aloittamista ennenlupapäätöksen lainvoimaiseksi tulemista (ns. puhdistusruoppauslupa)Päätösprosessi:Länsi-Suomen ympäristölupaviraston päätös20. 12. 2004 nro 85/2004/3Vaasan hallinto-oikeuden päätös 28. 12. 2005nro 05/0437/3Korkeimman hallinto-oikeuden päätös 2. 11. 2006taltionro 29133. Ympäristölupa koskien <strong>Vuosaaren</strong> <strong>satama</strong>-alueenpilaantuneiden sedimenttien hyötykäyttöä <strong>satama</strong>rakenteissasekä lupapäätöksen täytäntöönpanoa<strong>ja</strong> toiminnan aloittamista mahdollisesta muutoksenhaustahuolimatta (ns. hyötykäyttölupa)Päätösprosessi:Länsi-Suomen ympäristölupaviraston päätös10. 3. 2005 nro 26/2005/3Vaasan hallinto-oikeuden päätös 28. 12. 2005 nro05/0438/3Korkeimman hallinto-oikeuden päätös 2. 11. 2006taltionro 2914Länsi-Suomen ympäristölupavirasto myönsi päätöksissäänluvat hakemusten mukaisille toimenpiteillesekä luvat päätösten mukaisten töiden <strong>ja</strong> toimenpiteidenaloittamiseen ennen päätösten lainvoimaiseksitulemista <strong>ja</strong> muutoksenhausta huolimatta.Suo<strong>ja</strong>pengeralueiden ruoppaustyöt jouduttiin keskeyttämäänVaasan hallinto-oikeuden välipäätöksen6. 7. 2004 nro 04/0228/3 johdosta, mutta töitä voitiin<strong>ja</strong>tkaa Vaasan hallinto-oikeuden annettua varsinaisenpäätöksensä 7. 9. 2004 nro 04/0274/3. Muitakeskeytyksiä puhdistamishanketta koskevista päätöksistätehdyistä valituksista tai muutoksenhakutuomioistuintenpäätöksistä ei aiheutunut.9.6 TBT:n esillenousun seurannaisvaikutuksia vuosina 2003 <strong>ja</strong> 2004<strong>Vuosaaren</strong> <strong>satama</strong>-alueelta tehty löydös nosti TBT:n julkisuuteen <strong>ja</strong> käynnisti laa<strong>ja</strong>n kansallisen TBT:hen liittyvän selvitys-, tutkimus- <strong>ja</strong> työryhmätoiminnan.Tätä ennen Ylä-Mononen oli tehnyt aiheeseenliittyvän suomalaisen selvityksen <strong>ja</strong> tutkimuksen1980- <strong>ja</strong> 1990-lukujen taitteessa [3], mutta silloisetTBT:n määritysmenetelmät olivat puutteellisia.Keväällä 2003 Suomessa ei ollut ainoatakaan laboratoriota,joka olisi määrittänyt TBT-pitoisuuksia,minkä vuoksi <strong>Vuosaaren</strong> näytteet jouduttiin toimittamaanSaksan Geesthachtissa si<strong>ja</strong>itsevaan Galablaboratorioontutkittaviksi. Vielä vuoden 2004 alussakaanSuomessa ei ollut laboratoriota, jolla olisiollut virallinen hyväksyntä eli akkreditointi TBTmääritykselle.Vuoden 2004 lopussa TBT-määrityksiätekeviä laboratorioita oli kuitenkin jo useita.Ympäristöministeriö julkaisi keväällä 2004 sedimenttienruoppaus- <strong>ja</strong> läjitysohjeen [4], joka taustanaoli Suomen ympäristökeskuksen valmistelema hallinnollinenohjeluonnos [2]. Ruoppaus- <strong>ja</strong> läjitysohjeenmukaiset läjityskelpoisuuden kriteerit ruopattavansedimentin TBT-pitoisuudelle olivat eräin täsmennyksinsamat kuin hallinnollisessa ohjeluonnoksessa:• Haitaton ruoppausmassa, normalisoitu TBT-pitoisuus≤ 3 μg/kg k.a. (taso 1), haitat merkityksettömiä<strong>ja</strong> massa mereen läjityskelpoista• Mahdollisesti pilaantunut ruoppausmassa, TBTpitoisuus> 3 – 200 μg/kg k.a. (pitoisuus tasojen 1<strong>ja</strong> 2 välillä), haitat <strong>ja</strong> läjityskelpoisuus arvioitavatapauskohtaisesti• Pilaantunut ruoppausmassa, normalisoitu TBTpitoisuus> 200 μg/kg k.a. (taso 2), haitat mahdollisia<strong>ja</strong> massa pääsääntöisesti mereen läjityskelvotonta9.7 Puhdistamisratkaisun toteutus9.7.1 Suo<strong>ja</strong>rakenteiden toteuttaminen<strong>ja</strong> Niinilahden valmisteluPuhdistettava n. 75 ha:n <strong>satama</strong>-alue eristettiin pysyviksirakenteiksi jäävillä suo<strong>ja</strong>penkereillä <strong>ja</strong> tilapäiselläsuo<strong>ja</strong>verhorakenteella muusta merialueesta.Näillä suo<strong>ja</strong>rakenteilla estettiin kiintoaineen <strong>ja</strong> siihensitoutuneen TBT:n karkaaminen <strong>ja</strong> leviämineneristetyn alueen ulkopuolelle. <strong>Vuosaaren</strong> voimalaitostenjäähdytysvedet johdettiin erillisellä pengerrakenteellasuo<strong>ja</strong>rakenteiden ra<strong>ja</strong>aman alueen ulkopuolelle.Samanaikaisesti Niinilahti valmisteltiinottamaan vastaan puhdistusruopattavat sedimentit(kuva 9.4). Tämä vaihe toteutettiin kesäkuun 2004<strong>ja</strong> huhtikuun 2005 välisenä aikana.Suo<strong>ja</strong>penkereiden rakentamisalueen lievästi TBTpitoinenpintasedimentti kuorittiin suljetulla kahmarikauhalla<strong>ja</strong> siirrettiin välivarastoon samaan Niinilahdenläheisyyteen rakennettuun kallioaltaaseen kuinSATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö87


A1A2B2Niinilahdensijoitus- elitäyttölueetKäärmeniemenvälivarastoallasB1Penger jäähdytysvesienoh<strong>ja</strong>amiseksiSuo<strong>ja</strong>verhorakenneJäähdytysvesiaukkoRaidepenger50 cm100 cmTBT 1TBT 250 cm<strong>Satama</strong>nII-vaiheEteläinensuo<strong>ja</strong>pengerPuhdistusruoppausalue20 cm30 cm20 cmItäinensuo<strong>ja</strong>penger20 cmKuva 9.3Niinilahden täyttöalue<strong>ja</strong> puhdistusruoppausalueet.Niinilahdesta kuorittu pintasedimentti. Tämän jälkeensuo<strong>ja</strong>penkereiden rakentamisalueen pehmeätmassat voitiin poistaa käyttäen tavanomaista ruoppaustekniikkaa.Suo<strong>ja</strong>penkereet rakennettiin sekalouheesta.Suo<strong>ja</strong>penkereiden rakentamisesta laadittiinraportti lupapäätöksen mukaisesti.Suo<strong>ja</strong>penkereiden kärkien välille rakennetunsuo<strong>ja</strong>verhorakenteen pituus oli 650 m <strong>ja</strong> korkeus 10–12 m. Suo<strong>ja</strong>verhon materiaali oli kudottua geotekstiiliä,jonka vetolujuus oli pääosassa rakennetta ≥ 70kN/m <strong>ja</strong> kriittisissä kohdissa ≥ 120 kN/m. Suo<strong>ja</strong>verhoakannatteli styreenimuovinen ponttoonirakenne<strong>ja</strong> verho painotettiin poh<strong>ja</strong>an tukevalla kettingillä.Suo<strong>ja</strong>verhorakenne ankkuroitiin paikalleen 25 m:nvälein. Suo<strong>ja</strong>verhorakenteeseen tehtiin 50 m:n levyinen,avattava <strong>ja</strong> suljettava kulkuportti aluksille.Niinilahti, joka oli tyhjennetty savimassoista,valmisteltiin ottamaan vastaan suo<strong>ja</strong>rakentein eristetyltäalueelta poistettava likaantunut sedimentti.Niinilahden poh<strong>ja</strong> täytettiin merihiekalla tasoon−4,0 m <strong>ja</strong> alueelle rakennettiin sekalouhepenkereinerotut täyttöaltaat A1, A2 <strong>ja</strong> B1. Hakemuksesta<strong>ja</strong> Länsi-Suomen ympäristölupaviraston päätöksestä85/2004/3 poiketen täyttöalueelle A rakennettiintäyttöalueet A1 <strong>ja</strong> A2 erottava ylimääräinen työpenger<strong>ja</strong> täyttöalueen B1 ulompi penger yhdistettiinraidepenkereeseen sen proomuaukon pohjoispuolella.Pengerjärjestely mahdollisti täyttöalueiden A1<strong>ja</strong> B1 proomuaukkojen avautumisen täyttöalueelleA2. Näin Niinilahden alueelle muodostui täyttöalueista<strong>ja</strong> niiden proomuaukoista kiintoaineen karkaamistaehkäisevä labyrinttirakenne (kuvat 9.3 <strong>ja</strong>9.5). Proomuaukkoihin jätettiin n. 1,5 m:n kynnyksetkiintoaineen karkaamisen estämiseksi. Kaikki näinmuodostuneen Niinilahden täyttöalueen louhepenkereettiivistettiin moreenilla <strong>ja</strong> kriittisille osuuksilleasennettiin suodatinkangas moreeniverhouksen alle.Niinilahden edustalle <strong>ja</strong> suo<strong>ja</strong>verhorakenteenulkopuolelle asennettiin <strong>ja</strong>tkuvatoimiset sameusmittausasematkiintoaineen leviämisen tarkkailemiseksi.Kuva 9.4Suo<strong>ja</strong>verhorakennettaasennetaan huhtikuussa2005.Kuva: Ari Piispanen88SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 9.5<strong>Satama</strong>työmaaluoteesta kesäkuussa2005. Keskellä Niinilahdentäyttöaluetäyttöaltaat erottavinepenkereineen.Niiden vasemmallapuolella Käärmeniemenvälivarastoallas.Kuva: Sami Kurikka/ Skylinefoto9.7.2 Puhdistusruoppaus <strong>ja</strong> sedimenttiensijoittaminen Niinilahden täyttöalueellePuhdistusruoppausta <strong>ja</strong> puhdistusruopattujen sedimenttienNiinilahden täyttöalueelle sijoittamisenoh<strong>ja</strong>usta <strong>ja</strong> valvontaa varten perustettiin huhtikuussa2005 erillinen valvontaryhmä, jossa ovat edustettuinavalvontaviranomaiset, VUOSA-projekti <strong>ja</strong> tarvittaessaurakoitsi<strong>ja</strong>t. Valvontaryhmän tarkoituksenaoli oh<strong>ja</strong>ta <strong>ja</strong> valvoa puhdistusruoppausta <strong>ja</strong> puhdistusruopattujenmassojen sijoittamista intensiivisellävuorovaikutusperiaatteella. Valvontaryhmän kokouksistalaadittiin muistiot, jotka toimivat dokumentteinahankkeen tapahtumista, sovituista menettelytavoista<strong>ja</strong> tehdyistä päätöksistä.Suo<strong>ja</strong>rakentein eristetyn alueen TBT:llä likaantunutsedimentti poistettiin merenpoh<strong>ja</strong>sta kehittyneeseenkaivunvalvontaan perustuvalla puhdistusruoppauksella<strong>ja</strong> siirrettiin Niinilahteen rakennetulletäyttöalueelle (kuva 9.5). Puhdistusruoppaus toteutettiintouko–lokakuussa 2005. Niinilahden läheisyyteenrakennettuun kallioaltaaseen välivarastoidutsedimentit siirrettiin Niinilahden täyttöalueellekesä–heinäkuussa 2005.Puhdistusruoppaus aloitettiin 8. 5. 2005 voimakkaimminlikaantuneista alueista TBT1 <strong>ja</strong> TBT2(kuva 9.3). Varsinainen puhdistusruoppaus toteutettiinsuurella Nordic Giant -ruoppaa<strong>ja</strong>lla, johonoli asennettu viimeisin saatavilla oleva <strong>ja</strong> mahdollisimmantarkka kaivunvalvontajärjestelmä sekätarkoitusta varten suunniteltu, 8 m leveä <strong>ja</strong> 25 m³:nvetoinen kauha, jossa oli sedimentin karkaamisenestävä, noston a<strong>ja</strong>ksi suljettava läppä. Tällä menetelmälläruopatut massat siirrettiin Niinilahden alueelleproomuilla.Niinilahden altaiden täyttöjärjestys oli A1, B1,A2 <strong>ja</strong> B2. Puhdistusruopatut sedimentit pudotettiinaluksi proomusta täyttöaltaisiin. Proomujen kulkusyvyydenalittuessa penkereiden proomuaukot suljettiin<strong>ja</strong> näihin kohtiin tehtiin vastaavat tiivistysrakenteetkuin muulla osalla pengertä. Tämän jälkeensedimentit siirrettiin imuruoppaa<strong>ja</strong>lla <strong>ja</strong> massapumpullatyöpenkereen yli kulloinkin täytettävänä olleeseenaltaaseen.Puhdistusruoppaus viimeisteltiin imuruoppauksella,jolla löyhtynyt <strong>ja</strong> mahdollisesti TBT-pitoinenaines poistettiin poh<strong>ja</strong>sta. Imuruopattu aines pumpattiinputkilin<strong>ja</strong>a pitkin suoraan Niinilahden alueelle.Imuruoppauksen mukana tulleen ylimäärävedenkiintoaineen laskeuttamisessa hyödynnettiinNiinilahden täyttöaltaita. Selkeytynyt vesi johdettiinsettipadon yli reservinä <strong>ja</strong> viimeisenä laskutusaltaanatoimineeseen täyttöaltaaseen B2, josta vesi suotautuimoreeniverhotun sekalouhepenkereen läpi takaisinsuo<strong>ja</strong>rakentein eristetylle puhdistusruoppausalueelle.Imuruoppaus jouduttiin toteuttamaan <strong>ja</strong>ksottaisesti,koska suotautuminen altaasta B2 puhdistusruop-SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö89


Kuva 9.6Suo<strong>ja</strong>verhorakennetoiminnassakesäkuussa 2005.Kuva: Sami Kurikka /Skylinefotopausalueelle oli hidasta. Niinilahden alueelta purkautuneenvesimäärän <strong>ja</strong> TBT-pitoisuuden perusteellatakaisin puhdistusruoppausalueelle kulkeutuiainoastaan hyvin vähäinen TBT-määrä (alle 0,1 kg).Puhdistusruoppauksen toteumaa seurattiin lupa<strong>ja</strong>ympäristöviranomaisten hyväksymän laadunvarmistusohjelmanmukaisesti. Laadunvarmistus käsittikunkin puhdistusruopatun osa-alueen alku- <strong>ja</strong> loppuluotaustenerotuksena saadun poistuneen sedimenttikerroksenpaksuuden seurannan sekä kultakin em.erotuksen perusteella valmistuneeksi todetulta osaalueeltaotetut sedimenttinäytteet, joista analysoitiinorgaanisten tinayhdisteiden pitoisuudet. Kunkin osaalueenlaadunvarmistuksen tulokset käsiteltiin valvontaryhmässä,jossa puhdistusruoppaustulos jokohyväksyttiin tai päätettiin tarvittavista <strong>ja</strong>tkotoimenpiteistä.Hankalimmilla alueilla puhdistusruoppausjouduttiin toteuttamaan useampaan kertaan riittävänpuhtaustason saavuttamiseksi.Puhdistusruoppauksen yhteydessä Niinilahdentäyttöalueelle sijoitetuksi sedimenttimääräksi muodostuin. 450 000 m³ktr. Laadunvarmistustutkimustenperusteella <strong>satama</strong>-alueen merenpoh<strong>ja</strong>sta olipoistunut n. 96,5 kg TBT:tä vastaten lähes 99 %:npuhdistusruoppaustoteumaa.Suo<strong>ja</strong>penkereet <strong>ja</strong> suo<strong>ja</strong>verhorakenne toimivatpuhdistusruoppauksen aikana erittäin hyvin. Sameustasosuo<strong>ja</strong>verhorakenteen ulkopuolisella sameusmittausasemallaoli koko puhdistusruoppauksen a<strong>ja</strong>nalueelle tavanomaisella tasolla (sameus alle 10 NTUvastaten alle 10 mg/l kiintoainetta), joten voidaanarvioida, että suo<strong>ja</strong>rakenteiden ulkopuoliselle merialueelleei käytännössä kulkeutunut kiintoainetta<strong>ja</strong> siihen sitoutunutta TBT:tä ruoppaustyön aikana.Myös muut tarkkailutulokset tukevat tätä arviota.Puhdistusruoppauksesta laadittiin raportti lupapäätöksenmukaisesti.Keväällä 2006 puhdistusruoppausta täydennettiinpienellä, entisen telakka-altaan suun kaakkoispuolellesijoittuvalla alueella Uudenmaan ympäristökeskuksenhyväksymällä tavalla. Tällöin merenpoh<strong>ja</strong>stapoistettiin <strong>ja</strong> sijoitettiin Niinilahden täyttöalueelle n.7 600 m³ktr sedimenttiä, joka sisälsi n. 0,2 kg TBT:tä.Puhdistusruoppauksen täydentämisestä laadittiinerillinen raportti.Kaikkiaan <strong>satama</strong>-alueen merenpoh<strong>ja</strong>sta poistettiinn. 97,5 kg TBT:tä, josta n. 96,5 kg oli peräisinpuhdistusruoppauksesta, n. 0,2 kg puhdistusruoppauksentäydentämisestä <strong>ja</strong> n. 0,8 kg kallioaltaaseenvälivarastoiduista sedimenteistä.Kuva 9.7Puhdistusruoppaustavarten rakennetturuoppaa<strong>ja</strong> NordicGiantin läppäkauha,jonka leveys oli 8 m<strong>ja</strong> tilavuus 25 m³.Kuvassa myös suljetunkahmarikauhantoimintaperiaate(Terramare Oy).Kuva: Paavo Lyytinen90SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


9.7.3 Massastabilointi <strong>ja</strong> massojen hyötykäyttöNiinilahden täyttöalueelle siirretty puhdistusruopattusedimentti massastabiloitiin siten, että se voitiinhyötykäyttää <strong>satama</strong>kentän poh<strong>ja</strong>rakenteena.Stabilointi- <strong>ja</strong> hyötykäyttöalueelle rakennettiin tarvittavatsalao<strong>ja</strong>- <strong>ja</strong> tiivistysrakenteet sekä päällysrakennekerrokset.Massastabilointi toteutettiin joulukuun2005 <strong>ja</strong> joulukuun 2006 välisenä aikana.Stabilointi- <strong>ja</strong> hyötykäyttöalueen <strong>ja</strong>tkorakentaminentapahtui vuoden 2007 <strong>ja</strong> kevään 2008 aikana.SideainesäiliöMassastabiloituruoppausmassaLujitekangasETENEMISSUUNTAMassastabilointikoneSekoituslaitteistoRuoppausmassa3...5mEsikuormituspenger(h ~ 1.0m)2...6 mKuva 9.9MassastabiloinninperiaateKorkeustasoSATAMAKENTTÄ+10Alue A+5Salao<strong>ja</strong>0-5-10Kuva 9.8Niinilahdentäyttöalueenpoikkileikkaus,periaatekuva.SuodatinkerrosStabiloituTBT-saviKantavatäyttöRaidealue SATAMAKENTTÄAlue BLopullinenAsfalttipäällyste ra<strong>ja</strong>määritelläänPäällysrakenne työn aikanaKantavapengerStabiloituTBT-saviKantavatäyttöSiltti-15HiekkaMoreeni-200 50 100 150 200 250 300 350 400 450 500 550Puhdistusruopatun sedimentin hyötykäyttöhankkeenvireille saattamista edelsivät mm. eri sideainemäärillä<strong>ja</strong> -yhdistelmillä tehdyt stabilointi- <strong>ja</strong> liukoisuuskokeet,joiden perusteella hanke arvioitiintoteuttamiskelpoiseksi <strong>ja</strong> joiden perusteella sitä lähdettiinviemään eteenpäin.Puhdistusruopattu sedimentti sijoitettiin Niinilahdentäyttöaltaisiin A1, A2 <strong>ja</strong> B1 kantavan merihiekkakerroksenpäälle keskimäärin viisi metriä paksunakerroksena, joka on syvämassastabiloitavissa yleisestisaavilla olevalla kalustolla (kuva 9.8). TäyttöaltaaseenB1 sijoittua massaa siirrettiin laskutusaltaanatoimineeseen täyttöaltaaseen B2 siten, ettämyös tässä altaassa sedimenttikerroksen paksuusmuodostui riittäväksi massastabiloinnin kannalta.Vaasan hallinto-oikeus oli edellyttänyt päätöksessään28. 12. 2005 nro 05/0438/3, että massastabilointisuunnitelmasamoin kuin suunnitelma poh<strong>ja</strong>- <strong>ja</strong>meriveden pääsyn estämisestä stabiloituun rakenteeseenoli toimitettava Länsi-Suomen ympäristö-Kuva 9.10Massastabilointi käynnissäsyyskuussa 2006.Kuva: <strong>Vuosaaren</strong><strong>satama</strong>n mediapankkiKuva 9.11Massastabilointilaitteensekoituspää eli myyrä.Kuva: Timo KarttunenSATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö91


Kuva 9.12Niinilahden täyttöelihyötykäyttöalueenympäryssalaojia<strong>ja</strong> tiivistysrakenteitaasennetaan kesäkuussa2007.Kuva: Markku Ahonenlupaviraston hyväksyttäväksi. Uudenmaan ympäristökeskuksenkanssa sovitusti massastabilointityönulkopuoliseksi auditoi<strong>ja</strong>ksi kiinnitettiin VTT.Puhdistusruopattu sedimentti massastabiloitiinkuvasta 9.9 ilmenevän periaatteen mukaisesti.Sideaineena käytettiin yksinomaan yleissementtiä,jonka sekoitussuhde oli 130 kg/m³ sedimenttiä.Altaiden reunaluiskissa sideainetta käytettiin runsaammin,n. 150 kg/m³. Stabilointityö eteni 4,5 mx 4,5 m lameilleittain <strong>ja</strong> lamelliriveittäin. Stabiloitusedimentti peitettiin heti sekoitustyön jälkeenn. 1 metrin paksuisella työpenkereellä, jonka päältätoteutettiin seuraavan työvuoron aikana seuraavanlamellirivin stabilointi. Myöhemmin stabiloidunmassan <strong>ja</strong> työpenkereen päälle rakennettiin varsinaisetkorkeammat esikuormituspenkereet. Sideaineensekoittamisen <strong>ja</strong> esikuormituksen seurauksena puhdistusruopatustasedimentistä muodostui kantavaa<strong>satama</strong>kentän poh<strong>ja</strong>rakennetta.Stabiloidun rakenteen lupamääräysten mukaistalaatua tarkkailtiin sekä työn edetessä että esikuormituksenjälkeen stabilointityön auditoi<strong>ja</strong>na toimineenVTT:n <strong>ja</strong> viranomaisten hyväksymällä tavalla. Stabiloidunrakenteen leikkauslujuuden tuli olla vähintään70 kPa <strong>ja</strong> vedenläpäisevyyden enintään 5 x 10 −9m/s. Lisäksi rakenteen painumaominaisuuksia tarkkailtiin<strong>ja</strong> tutkittiin koko prosessin a<strong>ja</strong>n sekä urakoitsi<strong>ja</strong>nettä rakennutta<strong>ja</strong>n intressien mukaisesti.Niinilahden täyttöalueen edusta täytettiin stabilointityönaikana syvätiivistetyllä merihiekalla<strong>satama</strong>-altaan pohjoisreunaan rakennettuun laiturintaustapenkereeseen saakka. Stabiloidun rakenteenympärille rakennettiin ympärys- eli niskasalaojitus<strong>ja</strong> päälle päällyssalaojitus 50 m:n välein. Niskasalaojituksen<strong>ja</strong> stabiloidun rakenteen välille asennettiinbentoniittieristys. Salaojitus- <strong>ja</strong> tiivistysratkaisutestävät vesipaineen muodostumisen stabiloituunrakenteeseen <strong>ja</strong> minimoivat näin haitta-aineiden liukenemisriskin.Toteutetut rakenteet mahdollistavatsalao<strong>ja</strong>vesien laadun tarkkailun <strong>ja</strong> tarvittaessa talteenoton.Stabiloidun rakenteen päälle rakennettiintarvittavat päällysrakennekerrokset. Pintarakenteenaalueella on asfalttikerros tai vedenpidätyskyvyltäänvähintään vastaava rakenne, minkä seurauksenavettä ei käytännössä pääse ylhäältä päin stabiloituunrakenteeseen.Toteutettujen toimenpiteiden seurauksena Niinilahdentäyttöalueelle stabiloitu TBT-pitoinen sedimenttion kiinteytetty <strong>ja</strong> hyödynnetty <strong>satama</strong>kentänpoh<strong>ja</strong>rakenteena sekä eristetty täysin merialueesta.Lisäksi stabiloitu sedimentti korvaa rakenteenamerihiekkaa <strong>ja</strong> louhetta, joita Niinilahden alueenrakentamisessa olisi muutoin tarvittu vastaavarakennetilavuus.9.8 Puhdistamisella saavutetut tulokset<strong>Satama</strong>-alueen merenpoh<strong>ja</strong>n puhdistamisen yhteydessämeriympäristöstä poistettiin <strong>ja</strong> eristettiin pysyvästin. 97,5 kg TBT:tä. Vuonna 2003 koko <strong>satama</strong>alueen– sellaiset vesiliikennealueet mukaan lukien,joilla ei ole ruoppaustarvetta – TBT-määräksi arvioitiinn. 101,6 kg. Tähän suhteutettuna koko <strong>satama</strong>alueeltapoistui puhdistamisratkaisun toteuttamisenyhteydessä n. 96 % alueen TBT-määrästä. <strong>Satama</strong>hankkeentoteuttamiseen liittyen Itä-<strong>Helsingin</strong> <strong>ja</strong>Länsi-Sipoon merialueelta poistettiin merkittäväTBT-päästölähde. Tällä on positiivisia vaikutuksiaalueen vesiekosysteemin tilaan erityisesti pidemmälläaikavälillä.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen toteuttamisen sekäTBT:llä likaantuneen sedimentin poistamisen vaikutuksiamerialueella on tarkkailtu erittäin kattavan<strong>ja</strong> dynaamisen vesistö- <strong>ja</strong> kalataloustarkkailuohjelmanmukaisesti. Tarkkailusta on laadittu vuosittainraporttijulkaisut [5–9]. TBT:llä likaantuneen sedimentinpoistamisprosessin aikana tarkkailutulokseteivät indikoineet mitään sellaisia haitallisia vaikutuksia,jotka olisivat poikenneet tavanomaisestaruoppaus- <strong>ja</strong> vesirakentamistoiminnasta. Itse asiassapuhdistusruoppausta varten rakennettujen suo<strong>ja</strong>rakenteidenansiosta kiintoaineen <strong>ja</strong> sameuden leviäminen<strong>satama</strong>n rakentamisalueelta ympäröivälle92 SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 9.13<strong>Satama</strong>työmaaluoteesta huhtikuussa2008. <strong>Satama</strong>kentänpoh<strong>ja</strong>rakenteeksimuuttuneenNiinilahden täyttöelihyötykäyttöalueenlikimääräinen si<strong>ja</strong>inti onosoitettu vaalennetullasoikiolla kuvan keskellä.Kuva: Sami Kurikka /Skylinefotomerialueelle oli vähäisempää kuin alkuperäisensuunnitelman mukaisesti toimittaessa. Erittäin huomionarvoistavuosina 2003–2007 toteutetun vesistö<strong>ja</strong>kalataloustarkkailun tuloksissa on, että TBT:n <strong>ja</strong>muiden orgaanisten tinayhdisteiden pitoisuudet <strong>Vuosaaren</strong><strong>satama</strong>n ympäristön sedimenteissä, simpukoissa<strong>ja</strong> kaloissa ovat pienentyneet merkittävästivuoteen 2003 verrattuna.Kokonaisuutena merenpoh<strong>ja</strong>n puhdistaminenTBT:stä nivoutui kohtalaisen saumattomasti <strong>Vuosaaren</strong><strong>satama</strong>hankkeen muuhun toteuttamiseen.Sillä ei ollut vaikutusta myöskään <strong>satama</strong>hankkeensuunniteltuun valmistumiseen. Merenpoh<strong>ja</strong>n puhdistamisenkustannukset olivat yhteensä 10,5 miljoonaaeuroa.L ä h t e e t1. Länsi-Suomen vesioikeuden päätökset 9. 7. 1998nrot 48–52/1998/3Vaasan hallinto-oikeuden päätös 24. 2. 2000nro 00/0010/2Korkeimman hallinto-oikeuden päätös 24. 10. 2002taltionro 2638.2. Suomen ympäristökeskus 2003. Likaantuneen ruoppausmassanläjityskelpoisuus meriympäristössä.Ruopattavan massan haitallisuuden arvioiminenhaettaessa vesilain mukaista lupaa ruoppausmassanmereen läjittämiseen. Hallinnollinen ohje (luonnos29. 6. 2001, johon on tehty täsmennyksiä viimeksi28. 2. 2003). Moniste. 15 s.3. Ylä-Mononen, L. 1989. Orgaanisten tinayhdisteidenkäyttö <strong>ja</strong> ympäristövaikutukset. Ympäristöministeriönympäristönsuojeluosaston julkaisusar<strong>ja</strong> D66/1989.Helsinki. 104 s.4. Ympäristöministeriö 2004. Sedimenttien ruoppaus- <strong>ja</strong>läjitysohje. Ympäristöopas 117. 19. 5. 2004. Helsinki. 121 s.5. Niinimäki, J., Paasivirta, L., Heitto, A. Oulasvirta, P. &Vatanen, S. 2004. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen vesistö<strong>ja</strong>kalatalousseuranta 2003. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2004. Helsinki. 122 s.6. Vatanen, S. & Niinimäki, J. 2005. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2004. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen julkaisu<strong>ja</strong> 1/2005. Helsinki. 122 s.7. Vatanen, S., Niinimäki, J. & Haikonen, A. 2006. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen vesistö- <strong>ja</strong> kalatalousseuranta2005. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen julkaisu<strong>ja</strong> 1/2006.Helsinki. 120 s.8. Vatanen, S. & Haikonen, A. 2007. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2006. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen julkaisu<strong>ja</strong> 1/2007. Helsinki. 120 s.9. Vatanen, S. & Haikonen, A. 2008. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2007. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen julkaisu<strong>ja</strong> 1/2008. Helsinki. 104 s.SATAMA-ALUEEN MERENPOHJAN PUHDISTAMINEN TBT:STÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö93


10Telakka-alueenpilaantuneen maaperän kunnostus10.1 JohdantoOn vaikea kuvitella ympäristöteknisesti haastavampaa<strong>ja</strong> mielenkiintoisempaa maaperänkunnostuskohdettakuin <strong>Vuosaaren</strong> telakka-alue. Alueen varsinmonimuotoisen teollisen käyttöhistorian aiheuttamamaaperän pilaantuminen asetti monisyisiä terveys<strong>ja</strong>ympäristövaikutteisia reunaehto<strong>ja</strong> tulevalle <strong>satama</strong>nrakentamiselle. Selvää oli, että maapoh<strong>ja</strong>a onpuhdistettava ennen alueen uudelleen rakentamista.Maaperän kunnostukseen tähtäävät toimet aloitettiinjo vuonna 1997. Nyt runsas vuosikymmenmyöhemmin voidaan todeta maapoh<strong>ja</strong> kunnostetuksiasetetuissa aikatauluissa <strong>ja</strong> lupamääräystenmukaisesti. <strong>Vuosaaren</strong> tyyppisissä suurhankkeissaympäristötekninen suunnittelu <strong>ja</strong> -tutkimukset,riskienarviointi <strong>ja</strong> -hallinta sekä niihin poh<strong>ja</strong>utuvatkunnostusratkaisut ovat usein lähes näkymätönmutta tärkeä osa rakentamista.On itsestään selvää, että terveyden <strong>ja</strong> ympäristönsuojeleminen ovat itsearvoisesti tärkeimmät huomioitavattekijät pilaantuneita kohteita kunnostettaessa.Ympäristötekninen suunnittelu, tutkimukset <strong>ja</strong>kunnostuksen valvonta poikkeuksetta myös hidastavatnormaalia rakentamistyötä, joten em. osakokonaisuuson pyrittävä ottamaan huomioon aikataulu<strong>ja</strong>laadittaessa. Ympäristöteknisten vaateiden aliarviointitai sivuuttaminen saattaa aiheuttaa kokonaistenrakennusvaiheiden pysähtymisiä <strong>ja</strong> ketjutettujen työvaiheidenviipeitä, mikä suurissa hankkeissa pahimmillaantarkoittaa jopa miljoonien eurojen lisäkustannuksia.Pilaantuneilla alueilla toimittaessa myöstyösuojeluvaateet ovat usein tiukemmat kuin ns. normaalissamaanrakennustoiminnassa.Maaperän kunnostaminen Vuosaaressa onnistuiodotusten mukaisesti, ehkä ylittikin ne. On kuitenkinhyvä todeta, että jokainen kunnostusvaihe tuotti,perusteellisesta poh<strong>ja</strong>työstä huolimatta, yllätyksiä,takaisku<strong>ja</strong> <strong>ja</strong> haastavia vaiheita. Tässä osassa kerrataanlyhyesti pilaantuneen maaperän kunnostushankkeenperusteet <strong>ja</strong> työn kulku, hankkeen organisaatio<strong>ja</strong> sen toimivuus, sekä nostetaan esimerkkeinäesiin muutamia niistä erityishaasteista, joihin kokokunnostukseen osallistunut organisaatio joutui matkanvarrella paneutumaan.10.2 ToimintahistoriaEnnen teollista toimintaa tuleva telakka-alue oliluonnontilaista <strong>ja</strong> siellä oli ha<strong>ja</strong>naista, lähinnäkesähuvila- <strong>ja</strong> omakotiasutusta. Varsinainen teollinentoimintahistoria voidaan <strong>ja</strong>kaa karkeasti kahteenpäävaiheeseen: Alueella toimi Valmetin laivanrakennustelakkavuosina 1974–1987. Telakallavalmistettiin, koottiin <strong>ja</strong> varastoitiin laivanosia,mihin liittyen kohteessa harjoitettiin mm. hiekkapuhallusta,maalausta <strong>ja</strong> lakkausta sekä pintakäsittelyä.Telakalla toimi myös yksi Euroopan suurimmistakuivatelakoista sekä lukuisa määrä toimialaatukevia alihankintayrityksiä sekä mm. ammattikoulu.Vuodesta 1988 lähtien alueella harjoitettiin laivankor<strong>ja</strong>ustoimintaasekä monimuotoista pienyritystoimintaa<strong>ja</strong> varastointia. Alueella si<strong>ja</strong>itsiveneenrakennus- <strong>ja</strong> kor<strong>ja</strong>usyritysten lisäksi mm.lasikuituvalmistusta, auto- <strong>ja</strong> moottorikor<strong>ja</strong>amo<strong>ja</strong>,metalliverstaita, maalaamoita, sekä hitsaamo, pesula<strong>ja</strong> hiekkapuhaltamo. Alueen pohjoisosassa toimivuodesta 1989 alkaen betonitehdas <strong>ja</strong> kiviainesvarasto.Toiminta jätti jälkensä alueen maaperään; a<strong>ja</strong>nhengen mukaisesti kemikaaleista tai jätteistä ei asianmukaisestihuolehdittu, vaan ne pääsääntöisesti joko”hyötykäytettiin” alueen täytöissä, tai esim. poltettiin.Lisäksi alueita, joiden pintamaa teollisen toiminnanmyötä täyttyi sorvaus-, hitsaus- ym. palamattomastajätteestä, saatettiin aika ajoin peittääpuhtaalla sorakerroksella. Öljy-, maali- <strong>ja</strong> liuotinjätteitäkaadeltiin maahan, ojiin <strong>ja</strong> viemäreihin.Lisäksi esim. maalaustöissä, hiekkapuhalluksessa<strong>ja</strong> hitsauksessa levisi lähialueille merkittäviäkinpisara- <strong>ja</strong> hiukkaslaskeumia. Näin kohteeseen muodostuipilaantuneisuusprofiili, jossa toisaalta voitiintodeta laajo<strong>ja</strong>, pilaantuneita pintamaa-alueita,94 TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aKari Koponen, FT, työskentelee johtavana asiantunti<strong>ja</strong>naFCG Planeko Oy:ssä. Vuosina 2000 –2007 Koponen työskenteliprojektipäällikkönä Golder Associates Oy:n palveluksessa vastaten<strong>Vuosaaren</strong> telakka-alueen pilaantuneiden maiden riskinarvioinnista,kunnostuksen suunnittelusta <strong>ja</strong> valvonnasta.puhtaan pintamaan alapuolella si<strong>ja</strong>itsevia pilaantuneitavanho<strong>ja</strong> pintamaakerroksia, pistemäisiä, muttasyvälle ulottuvia nestemäisten jätteiden ”dumppauspaikko<strong>ja</strong>”,sekä varsinaisia jätehauto<strong>ja</strong> <strong>ja</strong> -aumo<strong>ja</strong>.Haitta-aineilla pilaantuneiden alueiden lisäksikohteen täyttöhistoria haastoi kunnostajia <strong>ja</strong> rakentajia;<strong>Vuosaaren</strong> telakka-alue si<strong>ja</strong>itsee pääosin mereenrakennetulla täyttömaalla. Alueen täytöistä löytyikinturpeella, juurakoilla, savella <strong>ja</strong>/tai rakennusjätteellätäytettyjä alueita, jotka oli poistettava haitta-ainepitoisuuksistariippumatta, sillä em. täyttöjen todettiinolevan rakennusteknisesti soveltumatonta uuden<strong>satama</strong>n poh<strong>ja</strong>rakenteisiin.10.3 Tutkimukset <strong>ja</strong> suunnitelmat10.3.1 Ympäristölupaa edeltäneet tutkimuksetTutkimus- <strong>ja</strong> kunnostusalueen alustava ra<strong>ja</strong>us hahmottuitoimintahistorian perusteella siten, että tutkimustenpääpaino kohdistettiin niille alueille, joissatiedettiin harjoitetun mahdollisesti maaperää pilaavaatoimintaa. Alue <strong>ja</strong>kaantui kahteen toiminnalliseenosaan; suunniteltuun <strong>satama</strong>-alueeseen (pintaalanoin 30 ha) <strong>ja</strong> työpaikka-alueeseen (noin 30 ha).Koko alueen pinta-alaksi arvioitiin noin 60 ha.Maanpinta suunnittelualueella on noin tasolla+3…+4 metriä meren pinnasta, koostuen varsinkin<strong>satama</strong>-alueella pääosin täyttömaasta. Työpaikkaalueellatäyttömaakerrosten alla todettiin paikoinlohkareisia täyttökerroksia, hiekkaista luonnonmaatasekä kallioalueita. Alueen keskiosassa on lisäksi kallioonlouhittu telakka-allas. Kohde ei si<strong>ja</strong>itse poh<strong>ja</strong>vesialueella.<strong>Satama</strong>n rakentamisen vaatima kaivusyvyysalueella vaihteli, ollen syvimmillään noin3 m silloisen maanpinnantason alapuolella, kun taasosalla aluetta maanpintaa jouduttiin hieman nostamaan.Kunnostusta <strong>ja</strong> ympäristölupaa varten alueenmaaperän <strong>ja</strong> poh<strong>ja</strong>veden pilaantuneisuutta tutkittiinuseaan otteeseen vuosina 1997 –2001. Tulevaltakunnostusalueelta otettiin maaperä- <strong>ja</strong> poh<strong>ja</strong>vesinäytteitäsekä kartoitettiin alueen pintamaidenpilaantuneisuutta kenttäkatselmuksin. Alueen kokonaispinta-alaansuhteutettuna pistemäärä oli vielätässä vaiheessa melko vähäinen. On kuitenkin huomioitava,että tutkimusten aikana alue oli edelleenaktiivisessa teollisuuskäytössä. Alueella si<strong>ja</strong>itsi laajo<strong>ja</strong>,aidattu<strong>ja</strong> vuokra-alueita, joissa toimi kymmeniä,ellei sato<strong>ja</strong> pienyrityksiä varastoineen. Lisäksikohteessa si<strong>ja</strong>inneet rakennukset <strong>ja</strong> maanalaisetrakenteet rajoittivat merkittävästi alueen tarkempaatutkimista. Tutkimuspisteet pyrittiinkin sijoittamaanmahdollisimman tarkasti niille alueille, joilla kohteenkäyttöhistorian perusteella arvioitiin mahdollistenpilaantumien si<strong>ja</strong>itsevan.Näytteistä tutkittiin raskasmetallien, arseenin,syanidin, mineraaliöljyn, liuotinaineiden <strong>ja</strong> haihtuvienhiilivetyjen sekä PCB- (polyklooratut bifenyylit)<strong>ja</strong> PAH-yhdisteiden (polyaromaattiset hiilivedyt)pitoisuuksia. Tutkimusten perusteella todettiin, ettäpääasiallisena haitta-aineena kohteessa ovat raskasmetallit.Metalleista korkeimmat pitoisuudet todettiinkoboltilla, kromilla, kuparilla, nikkelillä <strong>ja</strong> sinkilläsekä arseenilla. Yleisesti alueella todettujenkohonneiden arseenipitoisuuksien arvioitiin olevanalueen kiviainekselle luontaista, <strong>ja</strong> levinneen maaperäänkallion louhinnan seurauksena. Todennäköisimpiäraskasmetallien lähteitä alueella arvioitiinolleen mm. sinkkaamo <strong>ja</strong> pintakäsittely (sinkki, nikkeli),hitsaus- <strong>ja</strong> polttoleikkaus (kromi) <strong>ja</strong> maalaus/Haitta-aineTodettumaksimikeskiarvoSamaseOASamaseRAArseeni 147 12 10 50Kadmium 4 0,3 0,5 10Koboltti 2200 191 50 200Kromi 2200 175 100 400Kupari 2800 360 100 400Lyijy 761 55 60 300Nikkeli 1600 174 60 200Sinkki 2840 389 150 700Taulukko 10.1Ennen ympäristölupaatehtyjen tutkimustenraskasmetallipitoisuuksia(mg/kg) <strong>ja</strong>vertailu Samase(Ympäristöministeriönympäristönsuojeluosastonmuistio5/1994) ohje- <strong>ja</strong> ra<strong>ja</strong>arvoihin.TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö95


Taulukko 10.2Orgaanisille yhdisteilleriskinarviossaesitettyjä tavoitepitoisuuksia.Taulukossaoikealla ympäristölupapäätöksenmukaisetkunnostustavoitteet(mg/kg).kor<strong>ja</strong>ustoiminnot (kupari, lyijy) telakka-altaassa <strong>ja</strong>lähialueilla. Pilaantumia todettiin lähinnä pintamaakerroksissa.Taulukossa 10.1 on esitetty ennen ympäristölupaatehdyissä tutkimuksissa todettu<strong>ja</strong> raskasmetallipitoisuuksia.Tutkimusten yksi merkittävimmistä havainnoistaoli ns. maalijätealueen löytyminen; vanho<strong>ja</strong> maalipurkke<strong>ja</strong><strong>ja</strong> muuta jätettä sisältävän alueen täytöissätodettiin korkeita raskasmetallipitoisuuksia sisältävääpuhallushiekkajätettä, sekä kohonneita öljy- <strong>ja</strong>PCB-yhdisteiden, sekä haihtuvien hiilivetyjen pitoisuuksia.Muualla kunnostusalueella ei tutkimusvaiheessatodettu merkittäviä pitoisuuksia syanidia eikäPCB- tai PAH-yhdisteiden pitoisuuksia. Myös öljyhiilivetyjenpitoisuudet olivat alhaisia. Alueen orsivesinäytteissäei todettu, muutamaa lievää öljypitoisuuttalukuun ottamatta, merkittävästi kohonneitahaitta-ainepitoisuuksia.Tehtyjen tutkimusten perusteella saatiin hyväyleiskuva alueen pilaantuneisuudesta <strong>ja</strong> sen si<strong>ja</strong>innista.Seuraavassa vaiheessa telakka-alueelle tehtiinyleistasoinen terveys- <strong>ja</strong> ympäristöriskinarvio sekäriskinarvioon poh<strong>ja</strong>utuva kunnostuksen yleissuunnitelma.10.3.2 Riskinarvio <strong>ja</strong>kunnostuksen yleissuunnitelmaTelakka-alueen maaperässä todettujen haitta-aineiden<strong>ja</strong> haitta-ainepitoisuuksien aiheuttamia terveys<strong>ja</strong>ympäristöriskejä arvioitiin maaperän kunnostussuunnittelunpoh<strong>ja</strong>ksi. Riskinarvioperustainenpilaantuneen maapoh<strong>ja</strong>n kunnostaminen oli Suomessavielä vuonna 2001 melko uusi menetelmä,joten Vuosaari-hankkeen voidaan katsoa omaltaosaltaan tässäkin suhteessa toimineen päänavaa<strong>ja</strong>nauusien ratkaisumallien käyttöönotolle.Riskinarviossa todettiin mm., että kaivutyönaikana haitta-ainepitoiset maat saattavat aiheuttaaHaitta-aineHaihtuvatyhdisteetSyvemmätmaakerroksetKeskiraskaatöljy<strong>ja</strong>keetRaskaatöljy<strong>ja</strong>keetPCByhdisteetRiskinarviossaesitetyttavoitepitoisuudetPintamaa0–1 mYmpäristölupapäätöksenYS 1076mukaisettavoitepitoisuudet100 100 100300 1000 300600 2000 6000,5 5,0 0,1alueella työskentelevillä hengitystie- <strong>ja</strong> ihoaltistusta.Riskinarviossa tarkasteltiin myös kunnostuksen jälkeistälopullista tilannetta, jossa kohdealueella toimisinykyaikainen <strong>satama</strong> logistiikka- <strong>ja</strong> liikennealueineen,sekä alueen infrastruktuuria tukevia taisiitä hyötyviä yrityksiä. Terveys- <strong>ja</strong> ympäristöriskienkartoittamisen kautta pyrittiin löytämään kustannustehokkaitakunnostusratkaisu<strong>ja</strong>, joissa alueenmaaperässä todettujen haitta-aineiden mahdollisestiaiheuttamat terveys- <strong>ja</strong> ympäristöhaitat oliriskinvähennystoimin saatettu merkityksettömälletasolle.Arvioinnissa edettiin kohdetta kuvaavien käyttö-,maaperä-, <strong>ja</strong> poh<strong>ja</strong>vesitietojen kautta kohteessatodettuihin haitta-aineisiin <strong>ja</strong> niiden pitoisuustasoihin.Kohteeseen luotiin nk. käsitteellinen malli,jossa kuvailtiin riskien kannalta merkittäviksi valittujenhaitta-aineiden mahdollisia kulkeutumis- <strong>ja</strong>altistusreittejä, sekä arvioitiin mahdollisia haittaaineillealtistujia.Riskejä tarkasteltiin tilanteessa, missä kohdeon päällystettyä, teollisuus- <strong>ja</strong> <strong>satama</strong>käytössä olevaaaluetta. Tarkennetussa kunnostuksen tavoitepitoisuuksienasettelussa käytettiin metallien osaltahyväksi kanadalaisia riskipoh<strong>ja</strong>isia tavoitepitoisuuksia.Riskitarkastelun johtopäätöksissä todettiin, ettäkun rakentamisen vuoksi kaivettavat pilaantuneetmaat on poistettu, maaperään jääneet, puhtaillamailla peitetyt <strong>ja</strong> asfaltilla tai muilla rakenteilla eristetytkorkeatkaan metallipitoisuudet eivät aiheuttaisimerkittäviä terveys- tai ympäristöriskejä kohteessa.Kunnostustavoitteiksi haihtuville hiilivety-yhdisteilleesitettiin Samase-ohjearvotasoa 100 mg/kg.Öljyhiilivedyille puolestaan esitettiin Samase-ohjearvo<strong>ja</strong>pintamaalle <strong>ja</strong> Samase-ra<strong>ja</strong>-arvo<strong>ja</strong> syvemmillemaakerroksille. PCB-yhdisteille esitettiinpintamaalle Samase-ohjearvotasoa 0,5 mg/kg,<strong>ja</strong> syvemmille maakerroksille kanadalaista riskipoh<strong>ja</strong>istatavoitepitoisuutta 5 mg/kg, jonka arvioitiinpaikallisiin olosuhteisiin suhteutettuna olevanturvallinen pitoisuus telakan poh<strong>ja</strong>maakerroksissa.Tässä vaiheessa ei maaperän organotinayhdisteilleasetettu tavoitepitoisuuksia. Riskinarviossa kunnostustavoitteiksiasetettu<strong>ja</strong> orgaanisten yhdisteidenpitoisuuksia on esitetty taulukossa 10.2. Ympäristölupapäätöksessäasetettiin orgaanisille yhdisteillekuitenkin huomattavasti tiukemmat kunnostuskriteerit.Kohonneiden arseenipitoisuuksien arvioitiin olevanalueen kiviainekselle luontaista, sillä sen todettiinesiintyvän koko alueella Samase-ohjearvonylittävinä pitoisuuksina, eikä alueen käyttöhistorian96 TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


perusteella voitu osoittaa toiminto<strong>ja</strong>, jotka olisivatvoineet aiheuttaa niin laa<strong>ja</strong>n <strong>ja</strong> yhtenäisen arseenipitoisuuksienleviämän alueella. Suunnitelmassaesitettiinkin, että mikäli arseenin ei liukoisuustestienperusteella todettaisi liukenevan merkittävästimaa-aineksesta, pelkästään kohonneita arseenipitoisuuksiasisältävät kaivumaat voitaisiin hyötykäyttääkohteen alueella.Riskinarvio <strong>ja</strong> siihen perustuva pilaantuneenmaaperän kunnostuksen yleissuunnitelma sekä työsuojelusuunnitelmaliitettiin Uudenmaan ympäristökeskuksellelähetettyyn ympäristölupahakemukseen.Seuraavassa kappaleessa on lyhyesti käyty läpi lupapäätöksenkeskeisiä määräyksiä alueen kunnostamiselle.10.3.3 YmpäristölupaTelakka-alueen maaperän kunnostukselle saatiinympäristölupa syyskuussa 2002 [1]. Kunnostusalueelleedellytettiin tehtäväksi täydentäviä maaperätutkimuksiaaiemmin todettujen pilaantuneiden alueidenlaajuuden <strong>ja</strong> aiemmin tutkimattomien alueidenmaaperän pilaantuneisuuden selvittämiseksi. Lisätutkimuksiatehtiinkin aina ennen uuden kunnostusvaiheenalkua, sekä itse kunnostuksen aikana (erillisettutkimukset on esitetty taulukossa 10.3).Kunnostusalueilta oli luvan mukaan poistettavaepäorgaanisilla haitta-aineilla pilaantuneet maaaineksetalueella tehtävien rakennustöiden edellyttämiinkaivutasoihin asti. Metallipitoiset kaivutasotmäärättiin eristettäviksi <strong>ja</strong> merkittäviksi. Lisäksikunnostusalueelta määrättiin poistettavaksi täyttömaassamahdollisesti olevat jäte<strong>ja</strong>keet. Päätöksessäotettiin siten hienosti huomioon alueen pilaantuneisuudenluonne <strong>ja</strong> riskien hallinta rakentamisen jälkeisessätilanteessa.Kunnostusalueilta oli lisäksi poistettava maaaines,jonka orgaanisten haitta-aineiden pitoisuudetylittivät ympäristöministeriön ympäristönsuojeluosastonmuistiossa 5/1994 esitetyt ohjeellisetSamase-ohjearvotasot, kuitenkin siten, että PCBpitoisuudentavoitetaso on 0,1 mg/kg. Lisäksi määrättiinpoistettavaksi selvästi öljyperäisille hiilivedyille,liuottimille tai muille haitta-aineille haisevat maaainekset.Orgaanisten yhdisteiden osalta päätös todettiinyllättävän tiukaksi varsinkin raskaiden öljyhiilivetyjen<strong>ja</strong> PCB-yhdisteiden osalta. <strong>Satama</strong>-alueelleasetettuna vaade kunnostaa voiteluöljypitoisetmaat asuinalueita <strong>ja</strong> ns. herkkiä maankäyttömuoto<strong>ja</strong>varten asetettuihin ohjearvoihin koettiin ylisuojelevaksi.Vastaavasti PCB-yhdisteiden tavoitepitoisuudeksipäätöksessä asetettu 0,1 mg/kg oliarviolta samaa suuruusluokkaa kuin <strong>Helsingin</strong> kaupunkialueenpintamaissa yleisesti todettu pitoisuustaso.Vanha maatunut voiteluöljy, eivätkä varsinkaanPCB-yhdisteet haihdu ilmaan eivätkä liukeneveteen, joten maaperän ”puhdistaminen” kolmemetriä tulevan maanpinnantason alapuolella tulevanasfaltoidun <strong>satama</strong>kentän alueella aiheutti ylimääräistäkaivutyötä, sitoi kalustoa, kuormitti vastaanottopaikko<strong>ja</strong>sekä aiheutti puhtaiden maidenlisäkuljetustarvetta alueelle. Mainittakoon vielä,että riskinarviossa esitetty PCB-yhdisteiden tavoitepitoisuus(5 mg/kg) syvemmille maakerroksille olisama kuin vuonna 2007 valtioneuvoston ns. PIMAasetuksessateollisuusalueille arvioitu hyväksyttävätavoitepitoisuus.Arseenin osalta lupapäätöksessä esitettiin, ettäalueella todettujen kohonneita arseenipitoisuuksiasisältävien maa-ainesten luontaisesta arseenipitoisuudestatulee esittää seikkaperäinen selvitys, jossamm. arvioidaan todettujen arseenipitoisuuksien <strong>ja</strong>arseenin esiintymismuotojen aiheuttamaa terveys<strong>ja</strong>ympäristöriskiä alueen tulevassa käytössä.Arseenin alkuperä varmennettiin erilliselläriskinarvioinnilla [2], jossa todettiin, että alueentäyttömaassa tavattava arseeni esiintyy alueenkallioperästä tehdyn murskeen luonnollisissa mineraaleissa.Riskitarkastelussa arvioitiin arseenin olevanhaitatonta läheisen merialueen ekosysteemeille,sillä sen todettiin esiintyvän erittäin niukkaliukoisena,<strong>ja</strong> että puhtailla mailla peitettynä arseeni eimyöskään aiheuttaisi haittaa terveydelle. Luontaisestilievästi kohonneita arseenipitoisuuksia sisältävienmaa-ainesten sijoittamisesta hyötykäyttöön<strong>satama</strong>keskuksen alueelle saatiin Uudenmaan ympäristökeskuksenpäätös [3]. Em. arseenimaita saatiinhyötykäyttää lupa-alueella tulevan maanpinnan alapuolisissa,mutta merenpinnan yläpuolisissa täyttökerroksissa.Päätös oli hyötykäyttömielessä mainio;riskittömästi sijoitettuina em. arseenimaita voitiinsijoittaa täyttöihin, joita varten muuten olisi jouduttutuomaan puhtaita täyttömaita alueen ulkopuolelta.10.3.4 Täydentävät tutkimuksetTäydentäviä tutkimuksia suunniteltiin <strong>ja</strong> toteutettiinennen jokaista kunnostusvaihetta. Kunnostusalueillatehtiin täydentäviä maaperätutkimuksia aiemmintodettujen pilaantuneiden alueiden laajuuden <strong>ja</strong>aiemmin tutkimattomien alueiden maaperän ympäristöteknisentilan selvittämiseksi. Lisäksi tutkimuksiasuoritettiin kunnostustyön aikana aina, kunilmeni aihetta kartoittaa tarkemmin kunnostukseenTELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö97


Taulukko 10.3Ympäristöteknisetmaaperätutkimukset<strong>Vuosaaren</strong> telakkaalueella.VuosiYmpäristölupaa edeltäneet tutkimukset<strong>Satama</strong>- <strong>ja</strong>työpaikka-alue1997–2001Täydentävät tutkimukset<strong>Satama</strong>-alueTyöpaikka-alue2003–20072003–2007YmpäristötutkimuksetKoekuoppaKairaus Yhteensä124 35 159165 156 321115 105 220Tutkimukset yhteensä 70010.4 Kunnostustulevaa työaluetta. Kohteessa tehdyt lisätutkimukseton esitetty taulukossa 10.3. Listasta puuttuvat kunnostuksenaikana suoritetut tarkentavat koekuoppatutkimukset,joita tehtiin useita eri urakkavaiheissa.Mittavimmat täydennystutkimukset suoritettiinmaalijätealueen kunnostuksen jälkeen, valmistauduttaessaSMRU 4/1 -urakkaan. Laajoista lisätutkimuksistahuolimatta ei kunnostuksenaikaisilta yllätyksiltäkuitenkaan täysin vältytty: esimerkkeinä mm.todetut PCB-pitoisuudet ensimmäisen kunnostusvaiheenpintamaissa sekä laa<strong>ja</strong> jätetäyttöalue, joka löytyivasta kolmannen kunnostusvaiheen aikana.Kuva 10.1<strong>Vuosaaren</strong> <strong>satama</strong>nkunnostusalueet.SMRU 4/3SMRU 4/4SMRU 4/2SMRU 4/1SMRU 4/210.4.1 Kunnostustyön yleiskuvausMaaperän kunnostaminen suoritettiin neljässä erillisessäurakkavaiheessa (SMRU 4/1–4/4) vuosina2003–2007. Kunnostusalue eri urakkarajoineen onesitetty kuvassa 10.1. Valtaosa pilaantuneista maistasijoitettiin eristettyinä kunnostusalueen viereenrakennettuun ns. Melumäkeen, jolle saatiin Uudenmaanympäristökeskuksen päätös vuonna 2004 [4].Kunnostusurakoissa <strong>Helsingin</strong> <strong>Satama</strong> valvoi<strong>ja</strong> koordinoi hankkeita, joissa kaivu-urakoitsi<strong>ja</strong> <strong>ja</strong>ympäristökonsultti vastasivat hankkeiden käytännöntoteutuksesta. Ympäristövalvo<strong>ja</strong>n vastuulla onkäytännön tasolla ympäristöluvan määreiden noudattaminen.Myös urakoitsi<strong>ja</strong>n on välttämätöntäymmärtää kaivutyön ympäristövaateiden aiheuttamat,normaalista kaivutyöstä poikkeavat lisätyöt;Vuosaaressa tässä tavoitteessa onnistuttiin, <strong>ja</strong> yhteistyöntoimiessa voitiinkin todeta kaivutyön etenevänjopa edellä aikataulua. Työ todella eteni ripeästi,sillä kaluston määrässä ei säästelty; parhaimmillaankaivualueella puuhasi 11 kaivinkonetta, 3 dumpperia,4 kuorma-autoa, 2 pyöräkonetta (iltaisin 3) sekä2 seulaa (hetkittäin jopa kolme, kun samaan aikaanseulottiin pilaantuneita maita, savea <strong>ja</strong> turvetta).Normaalimiehityksen lisäksi jätealueita kunnostettaessakohteessa työskenteli 4– 6 käsilajitteli<strong>ja</strong>a.Ympäristöteknisen valvo<strong>ja</strong>n toimenkuvasta yksimerkittävimpiä osakokonaisuuksia on maaperänäytteenotto.Jatkuvassa massavirrassa valvo<strong>ja</strong>non oh<strong>ja</strong>ttava kaivumaita seulalle tai hyötykäyttöön,pilaantuneisuuden perusteella eri aumoihin <strong>ja</strong> loppusijoitukseen.Urakoitsi<strong>ja</strong>n on tiedettävä kalustotarvehyvissä ajoin etukäteen, joten ympäristövalvo<strong>ja</strong>n onmyös oltava selvillä siitä, paljonko <strong>ja</strong> minkä laatuisiamasso<strong>ja</strong> tullaan käsittelemään <strong>ja</strong> siirtämään.Ympäristötekninen valvo<strong>ja</strong> oh<strong>ja</strong>si kunnostustyötäyhteistyössä kaivu-urakoitsi<strong>ja</strong>n työjohdon kanssakaivusuunnitelman mukaisesti. Kaivunaikaisellavalvonnalla <strong>ja</strong> näytteenotolla varmistettiin tai tarkennettiintutkimusten avulla saatu<strong>ja</strong> tieto<strong>ja</strong> pilaantuneisuudesta.Kaivu suoritettiin alussa ns. Hot Spot-kaivuna, jolloin tutkimuksissa pilaantuneimmiksitodetut alueet pyrittiin poistamaan kaivualueeltaniin, että pilaantuneiden massojen poiston jälkeenkaivua voitaisiin <strong>ja</strong>tkaa puhtaiden maiden kaivutyönä.Em. tekniikka todettiin kuitenkin tuskastuttavanhitaaksi <strong>ja</strong> varsinkin puhtaiden maiden osoittamisensuhteen epävarmaksi.Kaivutyötä päätettiin <strong>ja</strong>tkaa rintamakaivunasiten, että kaivu- <strong>ja</strong> seulontajärjestyksessä otettiinhuomioon pilaantuneiden <strong>ja</strong> puhtaaksi arvioitujenmaa-alueiden si<strong>ja</strong>inti. Lisäksi kaikki kaivumaat seulottiin.Näin toimien saatiin kaivu etenemään aika-98 TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


PILAANTUNEENMAAN KAIVUVaihe A Vaihe B Vaihe CSeulonta AumausLoppusijoitusKuva 10.2Kaivumaiden käsittelynprosessikaavio.LaadunvarmistusNäytteenottoEnnakkotutkimuksetAnalyysituloksetMelumäki (kuormakir<strong>ja</strong>npito)Ulkopuoliset sijoituspaikat (siirtoasiakir<strong>ja</strong>t)Puhtaina hyötykäyttöönARSEENIMAIDENKAIVUSeulontaAumausLoppusijoitusLOPETUSNÄYTTEISTYSLaadunvarmistusNäytteenottoEnnakkotutkimuksetAnalyysituloksetHyötykäyttöön alueen täytöissä(ei pintamaahan)Jos As > RA, tai muu PIMA, VAIHEESEEN CPUHTAAN MAANKAIVUKaivunaikainen valvontaLoppusijoitusKaivetut alueetEristys, huomioverkkoMerkinnät karttoihinLaadunvarmistusNäytteenottoEnnakkotutkimuksetAnalyysituloksetjos PIMA-maitaVAIHEESEENAHyötykäyttöön alueen täytöissätaulussa <strong>ja</strong> maksimoitua hyötykäytettävän puhtaanmaan määrä, kuitenkaan heikentämättä ympäristöteknisenlaadunvalvonnan toimivuutta. Kaivun prosessikaavioon esitetty kuvassa 10.2.Kaivualueilta massat kuljetettiin esikäsittely- <strong>ja</strong>välivarastointialueelle. Esikäsittelyvaiheessa kaivetuistamassoista eroteltiin koneellisesti <strong>ja</strong> usein pelkkänäkäsityönä lajittelulin<strong>ja</strong>stolla jäte<strong>ja</strong>keet, jotkaolisivat muutoin aiheuttaneet seulan tukkeutumisia<strong>ja</strong> vaikeuttaneet seulontaprosessia. Lisäksi jäte<strong>ja</strong>keetolisivat rajoittaneet massojen hyötykäyttöä <strong>ja</strong> aiheuttaneethuomattavia lisäkustannuksia massojen loppusijoituksessa.Erottelun jälkeen massat seulottiin <strong>ja</strong> sijoitettiinaumoihin aidatulle alueelle asfaltoidulle esikäsittelykentälle.Samaan aumaan sijoitettiin vain maaaineksia,joiden pilaantuneisuus oli samankaltainen.Aumoille kasatuista massoista otettiin kokoomanäytteitähaitta-ainepitoisuustutkimuksiin. Näytteistäanalysoitiin haitta-ainepitoisuuksia kenttätestein, <strong>ja</strong>määrävälein pitoisuudet varmennettiin laboratorioanalyysein.Tulosten perusteella maamassat oh<strong>ja</strong>t-Kuva 10.3Yleiskuva välivarastokentältä.Kuvassaseulottu<strong>ja</strong> maa-aineksiaaumalla odottamassanäytteenottoa.Kuva: Ville LeppänenTELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö99


tiin loppusijoituspaikkoihinsa. Puhdas seulaylitesekä puhtaaksi todetut seula-alitteet hyötykäytettiin<strong>satama</strong>keskuksen alueen täytöissä. Kunnostuksenaikaisten oh<strong>ja</strong>us- <strong>ja</strong> laadunvarmennusnäytteidenmäärä on esitetty taulukossa 10.4.Varsinaisen laadunvalvontaan liittyvän näytteenotonlisäksi kaivumaiden laatua seurattiin <strong>ja</strong>tkuvastikenttähavainnoin, <strong>ja</strong> normaalista poikkeava haju,väri tai maan seassa havaitut jäte<strong>ja</strong>keet käynnistivätvälittömästi kyseisen alueen tai maa-aineseräntarkemman analysoinnin. Lisäksi ympäristövalvo<strong>ja</strong>vastasi kentällä tapahtuvasta haitta-aineiden työsuojeluohjeistuksesta.Urakka-alueella si<strong>ja</strong>inneita ainoastaan lievästikohonneita luontaisia arseenipitoisuuksia sisältäviämaita ei erikseen kaivettu, elleivät suunnitellutkaivutasot sitä edellyttäneet. Kaivetut, pelkästäänlieviä arseenipitoisuuksia sisältäneet maat seulottiin<strong>ja</strong> sijoitettiin <strong>Vuosaaren</strong> <strong>satama</strong>-alueelle hyötykäyttöön.10.4.2 Maaperän kunnostuksen tunnusluvutPilaantuneiden alueiden kunnostuksen tunnusluku<strong>ja</strong>on esitetty taulukossa 10.5. Pilaantuneita maita kunnostettiinyhteensä lähes 150 000 m³. Pilaantuneidenmassojen loppusijoituksessa Melumäen osuusoli ratkaiseva. Kaikista pilaantuneista maista lähes90 % sijoitettiin Melumäkeen. Näin alueen ulkopuolellepilaantuneen maan ajo saatiin minimoitua, <strong>ja</strong>kunnostustyön vaikutukset lähialueen luontoon <strong>ja</strong>mm. liikenteeseen jäivät varsin vähäisiksi.Yhteensä lähes 93 % kaivualueista saatiin kunnostettuapuhtaaksi. Orgaanisia haitta-aineita eialueelle jäänyt (maalijätealueen poh<strong>ja</strong>a lukuunottamatta)lainkaan. Metallipitoisia maita eristettiinlupamääreiden mukaisesti kaivutasoihin loput7 % alueesta. Tylsien tunnuslukujen taakse kätkeytyyuseita haastavia osaprojekte<strong>ja</strong>, joista jokainenhaastoi kunnosta<strong>ja</strong>t huippusuorituksiin tavoitteidensaavuttamiseksi. Kohdassa 10.5 on esitelty kaksi tällaistaerityiskohdetta.Taulukko 10.4Valvonnan oh<strong>ja</strong>us<strong>ja</strong>laadunvarmennusnäytteet.Valvontavaihe NäytemääräKenttämittauksetLaboratorioanalyysitOrgaaniset Metallit Metallit PCB TBT Öljyt PAHKaivun oh<strong>ja</strong>us 401 20 668 58 23 10 7 1Auma-näytteet 1217 14 2238 205 85 9 26 1Lopetusnäytteet 842 38 1282 61 174 27 108 -Yhteensä 2460 72 4188 324 282 46 141 2Taulukko 10.5Telakka-alueenpilaantuneen maaperänkunnostusvaiheet,pinta-alat <strong>ja</strong> poistetutpilaantuneet massat.Urakkavaihe Aika Alueen koko, m² Melumäkeen / vaihe Pilaantuneet yhteensä / vaiheMaalijätealue 11/02-5/03 4 000 - 4 000SMRU 4/1 10/04-1/05 25 000 38 500 44 500SMRU 4/2 6/05-11/05 69 000 22 000 28 000SMRU 4/3 5/06-2/07 212000 34 000 37 000SMRU 4/4 4/07-12/07 212 000 32 000 32 500Yhteensä 522 000 126 500 146 00010.5 Esimerkkejä erityishaasteista10.5.1 Maalijätealue<strong>Vuosaaren</strong> telakka-alueen maaperän kunnostus päätettiinaloittaa etukäteen vaikeimmin kunnostettavaksiarvioidusta alueesta, eli ns. maalijätealueesta.Maalijätealueen kunnostus toteutettiin marraskuun2002 <strong>ja</strong> toukokuun 2003 välisenä aikana. Tämämereen rajoittuva lähes 4 000 m² suuruinen alue olira<strong>ja</strong>ttu louhepenkereillä kolmelta maanpuoliseltasivultaan. Alueen pintamaassa oli vain ohut hiekkakerros;pääosa alueesta oli täytetty hiekkapuhallusjätteellä,jonka sekaan oli aumoina haudattu sato<strong>ja</strong>maaliastioita. Muusta jätetäytöstä mainittakoon mm.auton <strong>ja</strong> laivan romu<strong>ja</strong>, metalli- <strong>ja</strong> rakennusjätettä,vanhan merilaiturin jäänteet, sekä akku<strong>ja</strong>, hello<strong>ja</strong>,kaasunaamareita, jopa sairaalajätettä (tippa- <strong>ja</strong>plasmapullo<strong>ja</strong>) ym. tarpeetonta tavaraa. Raskasmetalleilla,PCB-yhdisteillä, öljyllä <strong>ja</strong> liuottimillapilaantunutta täyttöä oli yli 3 m:n paksuudelta, lähesmerenpinnan tasoon saakka. Poh<strong>ja</strong>lla todettiin louhetäyttö.Jätteestä <strong>ja</strong> haitta-aineista johtuen alueen kunnostaminenoli erittäin hidasta. Jätteitä jouduttiin lajittelemaankäsin ennen varsinaista seulontaa. Välillä100 TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 10.4MaalijätealueKuva: Ville Leppänenliuottimen hajun <strong>ja</strong> maalipönttöjen käsittelyn takiatyötä tehtiin erityissuo<strong>ja</strong>puvuissa <strong>ja</strong> hengityksensuo<strong>ja</strong>imet kasvoilla. Kaivuvaihe jouduttiin lisäksikeskeyttämään kovan pakkasen johdosta. Kunnostuksenhitaasti edetessä havaittiin, että ympäristölupapäätöksentavoitepitoisuuksia ei maalijätealueellapystytä täysimääräisesti toteuttamaan. Kaivu jouduttiinlopettamaan noin 3 m:n syvyyteen lähellemeren pinnan tasoa. Syvemmälle kaivettaessa louheenvälitiloista pilaantunutta hiekkaa ei enää saatukaivinkoneella poistettua, vaan se valui syvemmällelouheen sekaan, kunnes vesi täytti kaivukohdan.Kaivannon poh<strong>ja</strong>lle jääneiden lupapäätöksen tavoitepitoisuudetylittävien haitta-aineiden (öljy <strong>ja</strong> PCB)mahdollista kulkeutumista mereen arvioitiin erillisessäriskinarviossa. Riskinarviossa todettiin, etteivätem. haitta-aineiden pitoisuudet aiheuta merkittävääkulkeutumisriskiä kohteessa. Uudenmaan ympäristökeskushyväksyi maalijätealueen riskinarviopoh<strong>ja</strong>isenkunnostusratkaisun. Kaivualueen poh<strong>ja</strong>npilaantuneet maat eristettiin puhtaista maista havainnointiverkolla<strong>ja</strong> eristekerroksella.Tässä vaiheessa maaperän organotinayhdisteille eiollut asetettu<strong>ja</strong> tavoitepitoisuuksia. Maalijätettä käsiteltiinongelmajätteenä, <strong>ja</strong> siinä todettujen liuotin<strong>ja</strong>PCB-pitoisuuksien alhaisten tavoitepitoisuuksienkatsottiin olevan riittäviä poistamaan myös mahdollisestiorganotinayhdisteillä pilaantuneet massat kohteesta.Kun maalijätteet oli poistettu <strong>ja</strong> alue kunnostettu,kohteen viereen asennetusta poh<strong>ja</strong>vesiputkestaotetusta vesinäytteestä päätettiin kuitenkin analysoidamyös TBT-pitoisuus. Poh<strong>ja</strong>vedessä todettiinkinmerkkejä tributyylitinasta (TBT-pitoisuus 10 ng/l). Todetun TBT-pitoisuuden mahdollisista haittavaikutuksistaläheisen vesiympäristön laatuun tehtiinerillinen arviointi, jossa todettiin, että kunnostetunmaalijätealueen poh<strong>ja</strong>veden tilaa ei ole tarpeenem. pitoisuuksien takia asettaa <strong>ja</strong>tkoseurantaan.Ensimmäinen kunnostusvaihe, vaikkakin massamäärältäänvähäinen, opetti kohteen ympäristöteknisestäluonteesta paljon <strong>ja</strong> antoi a<strong>ja</strong>ttelemisenaihetta aloittaessamme valmistelun ensimmäistälaa<strong>ja</strong>-alaista kunnostusurakkaa, vaihetta SMRU 4/1varten. Ensinnäkin oli ilmeistä, että telakka-alueenmaaperästä tulisi vielä pal<strong>ja</strong>stumaan yllätyksiä, joitaei ennakkotutkimuksissa ollut todettu. Lisäksi tehtiinpäätös organotinayhdisteiden <strong>ja</strong> PCB-yhdisteidentehostetusta tarkkailusta.Kuva 10.5Maalijätealueenkunnostus käynnissä.Kuva: Ville LeppänenTELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö101


TBT-pitoisuuksien seurannassa oltiin tilanteessa,missä toisaalta organotinojen pitoisuuksia tuli analysoida<strong>ja</strong> seurata, mutta mahdollisesti todettaviapitoisuuksia ei voinut verrata mihinkään, silläorganotinojen maaperäpitoisuuksille ei ollut asetettuympäristö- tai terveysperusteisia tavoitepitoisuuksia.Tämä ongelma muodosti haasteen, joka kulminoituikonsulttien, <strong>Helsingin</strong> <strong>Satama</strong>n <strong>ja</strong> <strong>Helsingin</strong> kaupunginkiinteistöviraston yhteistutkimushankkeeseen,jonka lopputuloksena esiteltiin mm. turvallisia terveysperusteisiapitoisuustaso<strong>ja</strong> TBT-yhdisteille maaperässä[5]. Selvityksen tuloksia voitiin hyödyntääkunnostuksessa <strong>ja</strong> kaivumaiden loppusijoituksessaVuosaaressa; kohteessa todetut organotinojen pitoisuudetolivat riittävän alhaisia massojen turvallisellesijoittamiselle Melumäkeen. Julkaisun tuloksia hyödynnettiinmyös uudessa PIMA-asetuksessa organotinayhdisteidentavoitepitoisuuksia asetettaessa.10.5.2 JätetäyttöalueKaivuvaiheen SMRU 4/3 aikana koettiin epämieluisayllätys, kun maaperässä todettiin laa<strong>ja</strong>-alainen jätetäyttöalue.Alueen ennakkotutkimuksissa yhtenäistäjätetäyttöä ei ollut todettu. Syynä tähän oli se, ettäalueella tutkimuksen aikana si<strong>ja</strong>inneet toiminnot,maanpäälliset <strong>ja</strong> -alaiset rakenteet sekä aitaukset <strong>ja</strong>tiestö estivät koekuoppien kaivamisen, eikä kairaamallasaaduista maanäytteistä kyetty tulkitsemaanjätetäytön laajuutta oikein. Lisäksi jätetäyttö si<strong>ja</strong>itsiyli 1 metrin paksuisen savitäyttökerroksen alla.Jätetäytössä todettiin mm. hitsauskaasupullo<strong>ja</strong>,uretaanisilppua, lauto<strong>ja</strong> <strong>ja</strong> muuta puujätettä, tiili<strong>ja</strong>betonijätettä, betoroc-mursketta, muovia, väri<strong>ja</strong>uhetta(jossa korkeita raskasmetallipitoisuuksia),kanto<strong>ja</strong> <strong>ja</strong> juurakoita, viemärijätettä, metallista sorvauslastujätettä<strong>ja</strong> hitsausjätteitä (joissa korkeitaraskasmetallipitoisuuksia), raudoituksia <strong>ja</strong> kaoliinimassaa.Osassa täyttömaita todettiin lisäksi kohonneitaarseenin, raskasmetallien <strong>ja</strong> PCB-yhdisteidenpitoisuuksia sekä öljyä, mikä entisestään hankaloittimassojen käsittelyä <strong>ja</strong> sijoittamista.Alueelta kaivettiin pelkkää jätetäyttöä yhteensäyli 20 000 m³. Jätteen poiston takia jouduttiin puhtaitamaita kaivamaan <strong>ja</strong> käsittelemään huomattavastiarvioitua enemmän. Alue jouduttiin lisäksikaivamaan huomattavasti rakentamisen vaatimaakaivutasoa syvemmäksi, joten täyttömaita jouduttiintuomaan alueelle enemmän kuin oli suunniteltu.Näin mittavan jätetäytön käsittelyyn <strong>ja</strong> poistoon eiollut etukäteen varauduttu, joten sen kunnostaminenaikataulussa pysyen vaati huomattavia lisäresursse<strong>ja</strong><strong>ja</strong> aiheutti mittavia lisäkustannuksia.Kuva 10.6Kuorma-auton lavaltapudonnut betonilohkareei onneksiaiheuttanut henkilövahinko<strong>ja</strong>.Kuva: Ville Leppänen10.6 TyösuojeluVuosia kestävä pilaantuneen maaperän kaivu <strong>ja</strong> kunnostustoteutettiin samaan aikaan <strong>satama</strong>n rakennustöidenkanssa. Operatiivisella alueella liikkui siispaljon kalustoa <strong>ja</strong> henkilöstöä useamman osaprojektinollessa käynnissä samanaikaisesti. Esimerkiksivaiheen 4/4 aikana <strong>Vuosaaren</strong> <strong>satama</strong>hankkeessatyöskenteli toistakymmentä urakoitsi<strong>ja</strong>a <strong>ja</strong> yli400 henkilöä. Työsuojelun suunnitteluun, toteuttamiseen<strong>ja</strong> valvontaan kiinnitettiin siis erityistä huomiotaalueella.Jokainen urakoitsi<strong>ja</strong> vastasi omaan toimintaansaliittyvästä työsuojelun suunnittelusta <strong>ja</strong> valvonnasta.Suo<strong>ja</strong>utumisohjeet <strong>ja</strong> -käytännöt haitta-ainepitoisiamaita käsiteltäessä sekä ensiapu- <strong>ja</strong> toimintaohjeetaltistumistapauksien varalta laati ympäristökonsultti.<strong>Satama</strong> vastasi työsuojelun yleisvalvonnasta<strong>ja</strong> koordinoinnista niin, että lupamääräysten työsuojeluvaateettäyttyivät, <strong>ja</strong> ettei ns. harmaita alueitaeri urakoiden työsuojelullisiin saumakohtiin päässytsyntymään.Normaalien työsuojelutoimien <strong>ja</strong> -varusteidenlisäksi pilaantuneen maan kohteissa työskenteleväthenkilöt kävivät määräajoin työterveyshuollossakemikaalialtistumista mittaavissa biomonitorointitutkimuksissa.Merkittävästi kohonneita haittaainepitoisuuksiaei em. tutkimuksissa todettu, mikäosaltaan todistaa suo<strong>ja</strong>ustoimenpiteiden onnistuneenhyvin.Mainittavia työtapaturmia sattui koko hankkeenaikana vain kaksi: Kunnostusvaiheessa 4/3 sattuionnettomuus, kun kaivinkoneen kuorma-autonlavalle nostama betonilohkare putosi takaisin kai-102 TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


vinkoneen päälle. Onnettomuudessa ei onneksiaiheutunut henkilövahinko<strong>ja</strong>. Toinen onnettomuustapahtui kunnostusvaiheessa 4/4, kun suljetulla työmaa-alueella<strong>satama</strong>n täyttöihin louhetta kuljettanutkuorma-auto joutui liian lähelle reunapengertä <strong>ja</strong>kaatui kyljelleen. Auton kuljetta<strong>ja</strong> loukkaantui tieltäajossa lievästi. Onnettomuudesta ei aiheutunut vaaraamuille työmaalla työskenteleville.Pienet työtapaturmat käsiteltiin viikkopalavereissa<strong>ja</strong> kor<strong>ja</strong>avat toimenpiteet, mikäli haaverin tailäheltä piti -tilanteen katsottiin aiheutuneen rakenteellisistapuutteista, toteutettiin välittömästi. Sairauspoissaoloihinjohtaneita työtapaturmia ei kokohankkeen aikana kir<strong>ja</strong>ttu ainoatakaan.10.7 Johtopäätökset<strong>Vuosaaren</strong> <strong>satama</strong>n maapoh<strong>ja</strong>n kunnostaminen alkoimaalijätealueen kaivulla loppuvuonna 2002 <strong>ja</strong> päättyitelakka-altaan ympäristön kunnostamiseen joulukuussa2007. Tänä aikana poistettiin noin 53 ha:nalueelta yhteensä yli 580 000 m³ maata. Tästä määrästälähes 150 000 m³ oli pilaantunutta. Kunnostuksenmittaluokkaa voi havainnollistaa esimerkiksitoteamalla, että kaivualue on kooltaan noin 72 täysimittaisen<strong>ja</strong>lkapallokentän kokoinen. Kaivetullakokonaismassamäärällä täyttäisi 5,5 kertaa vanhaneduskuntatalon. Poistetuilla pilaantuneilla maillakinsaataisiin vanha eduskuntatalo täytettyä, <strong>ja</strong> läheskoko lisärakennuskin.Merkittävin tekijä onnistuneen kunnostusprojektintakana oli eittämättä sujuva vuorovaikutus <strong>ja</strong> tiedonkulku<strong>Helsingin</strong> <strong>Satama</strong>n sekä suunnittelijoiden,toteuttajien <strong>ja</strong> ympäristöviranomaisten kesken. Alueenkunnosta<strong>ja</strong>t voivat todeta osallistuneensa Suomenmittakaavassa ainutkertaiseen hankkeeseen.Ympäristölupaehdot toteutettiin, <strong>ja</strong> nyt kun alue onkunnostettu, <strong>Helsingin</strong> Vuosaari on todennäköisestiyksi koko maailman puhtaimmista <strong>satama</strong>-alueista.L ä h t e e t1. Uudenmaan ympäristökeskuksen päätös (26. 9. 2002) noYS 1076, Dnro 0101Y1052-111. <strong>Vuosaaren</strong> telakka-alueenpilaantuneen maaperän kunnostamisesta.2. Lintinen Petri. Selvitys <strong>Helsingin</strong> <strong>Vuosaaren</strong> telakka-alueenmaaperän arseenin alkuperästä <strong>ja</strong> arseenin aiheuttamastaterveys- <strong>ja</strong> ympäristöriskistä. Geologian tutkimuskeskus2003.3. Uudenmaan ympäristökeskuksen päätös YS 1430, Dnro0101Y1052-12. Luontaisesti lievästi kohonneita arseenipitoisuuksiasisältävien maa-ainesten sijoittaminen<strong>satama</strong>keskuksen alueelle.4. Uudenmaan ympäristökeskuksen päätös (22. 6. 2004)no YS 711, Dnro UUS-2004-Y-11-121. Pilaantuneen maaperänvälivarastoinnista <strong>ja</strong> hyödyntämisestä Melumäenrakenteissa.5. Lukkari Tuomas, Koponen Kari, Tuomi Pirjo, Dahlbo Kim,Rossi Esko <strong>ja</strong> Järvinen Kimmo. Tributyylitina maaympäristössä:esiintyminen, vaikutukset <strong>ja</strong> riskit. SuomenYmpäristö 16:52. 2006.TELAKKA-ALUEEN PILAANTUNEEN MAAPERÄN KUNNOSTUS<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö103


11<strong>Satama</strong>keskuksen kehittäminenosana kaupunkia <strong>ja</strong> luontoympäristöä11.1 Taustaa <strong>ja</strong> kysymyksenasettelu<strong>ja</strong>Kuva 11.1<strong>Vuosaaren</strong> <strong>satama</strong>keskuksenlaajuusverrattuna <strong>Helsingin</strong>kantakaupunkiin.<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> sen viereinen yritysalue onlaa<strong>ja</strong> aluekokonaisuus, joka rakennetaan lähes kerrallavalmiiksi. Rakentamisalueen laajuutta kuvaahyvin se, että alue peittäisi suuren osan <strong>Helsingin</strong>kantakaupungista, kuten näkyy kuvassa 11.1. <strong>Satama</strong>nuloin laituri olisi Kata<strong>ja</strong>nokan eteläkärjessä <strong>ja</strong>tietunnelin suuaukko olisi Eduskuntatalon kohdalla.<strong>Satama</strong> <strong>ja</strong> yritysalue muodostavat yhdessä suurenlogistiikkakeskuksen, josta käytetään nykyisinjo vakiintunutta nimitystä <strong>Vuosaaren</strong> <strong>satama</strong>keskus.Alueen suunnittelun lähtökohtia ovat tavaroidenjoustava <strong>ja</strong> sujuva käsittely, siirtäminen <strong>ja</strong> kuljettaminen.Alueen kaikki toimi<strong>ja</strong>t pyrkivät tavaran nopeaanliikkumiseen. <strong>Vuosaaren</strong> <strong>satama</strong> on läpivirtaus<strong>satama</strong>,jossa tavara kuljetetaan yksiköitynä eli jokokonteissa tai rekoissa <strong>ja</strong> perävaunuissa. Toiminnanluonteesta johtuen alueelle rakennetaan laajo<strong>ja</strong> kenttäalueita<strong>ja</strong> suurimittakaavaisia rakennuksia. Koskalogistiset ratkaisut kehittyvät nopeasti, suunnitteluratkaisujenon oltava joustavia <strong>ja</strong> muunneltavia.<strong>Satama</strong>hankkeelle on ollut tyypillistä <strong>satama</strong>n<strong>ja</strong> yritysalueen voimakas toiminnallinen kehittäminenrakentamisen rinnalla. Rakennustyöt käynnistyivättammikuussa 2003 <strong>ja</strong> ava<strong>ja</strong>iset ovat marraskuunlopussa 2008. Logistiikka-alan toimijoille tämä onpitkä aika varsinkin, kun ajoittain on tullut esiin riskejä,että valmistuminen viivästyy. On ymmärrettävää,että toimi<strong>ja</strong>t lyövät omat ratkaisunsa kiinniniin myöhään kuin mahdollista. Tämä on edellyttänytjoustavuutta <strong>satama</strong>keskuksen suunnittelussa <strong>ja</strong>toteutuksessa.<strong>Satama</strong>n suunnittelun <strong>ja</strong> rakentamisen kehittyminenon dokumentoitu tilanneraportteihin, joita onlaadittu keskimäärin puolivuosittain. Tämän luvunlopussa on lueteltu laaditut tilanneraportit [1].<strong>Satama</strong>n suunnittelun <strong>ja</strong> rakentamisen kehittymistäkuvaavat myös kaupunginvaltuustolle tehdytesitykset, jotka liittyvät <strong>satama</strong>n ohjelmalisäyksiin<strong>ja</strong> <strong>satama</strong>an toiminnallisesti liittyvän alueen laajentamiseen[2].Tässä luvussa pyritään vastaamaan seuraaviinkysymyksiin:• Miten tuotannollisista tavoitteista voimakkaastilähtevässä alueen suunnittelussa <strong>ja</strong> toteutuksessasaadaan aikaan hyvää ympäristöä, hyvää kaupunkia?• Soveltuuko yksityiskohtainen asemakaava nopeaan<strong>ja</strong> muuttuvaan toteutukseen? Pitäisikö asemakaavoituksessaottaa huomioon alueen luonnenykyistä paremmin <strong>ja</strong> jättää nykyistä enemmäntilaa kehittämiselle?104 SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j a :Antti Mäkinen, DI, on toiminut <strong>Helsingin</strong> <strong>Satama</strong>n palveluksessa<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen valmistelu- <strong>ja</strong> kehittämistehtävissävuodesta 2001 <strong>ja</strong> 1. 11. 2004 lähtien projektinjohta<strong>ja</strong>na.11.2 Tavoitteena toimiva <strong>ja</strong> huoliteltu kokonaisuus11.2.1 Arkkitehtonisen yleissuunnittelunkäynnistäminen<strong>Vuosaaren</strong> <strong>satama</strong>n asemakaavaa laadittaessa päähuomiojouduttiin kohdistamaan ympäristövaikutuksiin<strong>ja</strong> kaavan käsittelyprosesseihin. Alueen yksityiskohtainenkaupunkikuvallinen tarkastelu ei silloinollut vielä mahdollista. Tarkoitus oli myöhemminlaatia rakentamista oh<strong>ja</strong>avat lähiympäristön suunnitteluohjeet.Näiden tarve tuli selkeästi esiin, kun<strong>satama</strong>n rakentamista ryhdyttiin toden teolla valmistelemaanvuonna 2001. Tällöin todettiin, että<strong>satama</strong>keskuksen kehittämiseen tarvitaan ”kaupunkikuvallisianuotte<strong>ja</strong>”. Olihan kysymyksessä laa<strong>ja</strong>alue <strong>Vuosaaren</strong> asuntoalueiden <strong>ja</strong> Natura-alueidenvieressä. Alueen tekninen luonne asetti ”nuottien”kehittämiselle erityisen haasteen.<strong>Helsingin</strong> <strong>Satama</strong> käynnisti syksyllä 2001 yhteistyössäkaupunkisuunnitteluviraston kanssa arkkitehtonisenyleissuunnitelman laatimisen koko<strong>satama</strong>keskuksen alueelle. Suunnitteli<strong>ja</strong> valittiintarjouskilpailulla. Tarjouksessa tuli olla korkeintaankaksi A4-sivua käsittävä kir<strong>ja</strong>llinen esitys siitä,kuinka tarjoa<strong>ja</strong> lähestyy tehtävää.Tehtävälle asetettiin seuraavia tavoitteita:<strong>Satama</strong>keskuksesta on tarkoitus kehittää toiminnallisesti<strong>ja</strong> visuaalisesti mielenkiintoinen osa merellistäHelsinkiä. Luonnossuunnittelulla pyritäänlöytämään alueelle toiminnallisesti monipuolinen,jäsennetty rakenne <strong>ja</strong> visuaalisesti persoonallinen<strong>ja</strong> korkeatasoinen ilme. Suunnittelun tavoitteena onmyös kohottaa <strong>Vuosaaren</strong> <strong>ja</strong> koko itäisen <strong>Helsingin</strong>arvostusta asuin- <strong>ja</strong> työpaikka-alueena.Tavoitteena on, että luonnossuunnitelmia voidaankäyttää alueen <strong>ja</strong> yksittäisten hankkeiden <strong>ja</strong>tkosuunnittelussaideasuunnitelmina. Tavoitteena on myös,että luonnossuunnitelmia voidaan käyttää hyväksialueen esittelyssä <strong>ja</strong> markkinoinnissa.Luonnossuunnitelmien laatimisen lähtökohtanaovat alueen asemakaava, alueelle laadittu kunnallistekninenyleissuunnitelma sekä <strong>satama</strong>n yleissuunnitelma<strong>ja</strong> <strong>satama</strong>n maaliikenneyhteyksien yleissuunnitelmat.Luonnossuunnittelun kohteena on koko <strong>satama</strong>keskuksenalue <strong>ja</strong> sen liittyminen ympäristöön.Tarkoitus ei ole kuitenkaan laatia alueesta kattaviasuunnitelmia, vaan kysymyksessä on ideasuunnittelu,jonka tavoitteena on jäsentää aluetta sekä ottaaesille joitakin kohtia sekä kehittää näille erityisillekohdille toiminnallinen <strong>ja</strong> kaupunkikuvallinen merkitys<strong>ja</strong> luonne. Samalla on kiinnitettävä huomiotaesitettävien ratkaisujen toteuttamiskelpoisuuteen <strong>ja</strong>kehittämismahdollisuuksiin.Parhaan tarjouksen tekijäksi arvioitiin ArkkitehtityöhuoneArtto Palo Rossi Tikka Oy, jossa vastuuhenkilönäoli arkkitehti Teemu Palo.Kuva 11.2Havainnekuva<strong>satama</strong>keskuksesta,ArkkitehtityöhuoneArtto Palo Rossi Tikka OySATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö105


11.2.2 Arkkitehtoninen yleissuunnittelukiinteäksi osaksi suunnitteluprosessiaKoko <strong>satama</strong>keskuksen arkkitehtonisen yleissuunnitelmanensimmäinen versio valmistui toukokuussa2002. Tästä arkkitehtonisesta yleissuunnitelmastakäynnistyi prosessi, joka on <strong>ja</strong>tkunut koko rakentamisena<strong>ja</strong>n. Teemu Palosta avustajineen tuli keskeinentoimi<strong>ja</strong> <strong>satama</strong>n <strong>ja</strong> <strong>satama</strong>n yritysalueensuunnittelu- <strong>ja</strong> rakentamisprosessiin. Tämä oli tärkeälisä <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen valmisteluun <strong>ja</strong>toteutukseen, jota ovat kaiken kaikkiaan sävyttäneetympäristövastuullisuus <strong>ja</strong> innovatiivisuus. Ongelmaksikoettu laa<strong>ja</strong> tekninen kokonaisuus muutettiinaidosti haasteiksi. Avoin <strong>ja</strong> vuorovaikutteinen suunnitteluinnosti luoviin ratkaisuihin.Laa<strong>ja</strong> kokonaisuus pysyi kaupunkikuvallisestihallinnassa <strong>ja</strong> samalla saatiin <strong>satama</strong>keskuksestahavainnemateriaalia, jota käytettiin esitteissä, nettisivuilla<strong>ja</strong> esittelytilaisuuksissa. Arkkitehtien luoma<strong>satama</strong>keskuksen visuaalinen ilme tavallaan ”brändäsi”koko hankkeen. Alueen ilme perustui toiminnallisuuteen,mutta oli samalla huoliteltu <strong>ja</strong> inhimillinen.Alueen huolitellulle kokonaisilmeelle oli perusteenamyös se, että logistiikka-alan arvostusta pyrittiinnostamaan <strong>ja</strong> tekemään alueesta houkuttelevatyöpaikka.Teemu Palo luonnehtii itse prosessia seuraavalla tavalla:Arkkitehdin suuria haaveita on päästä “valkoisen pöydän” ääreen, aloittamaan suunnittelu puhtaalta pöydältä. Konkreettisestitämä toteutui tässä toimeksiannossa, kun suunnittelun lähtötiedoiksi annetussa kaavaluonnoksessa <strong>satama</strong>nalue oli merkitty valkoisella <strong>satama</strong>toimintojen alueeksi. Tätä valkoista aluetta lähdettiin täyttämään uusilla a<strong>ja</strong>tuksilla<strong>satama</strong>n toiminnasta <strong>ja</strong> ilmeestä. Ainoaksi päämääräksi sovittiin, että kun <strong>Vuosaaren</strong> <strong>satama</strong>sta ei voi tehdämaailman suurinta <strong>satama</strong>a, tehdään siitä sitten uusin <strong>ja</strong> paras. “Siinä teille vähän haastetta”, todettiin ensimmäisenkokouksen päätteeksi.Kaupunkisuunnittelu on puhtaimmillaan tulevaisuuteen tähtäävää, ennakkoluulotonta uusien tarpeiden <strong>ja</strong> muotojenhakemista. <strong>Satama</strong>n kaupunkikuvallinen ilme on luonteeltaan dynaaminen <strong>ja</strong> voimakkaan neliulotteinen. Liikkuvatelementit, laivat, kontit <strong>ja</strong> koneet, muuttavat päivittäin <strong>satama</strong>n kaupunkikuvallista ilmettä. <strong>Satama</strong>n alueella ”katutila”siirtyy, konttitalot kasvavat <strong>ja</strong> muuttuvat. Tästä <strong>ja</strong>tkuvasti muuttuvan kaupungin a<strong>ja</strong>tuksesta löytyi suunnitteluunkiehtova punainen lanka. Missään vaiheessa ei tässä hankkeessa ole ollut liian myöhäistä vielä kerran hakea <strong>ja</strong> testatauusia a<strong>ja</strong>tuksia <strong>ja</strong> muuttaa aiemmin tehtyjä suunnitelmia.Uusien ideoiden testaaminen on helppoa. Arkkitehtuuria ei synny ilman, että Vitruviuksen teoksessaan De Architectura(Arkkitehtuurista, todennäköisesti vuodelta 15 eaa.) esittämät kolme teesiä, firmitas, utilitas, venustas, täyttyvät.Kaikkea hyvää rakentamista voi kuvata määreillä kestävä, käytettävä <strong>ja</strong> kaunis tai toisin sanoin vain lu<strong>ja</strong>, käyttökelpoinen<strong>ja</strong> vaikuttava on hyvää rakentamista.Kuva 11.3<strong>Satama</strong>-alueenmeluseinä.Taustalla 13-kerroksinenGatehouse,<strong>Vuosaaren</strong>huippu<strong>ja</strong> 40 metriä korkeitavalaisinpylväitä.Kuva: Carita Kottila106 SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


11.3 Mielenkiintoisia rakennuskohteitaArkkitehtonisen yleissuunnittelun alkuperäinentavoite oli kokonaisuuden hallinta. Yleissuunnitelmanpoh<strong>ja</strong>lta suunniteltiin <strong>ja</strong> rakennettiin myöseräitä <strong>satama</strong>keskuksen näkyviä osia.11.3.1 MeluseinäEniten huomiota on herättänyt <strong>satama</strong>n koillisreunaanrakennettu betonirakenteinen 13 m korkeameluseinä, joka on pituudeltaan noin kilometrinmittainen. Ra<strong>ja</strong> aktiivisen <strong>satama</strong>-alueen <strong>ja</strong> luontoalueenväliin on tehty voimakkaaksi <strong>ja</strong> selkeäksi.Seinän eteläkärkeen on rakennettu yleiseen käyttöönnäköalatasanne, josta voi tarkkailla sekä <strong>satama</strong>toiminto<strong>ja</strong>että luontoalueita. Meluseinän rakenteenaolevat sivumitaltaan nelimetriset ”betonitölkit” täytettiinhiilivoimalaitosten poh<strong>ja</strong>tuhkalla, joille onkaupunkialueelta vaikea löytää sijoituspaikko<strong>ja</strong>.Linnuston elinolo<strong>ja</strong> monipuolistetaan perustamallameluseinän takana si<strong>ja</strong>itsevien Varissaaren<strong>ja</strong> Kalkkisaaren väliin alue vesi- <strong>ja</strong> kahlaa<strong>ja</strong>lintu<strong>ja</strong>varten. Alueesta käytetään nimitystä Auringonnousunranta,mutta tulevaisuudessa rantavyöhykeon tarkoitus nimetä Martin Meinanderin rannaksiedesmenneen apulaiskaupunginjohta<strong>ja</strong>n kunniaksi.Meinander oli luonnontieteilijä, joka apulaiskaupunginjohta<strong>ja</strong>navaikutti voimakkaasti <strong>satama</strong>hankkeentoteutumiseen. Näin aluksi ongelmalliseksi koettukovan infran <strong>ja</strong> luonnon vastakkainasettelu kohentaakinympäristöä.11.3.2 <strong>Satama</strong>n valaistusMeluseinääkin näkyvämpi kehittämiskohde on ollut<strong>satama</strong>n aluevalaistuksen suunnittelu sekä sen toteutukseenliittyneet kenttäkokeet <strong>ja</strong> mittaukset.<strong>Satama</strong>n aluevalaistuksen suunnittelusta vuonna2005 järjestetyssä kilpailussa yhtenä tärkeänä tavoitteenaoli suojelu- <strong>ja</strong> virkistysalueille kohdistuvanha<strong>ja</strong>säteilyn eli valosaasteen minimointi. Valon laatuunkiinnitettiin erityistä huomiota. Tärkeätä olimyös saada valaisinmastoista muodostumaan mielenkiintoinen<strong>satama</strong>-aluetta jäsentävä maisemapäivänvalossa. Kilpailun voitti ArkkitehtityöhuoneArtto Palo Rossi Tikka Oy ehdotuksellaan Azur,jossa oli kiinnitetty huomiota myös itse valon väriin<strong>ja</strong> värintoistokykyyn. Valkoinen valo luo tilaan hyvänvärintoiston <strong>ja</strong> parantaa työntekijöiden vireystilaa.Kuva 11.4ArkkitehtityöhuoneArtto Palo Rossi Tikka Oyvoitti ehdotuksellaanAZUR <strong>satama</strong>n valaistuskilpailun.SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö107


Kuva 11.5<strong>Satama</strong>n mastovalaisinLämpimällä valkoisella valolla on <strong>satama</strong>n ulkoalueillaerittäin tärkeä työturvallisuutta parantava merkitys.<strong>Satama</strong>-alueella mastot ovat 40 m korkeita.Voittaneen ehdotuksen poh<strong>ja</strong>lta käynnistettiinSuomen oloissa poikkeuksellisen laa<strong>ja</strong> <strong>ja</strong>tkosuunnittelu-<strong>ja</strong> selvitystyö. Syksyllä 2006 <strong>satama</strong>n alueellepystytettiin koemasto. Valaistusta selvitettiinasentamalla koemastoon erilaisia valaisintyyppejä<strong>ja</strong> niiden yhdistelmiä. Laadullinen vertailu tehtiinkattavien valoteknisten mittausten <strong>ja</strong> simulointienperusteella. Taloudellista arviointia varten tehtiinelinkaarikustannusvertailu eri ratkaisumallien kesken.Mastorakenteen käyttäytymistä selvitettiin laskelmin<strong>ja</strong> mittauksin. <strong>Helsingin</strong> Energian valaistusasiantunti<strong>ja</strong>tvastasivat kehittämisprosessista.Ensivaikutelman perusteella ratkaisu on sekäpäivä- että yöolosuhteissa onnistunut. Samantyyppistä,mutta 30 m korkeaa mastoa, käytetään porttialueella<strong>ja</strong> logistiikka-alueella.11.3.3 MelumäkiAsemakaava edellytti <strong>satama</strong>-alueen koillisnurkkaanrakennettavaksi 15 m korkean tekomäen, joka toimiimelusuo<strong>ja</strong>na Natura-alueen suuntaan. Arkkitehtonisessayleissuunnitelmassa tekomäelle, joka sittemminnimettiin Porvarinmäeksi, luotiin huoliteltukokonaismuoto sekä periaatteet pengerrysrakenteiden<strong>ja</strong> istutusten toteuttamiselle.Porvarinmäellä oli tärkeä rooli rakentamisprosessissa.Sinne sijoitettiin pääosa telakka-alueeltapoistetuista pilaantuneista maamassoista. Vain voimakkaimminpilaantuneet kaivumaat jouduttiin toimittamaanpois <strong>satama</strong>keskuksen alueelta erillisiinkäsittelylaitoksiin. Porvarinmäkeen sijoitettiinyhteensä noin 130 000 m³ pilaantuneita maamasso<strong>ja</strong>.11.3.4 Jalankulkusilta <strong>ja</strong> tekniikkapalkit<strong>Satama</strong>n pääportille tullaan tietunnelista <strong>satama</strong>tietäpitkin. Tien molemmin puolin on laa<strong>ja</strong>t rekkojenpysäköintialueet. Sisääntulon korostamiseksi<strong>ja</strong> alueen jäsentämiseksi <strong>satama</strong>tielle tunnelin suuaukon<strong>ja</strong> <strong>satama</strong>n pääportin välille rakennettiin lu<strong>ja</strong>rakenteisetporttaalit, ns. tekniikkapalkit. Niihin onkiinnitetty opasteita <strong>ja</strong> viitoitusta sekä valaisimia.Tekniikkapalkeilla luodaan alueelle identiteettiä <strong>ja</strong>paikan tuntua. Ollaan Suomen ulkomaankaupanpää<strong>satama</strong>ssa, ei missä tahansa <strong>satama</strong>ssa.Tekniikkapalkkien jäsentämä julkinen liikennealuera<strong>ja</strong>utuu valvottuun <strong>satama</strong>-alueeseen kokoporttialueen yli johtavan <strong>ja</strong>lankulkusillan kohdalla.Silta on 280 m pitkä <strong>ja</strong> se on kaikille avointa aluetta.Silta liittää tullin tarkastusalueen <strong>ja</strong> Finnsteve OyAb:n huoltoalueen joustavasti Gatehouseen. Se toimiikuitenkin myös julkisena yhteytenä <strong>satama</strong>nkoillispuolella oleville luontoalueille. Se tarjoaasuurelle yleisölle hyvän paikan <strong>satama</strong>n liikenteen<strong>ja</strong> toiminnan seuraamiseen.11.3.5 Logistiikka-alue<strong>Satama</strong>n viereen rakennettavan logistiikka-alueenperusratkaisu läpivirtausterminaaleineen kehitettiinarkkitehdin <strong>ja</strong> logistiikan ammattilaisten yhteistyönä.Tavoitteena oli tehdä alueesta maksimaalisentehokas <strong>ja</strong> saada samalla aikaan kaupunkikuvallisestihallittu <strong>ja</strong> huoliteltu työympäristö.Kehittämisprosessi kesti useita vuosia <strong>ja</strong> lopullisenratkaisun logistiikka-alueen muoto sai alueentoteuttamisesta käydyssä tarjouskilpailussa. Kilpailussasyntyneessä kokonaisratkaisussa alue onjäsennetty selkeästi. Se on myös sekä toiminnallisestiettä visuaalisesti hyvä. Alueen käyttö on tehokasta<strong>ja</strong> joustavaa.Kuva 11.6Näkymä <strong>ja</strong>lankulkusillansisältä.Kuva: Teemu Palo108 SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 11.7<strong>Satama</strong>tientekniikkapalkit.Kuva: Juha Kuokkanen/ Illusia.bizKuva 11.8Finnsteven huoltoalue,Arkkitehtitoimisto KariUnelius Oy, ArkkitehtitoimistoVIA Oy.Valokuva: Soile Kallio11.3.6 Muuntamot<strong>Satama</strong>ssa on laajo<strong>ja</strong> kenttäalueita, joissa on pääasiassavain kontte<strong>ja</strong> sekä rekko<strong>ja</strong> <strong>ja</strong> perävaunu<strong>ja</strong>.Siellä täällä on kuitenkin pienehköjä rakennuksia,joissa on muuntamoita, vesso<strong>ja</strong>, varasto<strong>ja</strong> tai joitainmuita tarvittavia pieniä tilo<strong>ja</strong>. Arkkitehtonisen yleissuunnitelmanviesti oli, että näille pikkurakennuksilleon perusteltua luoda selvä identiteetti, jotta neerottuvat kentillä olevista ”laatikoista”, konteista <strong>ja</strong>perävaunuista.Arkkitehtonisessa yleissuunnittelussa esitettyjensuuntaviivojen poh<strong>ja</strong>lta LAB arkkitehdit Oy(arkkitehti Ari Bungers) kehitti näihin <strong>satama</strong>kentän”mökkeihin” sopivan ulkoisen ilmeen. Ne ovatherättäneet myönteistä huomiota. Niitä on mm.nimitetty ”pikkukiasmoiksi”. Niillä on kiistatontahuomioarvoa, jota voidaan <strong>ja</strong>tkossa hyödyntää <strong>Vuosaaren</strong>julkisessa kuvassa.SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö109


Ari Bungers kuvaa suunnitteluprosessia seuraavasti:Suunnitteluvaiheessa kiersimme jonkin verran <strong>satama</strong>kentillä mm. Ruoholahdessa tarkkailemassa konttimaisemaa:muotokieltä <strong>ja</strong> konttien kir<strong>ja</strong>vaa värimaailmaa. Tarkastelun tuloksena syntyi sar<strong>ja</strong> ehdotuksia, joissa rakennustenmuotokielellä haettiin vastakohtaa <strong>satama</strong>kentän laatikkomaisesta maisemasta.Luonnossuunnittelun edetessä lisäsimme rakennusten muotokieleen <strong>ja</strong> väriin symboliikkaa sähköä muuntavastakuparikäämistä <strong>ja</strong> valkoisista keraamisista eristeistä. Tässä vaiheessa toimistossamme hankkeen työnimenäoli käämin englanninkielinen nimi coil. Kun luonnokset saivat tilaa<strong>ja</strong>n hyväksynnän, syntyneet a<strong>ja</strong>tukset muunnettiinrakennussuunnitelmiksi.Koko <strong>satama</strong>n suunnittelua kuvaa hyvin se, miten <strong>satama</strong>kentän logistisen ratkaisun muuttaminen on suunnitteluvaiheenedetessä siirtänyt <strong>ja</strong> pyörittänyt myös muuntamoiden si<strong>ja</strong>intia useaan otteeseen. Toivon, että rakennuksetovat onnistuneen toteutuksen kautta ilahduttamassa <strong>satama</strong>n asiakkaita <strong>ja</strong> käyttäjiä.Kuva 11.9<strong>Satama</strong>n laitetilarakennusVL17(muuntamo),LAB arkkitehdit OyValokuva: Tiia Ettala11.4 Asemakaavoituksen arviointia <strong>Vuosaaren</strong> <strong>satama</strong>n kokemusten poh<strong>ja</strong>lta11.4.1 <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristönasemakaava toteutuksen lähtökohtana<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaava [3]sisältää varsinaisen <strong>satama</strong>-alueen, <strong>satama</strong>n vieressäolevan yritysalueen sekä niiden pohjoispuolella olevanluontoalueen.Varsinainen <strong>satama</strong>-alue on asemakaavassa merkittyyhtenäiseksi alueeksi (merkintä LS-k: <strong>satama</strong>aluekunnan tarpeisiin), jossa harjoitetaan <strong>satama</strong>toiminto<strong>ja</strong>.Rakennusoikeus on määritetty yhdelläluvulla. Muita merkintöjä ei juuri ole. Asemakaavaon hyvin väljä. Se antaa suuren vapauden kehitellä<strong>satama</strong>toiminto<strong>ja</strong> <strong>ja</strong> suunnitella <strong>satama</strong>toimintaanliittyviä rakennuksia <strong>ja</strong> rakennelmia.Asemakaavaa laadittaessa <strong>satama</strong>n viereen sijoittuvanyritysalueen toiminnallista luonnetta <strong>ja</strong> sinnesijoittuvien yritysten tulevaisuuden tarpeita pyrittiinennakoimaan yhteistyössä <strong>Helsingin</strong> <strong>Satama</strong>n, kaupunkisuunnitteluviraston,kiinteistöviraston, raken-nusviraston <strong>ja</strong> ympäristökeskuksen kanssa. Poh<strong>ja</strong>naoli <strong>satama</strong>n perustamissuunnitelmassa esitetty konsepti<strong>ja</strong> pyrkimys tarjota sijoittumismahdollisuuksiamahdollisimman monenlaisille yrityksille. Suuretkorttelit kaavassa antavat mahdollisuuksia joustavuuteenyritysaluetta tarkemmin suunniteltaessa.Alueelle tulleiden toimintojen selkiytyminen taimuuttuminen ovat kuitenkin aiheuttaneet muutostarpeitamyös asemakaavaan.11.4.2 <strong>Satama</strong>n viereisen yritysalueensuunnittelu <strong>satama</strong>lähtöiseksi<strong>Satama</strong>n yritysalueen kehittämisen suunta määritettiin<strong>satama</strong>n rakentamispäätöksen (9. 10. 2002) yhteydessä,kun kaupunginvaltuusto päätti, että <strong>satama</strong>nviereisestä yritysalueesta kehitetään ensisi<strong>ja</strong>isesti<strong>satama</strong>an liittyvä toiminnallinen kokonaisuus, johon110 SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


sijoittuvat yritykset liittyvät <strong>satama</strong>n toimintoihin taihyödyntävät muutoin <strong>satama</strong>n naapuruutta. Samassayhteydessä päätettiin, että <strong>Helsingin</strong> <strong>Satama</strong> huolehtii<strong>Vuosaaren</strong> <strong>satama</strong>n viereisen yritysalueen kehittämisen,suunnittelun <strong>ja</strong> rakentamisen koordinoinnistayhteistyössä muiden virastojen <strong>ja</strong> laitosten kanssa.Nämä päätökset johtivat <strong>Helsingin</strong> <strong>Satama</strong>n <strong>ja</strong>kiinteistöviraston väliseen kehittämistyöhön, jonkaseurauksena merkittävä osa <strong>satama</strong>n viereisestä yritysalueestasiirrettiin <strong>Helsingin</strong> <strong>Satama</strong>n hallintaan.Samalla <strong>satama</strong>n <strong>ja</strong> yritysalueen muodostamastaaluekokonaisuudesta alettiin käyttää nimitystä <strong>Vuosaaren</strong><strong>satama</strong>keskus. Tässä yhteydessä kehitettiinerityisesti logistiikka-aluetta.Keskeinen vaikutin kehittämistyön taustalla olise, että <strong>satama</strong> <strong>ja</strong> sen liikenneyhteydet ovat kokonaisuutenasuuri investointi, joka pitää hyödyntäämahdollisimman tehokkaasti.11.4.3 Poikkeamia <strong>ja</strong> muutoksia asemakaavaan<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavan laatimisenjälkeen <strong>satama</strong>- <strong>ja</strong> yritysalue ovat nivoutuneetennakoitua kiinteämmäksi logistiseksi kokonaisuudeksi.Myös eri toimijoitten tarpeet ovat täsmentyneettai jopa kokonaan muuttuneet. <strong>Satama</strong>keskuksenalueen uudet ratkaisut edellyttivät monilta osinpoikkeamista voimassa olevasta asemakaavasta.Osa muutoksista voitiin hoitaa kaupunginhallituksenhyväksymin poikkeamispäätöksin.Liikenneyhteyksien <strong>ja</strong>tkosuunnittelun yhteydessäon avautunut mahdollisuuksia myös uusille innovatiivisilleratkaisuille. Esimerkiksi Laivanrakenta<strong>ja</strong>ntien(nykyisin <strong>Satama</strong>kaari) <strong>ja</strong> <strong>Satama</strong>tien eritasoliittymärakennettiin vähemmän tilaa vaativana kuinmihin kaavassa oli varauduttu. <strong>Satama</strong>n porttialuevoitiin näin suunnitella ottaen huomioon rahtiliikenteenlaajentuneet <strong>ja</strong> muuttuneet tilatarpeet. <strong>Satama</strong>npääportin edustan liikennejärjestelyjä jäsennettiinvoimakkaasti. Rekoille haluttiin luoda kunnollisetparkkialueet, joissa rekat voisivat myös yöpyä.Asemakaavassa porttialueen läpi menevälle <strong>ja</strong>lankululleoli merkitty alikulkutunneleita. Nämä todettiintoiminnallisesti ongelmallisiksi <strong>ja</strong> kustannuksiltaankalliiksi. Tunneleiden tilalle rakennettiin edelläkohdassa 11.3.4 kuvattu <strong>ja</strong>lankulkusilta.<strong>Satama</strong>n pääportin yhteyteen oli kaavoitettu porttirakennus,jonka kerrosluvuksi kaava oli määrittänytneljä. Portin edustalle oli kaavoitettu 12-kerroksinenhotellirakennus. Hotellille ei kuitenkaan ilmaantunuttarvetta, joten ko. tontti muutettiin rekkojenpysäköintialueeksi. <strong>Satama</strong>n pääportin yhteyteensuunnitellusta Gatehousesta tuli muutoksen yhteydessäalueen maamerkkinä toimiva 13-kerroksinentoimisto- <strong>ja</strong> palvelurakennus.Kuva 11.10<strong>Satama</strong>-alueella on sentoiminnan luonteestajohtuen laajo<strong>ja</strong> kenttiä<strong>ja</strong> suurimittakaavaisiarakennuksia.Kuvan keskellä on13-kerroksinen alueenmaamerkkinä toimivaGatehouse(Pöyry Architects).Kuva: Sami Kurikka/ SkylinefotoSATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö111


Logistiikka-alueen katujärjestelyt muutettiinuusien terminaalijärjestelyjen poh<strong>ja</strong>lta. Alueeltapoistettiin katu<strong>ja</strong>, jotka korvautuivat logistiikkakeskuksensisäisillä liikennealueilla.<strong>Helsingin</strong> <strong>Satama</strong>n hallinnassa oleville alueillekehitettiin yhteisväestönsuo<strong>ja</strong>järjestelmä, joka sisältää<strong>satama</strong>n pääportin yhteyteen rakennettavan pohjoisenkalliosuo<strong>ja</strong>n (3 600 suo<strong>ja</strong>paikkaa) <strong>ja</strong> eteläisenkalliosuo<strong>ja</strong>n (telakan vanha suo<strong>ja</strong>, 1 500 suo<strong>ja</strong>paikkaa).Muuttuvassa logistiikkaympäristössä ei oletarkoituksenmukaista toteuttaa talokohtaisia suojia.Lisäksi on perusteltua olla suo<strong>ja</strong>paikko<strong>ja</strong> liikkuvilleihmisille. <strong>Vuosaaren</strong> <strong>satama</strong> on strategisesti tärkeäkohde <strong>ja</strong> kalliosuojien suo<strong>ja</strong>ustaso on talokohtaisiasuojia merkittävästi parempi.Telakka-altaan käyttö oli asemakaavassa jäänytlopullisesti määrittelemättä. Telakkatoiminta ei tullutenää kysymykseen, koska suurten tankkialustenrakentamiseen suunniteltu telakka-allas ei sovellupienalusten kor<strong>ja</strong>amiseen. Allas todettiin kuitenkinrakenteellisesti hyväkuntoiseksi <strong>ja</strong> oli perusteltualöytää sille <strong>satama</strong>toimintoihin liittyvää hyötykäyttöä.Ensimmäisenä uutena käyttövaihtoehtonaaltaaseen kehitettiin maahantuotavien autojen kerrosvarasto6 000 henkilöautolle. Suunnitelmalle olijo rakennuslupa, tosin vain viideksi vuodeksi, koskaratkaisu ei ollut asemakaavan mukainen. Asemakaavanmuutosoli kuitenkin jo vireillä. Autovarastohankekuitenkin keskeytettiin, koska <strong>Helsingin</strong><strong>satama</strong>n päämaahantuo<strong>ja</strong> muutti logistista järjestelmäänsä.Autot tuodaan Vuosaareen, mutta toimitetaanmahdollisimman nopeasti edelleen ulos<strong>satama</strong>sta Pohjois-Vantaalle rakennettavaan uuteenlogistiikkakeskukseen.<strong>Helsingin</strong> <strong>Satama</strong> varautuu edelleen siihen, ettätelakka-altaaseen toteutetaan maahantuotavien autojenvarasto. Sitä tuskin toteutetaan koko altaan laajuisena.Toistaiseksi allasta kehitetään tyhjien konttienvarastoalueena. Siihen tarkoitukseen allas sopiihyvin, koska altaaseen voi pinota kymmenenkintyhjää konttia päällekkäin <strong>ja</strong> niitä voidaan käsitelläaltaan yläpuolelle mahdollisesti hankittavilla pukkinostureilla.Tulevaisuuden visio on tällä hetkellä se,että osaa altaasta käytetään maahantuotavien autojenvarastointiin <strong>ja</strong> osa tyhjien konttien varastointiin. Onmyös mahdollista, että altaalle löydetään jokin aivanmuu käyttömuoto.Muutokset <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön ase-112 SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 11.11<strong>Satama</strong>työmaayövalaistuksessa.<strong>Satama</strong>-alueenvalaistuksen yhtenätavoitteena oli suojelu<strong>ja</strong>virkistysalueillekohdistuvan valonha<strong>ja</strong>sätelyn minimointi.Kuva: Leif Rosas /Redstar Photoagencymakaavan mukaisista ratkaisuista ovat olleet selvästialueen sisäisen toiminnan järjestelyihin liittyviä.Niillä ei ole merkittäviä vaikutuksia <strong>satama</strong>keskuksenulkopuolelle. Muutoksiin oli jo osin varauduttuasemakaavaa laadittaessa.Laa<strong>ja</strong> asemakaavan muutos, johon edellä mainitutmuutokset, mm. <strong>satama</strong>n logistiikkakeskus,sisältyvät, on ollut virallisesti nähtävillä <strong>ja</strong> lausuntokierroksellakeväällä 2008. Viimeksi on valmisteltuasemakaavan muutos <strong>Vuosaaren</strong>lahden vene<strong>satama</strong>nalueelle. Siinä on varattu laituritilaa <strong>satama</strong>a<strong>ja</strong> merenkulkua palveleville toiminnoille kuten luotsille<strong>ja</strong> Merenkulkulaitokselle sekä saaristolaivojentelakalle. Samalla on vene<strong>satama</strong>a esitetty laajennettavaksin. 200 venepaikalla, niin että <strong>satama</strong>an tulisiyhteensä n. 1 100 venepaikkaa. Kaupunkisuunnittelulautakuntaon hyväksynyt asemakaavan muutosehdotuksen5. 6. 2008.Asemakaavasta poikkeamiset <strong>ja</strong> asemakaavanmuutoksen valmistelu on hoidettu rakennusvalvontavirastossa<strong>ja</strong> kaupunkisuunnitteluvirastossa joustavasti.Näiden virastojen <strong>ja</strong> <strong>Helsingin</strong> <strong>Satama</strong>n välinenyhteistyö on ollut tiivistä <strong>ja</strong> rakentavaa kokorakentamisprosessin a<strong>ja</strong>n.<strong>Satama</strong>n viereisellä yritysalueella on hyväksyttyasemakaavanmuutokset myös Oy Gustav Paulig Ab:nuutta kahvipaahtimoa, AAB Oy:n Azipod-tehdastasekä tietunnelin eteläpäähän tulevaa ABC-liikennemyymäläävarten.Viime mainitussa asemakaavanmuutoksessamuutettiin myös aluetta kiertävän pääkadun nimiLaivanrakenta<strong>ja</strong>ntiestä <strong>Satama</strong>kaareksi, joka kuvaaalueen käyttöä pitkälle tulevaisuuteen. <strong>Helsingin</strong>tavara<strong>satama</strong>llehan on Vuosaaressa luotu kehittämisedellytyksetpitkälle tulevaisuuteen.L Ä H T E E T1. <strong>Vuosaaren</strong> <strong>satama</strong>, <strong>satama</strong>n liikenneyhteydet <strong>ja</strong> yritysalue,Tilanneraportit10. 6. 2003, 1. 9. 2003, 28. 1. 2004, 21. 6. 2004, 1. 11. 2004(Khs 8. 11. 2004), 28. 2. 2005 (Khs 28. 2. 2005), 26. 9. 2005(Khs 3. 10. 2005), 26. 9. 2006 (Khs 2. 10. 2006), 15. 5. 2007(Khs 21. 5. 2007), 15. 11. 2007 (Khs 3. 12. 2007), 12. 5. 2008(Khs 2. 6. 2008)2. <strong>Helsingin</strong> kaupunginvaltuuston <strong>Vuosaaren</strong> <strong>satama</strong>akoskevat päätökset 9. 10. 2002, 14. 9. 2005, 17. 5. 2006,17. 1. 2007, 6. 6. 2007 <strong>ja</strong> 10. 10. 20073. <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaava nro10640 (Ympäristöministeriö 25. 1. 2002)SATAMAKESKUKSEN KEHITTÄMINEN OSANA KAUPUNKIA JA LUONTOYMPÄRISTÖÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö113


12<strong>Satama</strong>hankerakennusvalvonnan kannalta12.1 LuvitusKuva 12.1<strong>Vuosaaren</strong>Käärmenniemisyyskuussa 2003 ennenalueen tasaamista<strong>satama</strong>kentäksi.Kuva: Lauri Jääskeläinen<strong>Vuosaaren</strong> <strong>satama</strong> on ollut <strong>Helsingin</strong> rakennusvalvonnallekymmenen vuotta kestänyt jättiprojekti.<strong>Satama</strong>hankkeen todettiin jo sen alkuvaiheessa merkitsevänsato<strong>ja</strong> neuvottelu<strong>ja</strong> <strong>ja</strong> tuhansia työtunte<strong>ja</strong>rakentamista valvovalle viranomaiselle. Samallahanke koettiin mielenkiintoisena haasteena, jonkaeri vaiheet ovat tulleet tutuksi monelle rakennusvalvonnantyöntekijälle.Ensimmäiset yhteydenotot rakennusvalvontaanotti <strong>Vuosaaren</strong> <strong>satama</strong>n suunnittelun seurantaryhmämarraskuussa 1998. Käynnistettiin keskustelut, millaisiarakennuslainsäädännön tarkoittamia lupia<strong>satama</strong>n eri rakentumisen vaiheissa tarvitaan. Länsi-Suomen vesioikeus oli myöntänyt ensimmäiset luvatheinäkuussa 1998. Luvat käsittivät vesilain mukaisiaruoppauksia, täyttöjä, laitureiden rakentamista, merihiekanottamista ynnä muuta. Merenkulkulaitos olisaanut luvan 11 metrin väylän rakentamiseen. Vesioikeudenpäätöksestä oli valitettu. Valituskysymyksetolivat hankkeen alkuvaiheista lähtien mukanarakennusvalvonnan kanssa käydyissä keskusteluissa.Valitusten todettiin pahimmassa tapauksessa merkitsevänvuosien viivettä <strong>satama</strong>n toteuttamiselle.Uuden rakennuslain laatiminen oli pantu vireillevuonna 1996. Vuonna 1998 vaikutti jo todennäköiseltä,että monen aiemman karille a<strong>ja</strong>neen rakennuslainkokonaisuudistuksen jälkeen saadaan kokonaanuusi rakennuslaki vuonna 2000. Maankäyttö- <strong>ja</strong>rakennuslaki tulikin voimaan vuoden 2000 alusta.Kun ensimmäiset neuvottelut <strong>satama</strong>n tarvitsemistarakentamisen luvista perustuivat vielä vanhan rakennuslainkäytäntöihin, tuli vuosituhannen vaihduttuajo ottaa huomioon uusi laki siirtymäsäännöksineen.Helsingissä rakentaminen tukeutuu lähes ainavoimassa oleviin asemakaavoihin. Selvää oli, etteiuuden <strong>satama</strong>n kaltaista hanketta voitu lähteä toteuttamaanilman asianmukaisia maankäytöllisiä suunnitelmia.Valtuusto hyväksyi <strong>satama</strong>lle asemakaavanjoulukuussa 1999. Mutta vasta vuonna 2002 saatiinkorkeimman hallinto-oikeuden päätökset niin asemakaavastakuin seutukaavasta. Siihen saakka elettiinkaavoituksellisesti keskeneräisessä tilanteessa.Kaavoituksen keskeneräisyys ei rakennuslainmukaan ollut ehdoton este toteuttaa rakentamisentoimenpiteitä. Olemassa oli valtuuston kaavapäätös,jonka turvin arvioitiin voitavan käynnistää rakennuslain124 a §:ää soveltaen keskeiset maanrakennustoimenpiteet.Kaupunki ei kuitenkaan halunnut aloittaa <strong>satama</strong>nvarsinaisia rakentamistöitä ennen kaavapäätöstenvahvistumista. Rakennuslain 124 a §:n mukaisentoimenpideluvan tilalle oli tullut maankäyttö- <strong>ja</strong>rakennuslain 128 §:n maisematyölupa. Koska asemakaavaoli laadittu riittävän tarkaksi, voitiin maisemaamuuttavat maanrakennustyöt toteuttaa suoraankaavan poh<strong>ja</strong>lta. Samaan tulokseen tultiin sittemmin<strong>satama</strong>n koillisrantaa ra<strong>ja</strong>avan 13 metriä korkeanmeluseinän osalta. Asemakaava määräsi suo<strong>ja</strong>amaanmelulta <strong>satama</strong>an rajoittuvan Porvarinlahdenalueen.Tulevan <strong>satama</strong>n alle jäi kymmenittäin rakennuksia,joista valtaosaa oli käytetty lähinnä kesämökkeinä.Mökkien purkamiseksi tarvittiin erilliset purkamisluvat.Rakennusvalvonnan toivomuksena oli,että purettavista mökeistä kerätään jälkipolvia vartenvalokuvia <strong>ja</strong> muuta dokumentointia. Suuri osa purettavistamökeistä oli kaupungin omistamia.114 SATAMAHANKE RAKENNUSVALVONNAN KANNALTA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aLauri Jääskeläinen, varatuomari, valtiotieteen maisteri, toimii<strong>Helsingin</strong> kaupungin rakennusvalvontaviraston virastopäällikkönä.12.2 Natura 2000Vuonna 1996 käynnistyi Suomessa Euroopan UnioninNatura 2000 -verkoston toteutus. <strong>Vuosaaren</strong><strong>satama</strong>hankkeelle Natura 2000 toi oman problematiikkansa,johon myös rakennusvalvonta joutuiperehtymään.<strong>Helsingin</strong> kaupungin alueelle merkityistä kolmestaNatura 2000 -alueesta Mustavuoren lehto <strong>ja</strong>Östersundomin lintuvedet sijoittui osin tulevan <strong>satama</strong>nnaapuriksi. <strong>Satama</strong>n ratayhteydelle luontevalin<strong>ja</strong>us halkaisi Natura-alueen.Natura 2000 vaikutti ennen kaikkea kaavaprosessiin.Korkein hallinto-oikeus kallistui lopulta sillekannalle, ettei <strong>satama</strong>hankkeesta koidu merkittäväähäiriötä Natura-alueen luonnonarvoille. Prosessikaikkinensa kesti kuitenkin vuosia. Lopputulokseenvaikutti tehdyt luonnonarvo<strong>ja</strong> turvaavat ratkaisut.Muun muassa ratayhteys lin<strong>ja</strong>ttiin kulkemaan osintunnelissa Natura-alueen ali. Erilaisia vaikutusselvityksiämuun muassa linnuston <strong>ja</strong> kasviston osaltatehtiin enemmän kuin minkään yksittäisen hankkeenosalta oli siihen mennessä Suomessa tehty.Itse rakentamisen lupaprosessien kannalta Naturaosoittautui lopulta niin monessa liemessä keitetyksi,ettei rakennusvalvonta joutunut siihen juurikaanpuuttumaan. Virasto seurasi lähinnä lehtien palstoiltaministeritason keskustelua siitä, oliko <strong>satama</strong>hankeristiriidassa Naturan kanssa <strong>ja</strong> tulisiko EUkomissio,selvitykset saatuansa, saattamaan asianEY-tuomioistuimeen. Hankkeen perusteellinen valmisteluosoitti kuitenkin, että näin dramaattisesti eikävisi. Luonnonsuojeluliiton vetoomus Euroopanparlamentin vetoomusvaliokuntaan kesällä 2002 oliviimeinen, tuloksettomaksi jäänyt yritys estää <strong>satama</strong>ntoteuttaminen.12.3 Yhteistyö muuttuu suunnitelmalliseksiEntistä suunnitelmallisemmaksi yhteistyö <strong>satama</strong>hankkeenjohdon <strong>ja</strong> rakennusvalvontaviraston keskenmuuttui vuoden 2002 lopusta. Uutena aikataulullisenauhkana oli ilmaantunut ruoppaustöidenyhteydessä pal<strong>ja</strong>stunut tributyylitina (TBT). TBTylitti jälleen uutiskynnyksen. Tarvittiin lisää ympäristölupavirastonpäätöksiä, jotta ruoppaustöitä voitiin<strong>ja</strong>tkaa. Välillä Vaasan hallinto-oikeus keskeyttikinne.<strong>Satama</strong>n projektinjohta<strong>ja</strong> Antti Mäkinen piti huolen,että tapaamiset rakennusvalvonnan kanssa olivatsäännöllisiä. Tapaamisiin osallistui käsiteltävistäasioista riippuen <strong>satama</strong>n suunnittelijoita, rakentajia<strong>ja</strong> toteuttajia. Rakennusvalvonnasta mukana oliyleensä viraston johtoryhmä sekä alueen lupa-arkkitehti<strong>ja</strong> tarkastusinsinööri. Kokoonpano vaihtelitilanteen mukaan.Rakennusvalvonta korosti pätevien suunnittelijoidenvalinnan tärkeyttä, oli sitten kysymys <strong>Helsingin</strong><strong>Satama</strong>n omista hankkeista tai <strong>satama</strong>an sijoittautuvistamuista toimijoista. Maankäyttö- <strong>ja</strong> rakennuslainmukaiset vastaavat työnjohta<strong>ja</strong>t todettiin tarvittavanniihinkin rakentamiskohteisiin, joiden osaltarakennusvalvonnan lupavelvoite väistyi. Ilman lupaavoitiin toteuttaa muun muassa monet toimenpiteiksiluokiteltavat <strong>ja</strong> <strong>satama</strong>n ydintoimintaa palvelevatrakennelmat <strong>ja</strong> laitteet, jotka perustuivat oikeusvaikutteiseenkaavaan.Suunnittelukilpailujen hyödyllisyydestä keskusteltiin.Rakennusvalvonta kannusti niitä käyttämään.Tyytyväisiä oltiin puolin <strong>ja</strong> toisin siihen, että <strong>Helsingin</strong><strong>Satama</strong> oli kiinnittänyt huomiota <strong>satama</strong>n arkki-SATAMAHANKE RAKENNUSVALVONNAN KANNALTA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristöKuva 12.2Rakennusvalvontavirastonjohtoryhmä<strong>satama</strong>työmaallavasemmalta oikealle:yliarkkitehti JuhaPulkkinen, tarkastusinsinööriRisto Nyberg,projektinjohta<strong>ja</strong> AnttiMäkinen, yli-insinööriKauko Juutinen,hallintopällikkö JuhaniNortomaa sekä arkkitehtiPirkka Hellman.Kuva: Lauri Jääskeläinen115


tehtoniseen yleisilmeeseen. Sitä kehittämään olivalittu Arkkitehtityöhuone Artto Palo Rossi TikkaOy. Arkkitehti Teemu Palo vastasi muun muassa<strong>satama</strong>n kaupunkikuvaa voimakkaasti muovaavienvalaistuspylväiden suunnittelusta kilpailuvoitonperusteella.Rakennusvalvonnan asiantunti<strong>ja</strong>elimiä, kaupunkikuvaneuvottelukuntaa<strong>ja</strong> teknillistä neuvottelukuntaa,kannustettiin käyttämään lausunnonantajina silloinkinkun sen enempää rakennuslautakunnan kuinviranhalti<strong>ja</strong>nkaan lupapäätöstä ei ollut tarpeen hankkia.<strong>Satama</strong> onkin toiminut esimerkillisesti <strong>ja</strong> tuonutkaupunkikuvaneuvottelukunnan arvioitavaksi kaikkikaupunkikuvallisesti merkittävät hankkeet silloistalähtien.12.4 Rakennustekniset <strong>ja</strong> muut haasteetMonien hankkeiden rakennustekninen vaativuustasonousi korkeimpaan AA-luokkaan. Suomen rakentamismääräyskokoelmanosaa A1 oli täydennettyvuonna 2006 erityismenettelyä koskevalla osiolla.Erityismenettely tulee noudatettavaksi, jos rakennuksensuunnittelussa, rakentamisessa tai käytössätapahtuvasta virheestä voi seurata suuronnettomuudenvaara.<strong>Satama</strong> on lähtökohtaisesti toiminto, jossa suuronnettomuudenvaara aina piilee. Schengen-säännöstenedellyttämä aitaaminen pienentää riskimomenttiajonkin verran. <strong>Satama</strong> on myös kriisialtiskohde. Väestönsuo<strong>ja</strong>vaatimus on <strong>satama</strong>-alueellaluonnollinen eikä näköpiirissä ollut, että väestönsuo<strong>ja</strong>nrakentamisvelvollisuudesta voitaisiin saadasuurempia helpotuksia. Käynnistynyt keskusteluväestönsuojien rakentamisen tarpeettomuudesta olihelpotustoiveita herättävä.Yllätyksenä ei myöskään tullut, että 1990-luvunpuolivälin konseptiin perustunut asemakaava ei voinutvarautua kaikkiin 2000-luvun <strong>satama</strong>tekniikantuomiin haasteisiin. Monet neuvottelut käytiin siltäosin, milloin asemakaavasta poikkeamiset voitiintulkita vähäisiksi <strong>ja</strong> suoraan rakennusluvissa ratkaistaviksi.Osa poikkeamisista vaati selkeästi kaupunginhallituksensiunauksen.Merkittävimmät asemakaavasta poikkeamisetkoskivat muun muassa <strong>satama</strong>keskuksen porttialueellesijoittuvaa väestönsuo<strong>ja</strong>a. Myös itse porttikeskuspoikkesi asemakaavasta. Hanke sai rakennuslautakunnanrakennusluvan sen jälkeen kunkaupunginhallitus oli hyväksynyt toimisto-osan 13-kerroksisena. Lainvoimainen asemakaava salli vainkolmesta neljään kerrosta. Rakennuksen horisontaalisuusmuuttui vertikaalisuudeksi. Porttikeskus tuleeolemaan koko <strong>satama</strong>n kannalta tärkeä maamerkki<strong>ja</strong> poikkeus oli hyvin perusteltu.Paljon pohdintaa aiheutti muutoin käyttämättömäksijäävään kuivatelakka-altaaseen aiottu maahantuotavienautojen varasto. Kaavallinen valmiusvarastoon oli keskeneräinen. Rakennuslautakuntamyönsi hankkeelle tilapäisen rakennusluvan. Lopputulokseksikuitenkin tuli, että operaattori päätti sijoittaavaraston kokonaan muualle kehäteiden varsille.Valtaosa rakennusluvista käsiteltiin <strong>ja</strong> myönnettiinvuoden 2007 aikana. Kysymys oli rakennusvalvonnanhistoriassa jättisuurista <strong>satama</strong>logistiikan rakennuksista.Myönnetyt luvat aiheuttivat rakennusvalvonnantilastoihin piikin. Vuoden 2007 uusien rakennustenrakentamiseksi myönnettyjen rakennuslupien kokonaisvolyymistä,5,16 miljoonaa kuutiota, muodostivat<strong>satama</strong>n rakennukset lähes 2 miljoonaa kuutiota.12.5 <strong>Satama</strong> on Helsingille tärkeä kaupunkikuvallinen imagotekijäHelsinki perustettiin aikoinaan nimenomaan <strong>satama</strong>kaupungiksi.Kustaa Vaasan ajoista lähtien on meri<strong>ja</strong> <strong>satama</strong> muovanneet Helsingistä omanlaisensa. Eiole yhdentekevää, millaista <strong>satama</strong>rakentaminen onarkkitehtoniselta <strong>ja</strong> kaupunkikuvalliselta tasoltaan.Monet kokevat <strong>satama</strong>t nykyään enemmän kaupunginhäiriötekijänä kuin sen sieluna.Korkealaatuinen arkkitehtuuri <strong>ja</strong> huomion kiinnittäminenkaupunkikuvaan <strong>ja</strong> viihtyvyyteen voivatkääntää <strong>satama</strong>identiteettiä voittopuolisesti myönteiseksi.<strong>Vuosaaren</strong> <strong>satama</strong>n kohdalla erityishaasteenaon ollut luontoarvot. Hyvällä syyllä voi todeta, ettäasiantunteva <strong>ja</strong> riittävä panostus luonnon- <strong>ja</strong> ympäristönsuojeluunovat tuomassa uhraukset korkojenkera takaisin.Samanlaisia odotuksia kohdistuu <strong>satama</strong>n rakennettuunstruktuuriin. <strong>Satama</strong>n rakennuksia ei tulenähdä vain pelkkinä tuotannollisina <strong>ja</strong> logistisinakoneina. Niihin sisältyy paljon symboliarvo<strong>ja</strong>.<strong>Satama</strong>n rakennusten mittakaava on normaa-116 SATAMAHANKE RAKENNUSVALVONNAN KANNALTA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


12.6 <strong>Satama</strong> on lähtölaukauslista poikkeava. Erityisesti varastoterminaalit ovatkooltaan oma lukunsa. Rakennuslautakuntaa monethallit keskusteluttivat. Vaikka kaupunkikuvaneuvottelukuntaoli hankkeita puoltanut, kiinnitti rakennuslautakuntatoistuvasti <strong>ja</strong> ansiokkaasti huomiotahallirakennusten luonteeseen satojen ihmisten työpaikkoina.Toivottiin enemmän istutusten <strong>ja</strong> viherelementtienläsnäoloa. Myös hallien värivalinnatkeskusteluttivat.Suurten hallirakennusten vastapainoksi sijoittuu<strong>satama</strong>n alueelle paljon pieniä teknisiä <strong>ja</strong> muita<strong>satama</strong>toimintojen vaatimia rakennelmia. Myös niidenkorkea arkkitehtoninen taso oli usein esillä.Rakennusvalvonnan suureksi iloksi projektiorganisaatioymmärsi yksityiskohtien tärkeyden. Vaikka<strong>satama</strong>n ensisi<strong>ja</strong>inen tehtävä on toimia tehokkaasti<strong>ja</strong> tavaravirtojen nopeus on ykköskilpailutekijöitä,tulevat jälkipolvet vielä monasti kiittämään kaikkianiitä pyrkimyksiä, joilla <strong>Vuosaaren</strong> <strong>satama</strong> muodostuumyös arkkitehtuuriltaan Itämeren helmeksi.Helsinki mielletään hallinnon, kaupan <strong>ja</strong> kulttuurinkaupungiksi. Historiallisesti Helsinki on kasvanutnykyiseen asemaansa myös maan tärkeimpiinlukeutuvana teollisuuskaupunkina. <strong>Helsingin</strong> teollisetjuuret ovat viime vuosikymmenten myllerryksessäjääneet varjoon.Helsingille <strong>ja</strong> <strong>satama</strong>lle onneksi Pohjois-Euroopanjohtaviin kahvipaahtimoihin kuuluva Oy GustavPaulig Ab päätti jäädä Vuosaareen. Uusi paahtimosijoittuu <strong>satama</strong>n kupeeseen sen yritysalueelle.Raaka-ainekuljetukset hoituvat <strong>ja</strong>tkossakin valtamerientakaa logistisesti edullisimmilla mahdollisillatavoilla. Paahtimo edustaa arkkitehtuuriltaankorkeaa teollisen rakentamisen tasoa. ArkkitehtiMauri Tommila <strong>ja</strong>tkaa suomalaisen teollisuusarkkitehtuurinkomeita perinteitä. Alueelle myöhemminsijoittuvat muut tuotannolliset rakennukset saavatpaahtimosta oivan kirittäjän eivätkä voi lähteä arkkitehtuurinalennuslin<strong>ja</strong>lle.<strong>Vuosaaren</strong> <strong>satama</strong> on monessa mielessä lähtölaukaus<strong>Helsingin</strong> tulevaisuudelle. Helsinki säilyy <strong>satama</strong><strong>ja</strong>myös teollisuuskaupunkina. Samalla <strong>Vuosaaren</strong><strong>satama</strong> vapauttaa entisiä ahtaiksi käyneitä <strong>satama</strong>alueitakokonaan uuteen käyttötarkoitukseen. Länsi<strong>satama</strong>n<strong>ja</strong> Sörnäisten <strong>satama</strong>n rakentuminen lähinnäasumiseen tulevat leimaamaan useaksi vuosikymmeneksi<strong>Helsingin</strong> kehitystä.Aikataulullisesti <strong>satama</strong> on alkuvaikeuksienNatura- <strong>ja</strong> muiden ratkenneiden kiistojen jälkeenosoittautunut hämmästyttäväksi suoritukseksi.Vastaavankokoiset hankkeet eivät suinkaanaina pysy päätetyssä aikataulussa. Rakennusvalvontaon omassa toiminnassaan pyrkinyt koko a<strong>ja</strong>nottamaan huomioon <strong>Vuosaaren</strong> <strong>satama</strong>n strategisenmerkityksen <strong>Helsingin</strong> tulevaisuudelle. Lupahakemustenkäsittely on ollut ammattitaitoisen asiallista.Rakennustyönaikainen valvonta on perustunutsekin ammattilaisten työn arvostamiseen. Poikkeamiintyön laadussa on puututtu tiukasti <strong>ja</strong> jämäkästi,rakennusvalvonnan vision edellyttämällä tavalla.Rakennusten käyttöturvallisuuteen on kiinnitettyhuomiota. Rakennusten kunnossapito jää niidenomistajien <strong>ja</strong> käyttäjien vastuulle.<strong>Satama</strong>n kaltainen tuotannollis-teollis-logistinenkokonaisuus elää <strong>ja</strong> muuttuu. Varmaa on, että <strong>Vuosaaren</strong><strong>satama</strong> tuottaa <strong>ja</strong>tkossakin tasaisen virranlupahakemuksia <strong>ja</strong> rakennushankkeita rakennusvalvontaviranomaisenkäsittelyyn.SATAMAHANKE RAKENNUSVALVONNAN KANNALTA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristöKuva 12.3<strong>Satama</strong>n viereiselleyritysalueelle sijoittuvaPauligin paahtimoedustaa arkkitehtuuriltaankorkeaa teollisenrakentamisen tasoa.HavainnekuvaArkkitehdit Tommila OyKuva 12.4HavainnekuvaJohn Nurminen Oy:nterminaalista,ArkkitehtitoimistoErkki Helamaa –Keijo Heiskanen Oy117


13<strong>Satama</strong>hankkeenympäristöseurannat13.1 Johdanto<strong>Vuosaaren</strong> <strong>satama</strong>hankkeessa toteutetaan huomattavanlaa<strong>ja</strong>a ympäristövaikutusten seurantaa. Luontovaikutustenseurantaohjelmat täydentävät lupienvelvoitteita. Osa seurannoista aloitettiin jo ennenrakentamista, niitä on tehty rakennusaikana <strong>ja</strong> <strong>ja</strong>tketaan<strong>satama</strong>toiminnan alettua. Linnuston <strong>ja</strong> kasvillisuudenseurannalla halutaan saada tietoa vaikutuksistaerityisesti Porvarinlahden, Labbackan,Mustavuoren <strong>ja</strong> Kasabergetin alueilla, sillä luontodirektiiviedellyttää Natura-alueiden luontoarvojensäilyttämistä suotuisalla tasolla.13.2 Seurannan tausta <strong>ja</strong> tavoitteet13.2.1 TaustaYmpäristövaikutusten arviointimenettelyyn kuuluuseurannan suunnittelu. YVA-asetuksen (713/2006)10§:n mukaan arviointiselostuksessa tulee esittääehdotus seurantaohjelmaksi. Vuonna 1995 valmistuneessa<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointiselostuksessa [8] ei esitetty seurantaohjelmaa,vaan todettiin seurannasta yleisesti:Hankkeesta aiheutuvia ympäristövaikutuksia onsyytä tutkia seurantana mm. meren, linnuston <strong>ja</strong>kasvillisuuden osalta. Osa näistä on lakisääteisiävelvoitteita <strong>ja</strong> osa tässä esitettyjä seurantatoimia.Seurannasta vastaavat <strong>Helsingin</strong> <strong>Satama</strong>, Merenkulkuhallitus,Tiehallinto <strong>ja</strong> Ratahallintokeskus.Seurantaohjelman hyväksyvät asianomaiset ympäristöviranomaiset.YVA-menettelyssä yhteysviranomaisena toiminutUudenmaan ympäristökeskus ei lausunnossaan[22] ottanut kantaa seurannan järjestämiseen, vaanpiti <strong>Helsingin</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointiselostusta yleisyydestään huolimattariittävänä.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen suunnittelun koordinaatioryhmäkokosi keväällä 1997 viranomaisten<strong>ja</strong> suunnittelukonsulttien edustajia neuvottelemaanalustavasti <strong>satama</strong>hankkeen seurannan suunnittelusta[29]. Luontovaikutusten seurantaohjelmanluonnos valmistui vuonna 2000 [17].Valtioneuvosto käsitteli 3. 12. 1999 luonnonsuojelulain66§:n 2 momentissa tarkoitettua poikkeustakoskevaa Uudenmaan liiton hakemusta. Päätöksenmukaan valtioneuvosto piti tärkeänä, että <strong>satama</strong>hankkeenvaikutusten riittävä seuranta <strong>ja</strong> luonnollekohdistuvien haittojen lieventäminen sisällytetäänhankkeen yksityiskohtaiseen suunnitteluun [24].Käsitellessään kaupunginvaltuuston asemakaavapäätöksentoimeenpanoa 13. 12. 1999 kaupunginhallituskehotti <strong>satama</strong>lautakuntaa ottamaan huomioon<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen yksityiskohtaisessasuunnittelussa <strong>satama</strong>n luonnolle aiheuttamat vaikutukset<strong>ja</strong> niiden riittävän seurannan niin, että haittojentehokas lieventäminen tulee turvatuksi [5].Käsitellessään kaupunginvaltuuston päätöstä<strong>Vuosaaren</strong> <strong>satama</strong>n rakentamisesta kaupunginhallituspäätti 14. 10. 2002 kehottaa <strong>Helsingin</strong> <strong>Satama</strong>ahuolehtimaan yhteistyössä <strong>satama</strong>n liikenneyhteysprojektin<strong>ja</strong> <strong>Helsingin</strong> kaupungin ympäristökeskuksenkanssa <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseurannasta hyväksyttyjen seurantaohjelmienmukaan. Seurannasta kaupungille aiheutuvat kustannuksettuli sisällyttää <strong>satama</strong>n toteuttamiskustannuksiin[6].13.2.2 Seurantojen tavoitteetSeurannalla pyritään ennustamaan, tunnistamaan,selvittämään <strong>ja</strong> mittaamaan hankkeiden <strong>ja</strong> toimienvaikutuksia. Erityisen tärkeää on löytää mahdollisetennakoimattomat vaikutukset <strong>ja</strong> ryhtyä ajoissa lieventämään<strong>ja</strong> kor<strong>ja</strong>amaan haitto<strong>ja</strong>.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseurantaohjelman luonnoksessa [17] määriteltiinseurannan tavoitteet:1. Todentaa, syntyykö hankkeen rakentamisessa <strong>ja</strong>toiminnassa suunnittelun <strong>ja</strong> ympäristövaikutustenarviointimenettelyn aikana esitettyjä vaikutuksia.Arvioita <strong>ja</strong> käsityksiä vaikutuksista on esitettyselvityksissä, suunnitelmissa, mielipiteissä, lau-118 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K I R J O I T TA J APirkko Pulkkinen, MMM (ympäristönsuojelu), LuK (suunnittelumaantiede),työskentelee johtavana ympäristötarkasta<strong>ja</strong>na <strong>Helsingin</strong>kaupungin ympäristökeskuksessa. Hän on ollut ympäristötoimenedusta<strong>ja</strong>na <strong>Vuosaaren</strong> <strong>satama</strong>n valmistelussa vuodesta 1989 alkaen.sunnoissa <strong>ja</strong> muistutuksissa. Keskeistä on, kuinkamerkittäviä vaikutukset ovat <strong>ja</strong> kohdentuvatko nekuten oli arvioitu.2. Seurata haitallisten vaikutusten torjunta- <strong>ja</strong> lieventämistoimienvaikuttavuutta.3. Arvioida, onko tarpeen muuttaa haitallisten vaikutustenlieventämistoimia saadun seurantatiedonperusteella.4. Antaa tietoa lisätoimenpiteitä varten, mikäli merkittäviäodottamattomia vaikutuksia ilmenee.5. Saada tietoa hankkeen vaikutuksista suunnittelunkehittämistä varten sovellettavaksi muissa vastaavanlaisissahankkeissa.13.3 <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta13.3.1 Linnustonseurannan tausta <strong>ja</strong> tavoitteetMustavuoren lehdon <strong>ja</strong> Östersundomien lintuvesienNatura-alueen (FI0100065) suojelun perusteina ovatmm. 11 lintudirektiivin liitteen I lintulajia, jotkapesivät alueella (kalatiira, kehrääjä, kirjokerttu,laulujoutsen, liro, luhtahuitti, pikkulepinkäinen,pikkusieppo, pyy, ruisrääkkä <strong>ja</strong> suokukko). Kaikkilintuvesikokonaisuuden lahdet, Porvarinlahti, Bruksviken,Torpviken <strong>ja</strong> Kapellviken ovat myös lintujenmuutonaikaisia levähdyspaikko<strong>ja</strong>. Niillä käy ruokailemassauseita sellaisia laje<strong>ja</strong>, jotka eivät pesi alueella[23].<strong>Vuosaaren</strong> <strong>satama</strong> liikenneyhteyksineen on suunniteltusiten, että haitat luonnolle <strong>ja</strong> muulle ympäristölleovat mahdollisimman pienet. Useissa hankettakoskevissa lausunnoissa <strong>ja</strong> valituksissa oletettiinkuitenkin <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksien vaikuttavanmonella tavalla haitallisesti <strong>satama</strong>nlähiympäristön luontoon <strong>ja</strong> erityisestiNatura-alueen linnustoon mm.elinympäristöjen tuhoutumisen <strong>ja</strong> pirstoutumisensekä melun, valon <strong>ja</strong> rautatiesillanestevaikutuksen kautta.Linnustonseurannan tärkeimmättavoitteet ovat [32]:• Selvittää tutkimusalueen linnustoseurantaohjelmassa määritellyiltämetsä- <strong>ja</strong> ruoikkoalueilta.• Seurata mahdollisia muutoksia lintukannoissa<strong>ja</strong> verrata niitä aiempienvuosien tuloksiin.• Selvittää alueen vesilintujen poikastuottoa <strong>ja</strong> ver-ÖsterängenMustavuoripohjoisosaMustavuorieteläosaPorvarinlahtilänsiosarata sitä muilla eteläsuomalaisilla alueilla tehtyihinvastaaviin selvityksiin.• Seurata Mustavuoren lehdon <strong>ja</strong> Östersundominlintuvesien Natura-alueen linnuston suojeluarvonmahdollisia muutoksia.• Antaa suositus tulevien vuosien seurannoille.13.3.2 Linnustonseurannan toteuttaminen<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseurantaa ontehty vuonna 2001 valmistuneen seurantaohjelman[11] mukaan. Linnustonseuranta on poikkeuksellisenKasabergetLabbackaKehä IIIItäväyläTryvikTalosaarentieFotängen NiinilahtiVuosaariKäärmeniemiKarlvikÖstersundomKantarnäsSjöängenHusöKalkkisaariVarisluotoVästinkiKarhusaariKapellvikenBruksvikenTorpvikenPorvarinlahtiitäosaKuva 13.1Linnustonseurannantutkimusalueet.SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö119


Kuva 13.2Meriväylän seurantaluodot.Kuva 13.3Meriväylän vertailuluodot.SeurantaluotoRuoppauskohdeVästinkiVuosaariEestiluodon hiekanottoMustakuvun läjitysalueLänsi TonttuVertailuluodotKajuuttaluodot(9.0)OnkiluotoLoppikariPrinsessaMatalakariPeninkaritGranöVarisluotoItä TonttuLäjitysalueÖlhällenRk4bRk3Rk2Rk1Rk0Rk4EestiluotoHiekanottoalueKrokholmshällenMusta HevonenKuivaHevonen(9.0)Östra RödhällenRönnhällen(9.0)0 1 2 3 4 5 kmKallioluotoKalvholmen, östraKalliosaarenluotoÖstraholmshälletFårholmeninluotoHansholmsklippanlaa<strong>ja</strong> sekä alueeltaan että kestoltaan <strong>ja</strong> tiettävästi laajinEU-maissa.Seuranta ulottuu kolmen kunnan, <strong>Helsingin</strong>, Vantaan<strong>ja</strong> Sipoon, alueille. Kaikkia alueita ei lasketajoka vuosi. Tutkimusalueen pinta-ala on n. 600 ha,johon 355 ha:n Natura-alueen (Mustavuoren lehto,Labbacka, Kasaberget, Porvarinlahti, Bruksviken,Torpviken <strong>ja</strong> Karlviken–Kapellviken) lisäksikuuluvat Österängenin pelto, Tryvik, Fotängen,Käärmeniemi <strong>ja</strong> Östersundomin kartanon itäpuolentulvaniitty. Alue rajoittuu lännessä <strong>Vuosaaren</strong> <strong>ja</strong>Mellunmäen asuntoalueisiin sekä Västerkullan peltoihin.Pohjoisra<strong>ja</strong>na on Itäväylä. Idässä alue päättyyÖstersundomiin <strong>ja</strong> Karhusaareen.Keskeisiä vertailtavia muuttujia ovat lajimäärät,parimäärät <strong>ja</strong> poikastuotto. Lisäksi arvioinnissa huomioidaanSuomen kansallinen lintujen uhanalaisluokittelu<strong>ja</strong> Euroopan unionin lintudirektiivi. Yhtenämittarina on Suomen ympäristökeskuksen kehittämälintujen suojelupistearvo. Lintuvesien suojelupistearvotlasketaan lajikohtaisten parimäärien <strong>ja</strong>lajien suojeluarvojen avulla. Suojelupistearvoillayksinkertaistetaan lintuvesialueiden vertailua [32].Tutkimuksiin kuuluvat:1. Vesilintujen pistelaskenta2. Kosteikkolintujen kartoituslaskenta3. Maalintujen kartoituslaskenta4. Lajikohtaiset laskennat (eräiden EU:n direktiivilajiensovelletut reviirikartoitukset koko Naturaalueella)5. Muuttoaikaiset laskennat (ainoastaan vuonna 2002)6. Merilintujen pesälaskenta.Pesimälinnuston kartoituslaskennassa metsäalueetlasketaan kymmenen kertaa. Havaitut yksilöt<strong>ja</strong> reviirit merkitään kartoille. Reviiri tulkitaan, joslintuyksilö tai -pari havaitaan vähintään kolmellalaskentakerralla suurin piirtein samassa paikassa <strong>ja</strong>havainto koskee vähintään yhden kerran reviirikäyttäytymistä(laulu, varoittelu, reviirikiista, kantoi ruokaapesään). Tutkimusalue on <strong>ja</strong>ettu osiin, jotka onmahdollista laskea yhden aamun aikana. Laskentakausikestää huhtikuusta kesäkuun loppuun.Kosteikkoalueet <strong>ja</strong> Österängenin peltoalue lasketaanviiden kerran kartoituslaskentana. Reviiri tulkitaan,jos lintuyksilö tai -pari havaitaan vähintäänkahdella laskentakerralla suurin piirtein samassapaikassa <strong>ja</strong> vähintään yhden kerran havainto koskeereviirikäyttäytymistä.Vesilintujen pistelaskennassa lasketaan sopiviltatähystyspaikoilta alueella olevat vesilinnut. Vuonna120 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


2002 tehtiin myös muuttoaikaiset laskennat 25 kertaasekä kevät- että syyskaudella. Samoista pisteistälasketaan kesäkuun lopun <strong>ja</strong> elokuun alunvälillä vesialueet kahden viikon välein. Näiden <strong>ja</strong>muissa laskennoissa havaittujen poikueiden perusteellaarvioidaan vesilintujen poikastuottoa. Pesivienvesilintujen parimäärä tulkitaan siten, että osaaluekohtaiseksiparimääräksi katsotaan huhtikuunlopun <strong>ja</strong> toukokuun lopun välisenä aikana laskennoissahavaittu korkein parimäärä.Kartoituslaskento<strong>ja</strong> täydennetään kolmella pöllökuuntelullakeväällä <strong>ja</strong> kahdella yölaula<strong>ja</strong>laskennallatouko – kesäkuussa. Tutkimusalue kuljetaan kattavastiläpi, <strong>ja</strong> havainnot merkitään kartoille.Merilinnusto lasketaan pesimäaikana siten, ettähavainnoitsi<strong>ja</strong> käy luodoilla toukokuun puolivälissä<strong>ja</strong> sen jälkeen kerrasta neljään kertaan riippuen luodollapesivästä lajistosta.Koko tutkimusalueelta kir<strong>ja</strong>taan havainnot harvalukuisistalajeista. Niistä saadaan tietoa myös alueellaretkeileviltä lintuharrastajilta. Harvalukuisissalajeissa keskitytään niihin lintudirektiivin liitteenI lajeihin, jotka on mainittu Mustavuoren lehdon<strong>ja</strong> Östersundomin lintuvesien Natura-alueen tietolomakkeessa.Kaikki kartoitusalueilla havaitut lajien pysyvätreviirit on tallennettu paikkatieto-ohjelmaan. Poh<strong>ja</strong>karttanakäytetään alueen maastotietokantaa yhtenäiskoordinaatistolla.Maastotietokartan päälle ontallennettu reviirien keskipisteet.Paikkatieto-ohjelman avulla lasketaan rakennettavienliikenneväylien <strong>ja</strong> <strong>satama</strong>n alueiden ympärilleeri etäisyyksillä olevat vyöhykkeet, bufferit:100, 250, 500 <strong>ja</strong> 1000 metriä. Vyöhykkeistä voidaanpoimia reviirit <strong>ja</strong> käyttää tuloksia vaikutusten arviointiin.Linnustonseurantaa on tehty vuodesta 2002alkaen. Merilintujen pesälaskenta <strong>satama</strong>n <strong>ja</strong> meriväylänvaikutusalueella sekä vertailualueen luodoillaalkoi vuonna 2001. Varsinaiseen seuranta-alueeseenkuuluu kahdeksan luotoa, joista kaksi jäi vuonna2004 <strong>satama</strong>rakentamisen alle. Vertailualueeseenkuuluu 13 luotoa. Maalintujen vertailuaineistonakäytetään Luonnontieteellisen keskusmuseon aineistoaEtelä-Suomesta <strong>ja</strong> vesi- <strong>ja</strong> kosteikkolintujen vertailuaineistonaViikin-Vanhankaupunginlahden sekäParikkalan Siikalahden laskentatieto<strong>ja</strong>.Seurannat aloitettiin ennen <strong>satama</strong>n rakennustöitä,niitä on tehty rakentamisen a<strong>ja</strong>n <strong>ja</strong> niitä <strong>ja</strong>tketaankolme vuotta <strong>Vuosaaren</strong> <strong>satama</strong>n käyttöönotonjälkeen. Vuoden 2005 laskentojen yhteydessä selvitettiinmyös <strong>satama</strong>n koillispuolella olevien Varissaaren<strong>ja</strong> Kalkkisaaren linnusto. Vuonna 2008 linnustonseurantaanlisätään Porvarinlahden ratasillanvaikutusten seuranta.Seurannassa käytetään vakioitu<strong>ja</strong> menetelmiä, <strong>ja</strong>laski<strong>ja</strong>t ovat kokeneita ornitologe<strong>ja</strong>. Alueen laajuudenvuoksi laskijoita on useita. Laskennoissa noudatetaan<strong>Helsingin</strong> yliopiston Eläinmuseon linnustonseurannanohjeita <strong>ja</strong> Suomen ympäristökeskuksenohjeita kosteikkoalueiden kartoituksista. Menetelmienvakiointi <strong>ja</strong> toteutuksen selkeys ovat olennaisiapitempiaikaisten linnustonmuutosten seurannassa.Linnustovaikutusten seurannasta vastaavat <strong>Helsingin</strong><strong>Satama</strong>n VUOSA-projekti <strong>ja</strong> valtion <strong>Vuosaaren</strong><strong>satama</strong>n liikenneyhteydet (VUOLI) -projektiyhdessä <strong>Helsingin</strong> kaupungin ympäristökeskuksenkanssa. Oh<strong>ja</strong>usryhmään kuuluvat hankkeesta vastaavien<strong>ja</strong> <strong>Helsingin</strong> kaupungin ympäristökeskuksenedustajien lisäksi ympäristöministeriön, Suomenympäristökeskuksen <strong>ja</strong> Uudenmaan ympäristökeskuksenlinnustoasiantunti<strong>ja</strong>t.Alkuperäinen tutkimusaineisto säilytetään <strong>Helsingin</strong>kaupungin ympäristökeskuksessa. Linnustovaikutustenseurantaohjelma vuodelta 2001 sekäraportit vuodesta 2002 alkaen on julkaistu <strong>Helsingin</strong>kaupungin ympäristökeskuksen julkaisusar<strong>ja</strong>ssa.13.3.3 Linnustonseurannan tuloksetLinnustonseurannan tulee kestää riittävän kauan, ettäa<strong>ja</strong>n<strong>ja</strong>ksoon sattuisi eri lajien kannalta hyviä <strong>ja</strong> huono<strong>ja</strong>vuosia. Linnuilla on huomattavaa muun muassaedellisen vuoden poikastuotannosta, talvehtimismenestyksestä<strong>ja</strong> muuton aikaisista sääoloista johtuvaakannanvaihtelua. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenlinnustonseurantaohjelman [11] mukaiset tutkimuksetpäättyvät vuonna 2011, minkä jälkeen varsinaisestivasta voidaan tehdä johtopäätöksiä <strong>satama</strong>hankkeenlinnustovaikutuksista.Vuoden 2002 tulokset kuvaavat tilannetta ennen<strong>satama</strong>rakentamisen aloittamista, vuosien 2003 –2008 tulokset tilannetta <strong>satama</strong>rakentamisen aikana<strong>ja</strong> vuodet 2009 –2011 <strong>satama</strong>toiminnan vaikutuksiaseuranta-alueen linnustoon.Vuosi 2002Vuoden 2002 seuranta-alue oli 600 ha. Siihen kuuluivatMustavuoren lehdon <strong>ja</strong> Östersundomin lintuvesienNatura-alueen lisäksi <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> viereisentyöpaikka-alueen alle jääneet alueet sekä Österängeninpelto, jonka poikki rakennettiin tie <strong>ja</strong> rata.Alueen linnusto todettiin hyvin monipuoliseksi[31]. Pysyviä reviirejä havaittiin tutkimusalueella102 lajilla kaikkiaan yli 1900. Natura-alueen laji-SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö121


määrä oli 81 <strong>ja</strong> parimäärä 980. Natura-alueella runsaimmatdirektiivilajit olivat pyy (5 paria), ruisrääkkä(3 paria) <strong>ja</strong> pikkulepinkäinen (4 paria).Porvarinlahdella pesivät mm. ruisrääkkä, lapintiira,kirjokerttu, pikkulepinkäinen <strong>ja</strong> tiltaltti. Koko tutkimusalueellavarmennettiin 12 ruisrääkän <strong>ja</strong> 13 pikkulepinkäisenreviiriä. <strong>Vuosaaren</strong> <strong>satama</strong>n suunniteltujenliikenneyhteyksien kohdalla Natura-alueella eiollut lintudirektiivin liitteen lajien eikä uhanalaistenlajien reviirejä.Östersundomin lintuvesien neljästä lahdestaKapellviken on laajin <strong>ja</strong> arvokkain. Lajimäärä eiollut muuttunut 1980-luvulla tehtyihin selvityksiinverrattuna, mutta kokonaiskanta oli vähentynyt.Koko tutkimusalueella oli sinisorsaa lukuunottamatta huono poikastuotto. Syiksi oletettiin pienpedot,voimakkaat vedenpinnan vaihtelut <strong>ja</strong> ihmisenaiheuttama häirintä (kalastus, veneily). Kosteikkolintu<strong>ja</strong>oli eniten Bruksvikenillä <strong>ja</strong> Torpvikenillä.Metsissä runsaimmat lajit olivat peippo <strong>ja</strong> pajulintu.Meriväylän varren seurantaluotojen runsaimmatlajit olivat naurulokki, harmaalokki, kalalokki,lapintiira <strong>ja</strong> haahka.Vuoden 2002 muuttolintulaskentojen perusteellaÖstersundomin lintuvedet ei ole kovin merkittävämuuttolintualue. Tähän vaikuttaa ainakin vesialueidenpienuus erityisesti syksyllä, kun runsaat ruoikotovat kasvaneet täyteen mittaan [31].Vuosi 2003<strong>Satama</strong>n rakentaminen aloitettiin vuonna 2003Käärmeniemen <strong>ja</strong> ratapiha-alueen puiden kaatamisella<strong>ja</strong> <strong>satama</strong>-alueen rantaruoikon poistamisella.Tutkimusalueen linnustossa ei tapahtunut suuriamuutoksia vuosien 2002 <strong>ja</strong> 2003 välillä eikä negatiivisiavaikutuksia Porvarinlahden <strong>ja</strong> muiden lahtienlinnustoon havaittu. Porvarinlahden lajimääräkasvoi yhdellä <strong>ja</strong> parimäärä nousi, mutta suojelupistearvoaleni. Siihen vaikutti ruisrääkän <strong>ja</strong> pikkulepinkäisenparimäärien lasku. Luonnontieteellisenkeskusmuseon mukaan näiden lajien havaintomäärätolivat pudonneet selvästi aiemmista vuosista kokoEtelä-Suomessa.Österängenin peltoalueen <strong>ja</strong> meriväylän seurantaluotojenlajisto <strong>ja</strong> parimäärä pysyivät edellisen vuodentasolla.Vesilintujen poikastuotto oli vielä edellistä vuottahuonompi. Siihen vaikuttivat todennäköisesti sää,pienpedot sekä kalastajien <strong>ja</strong> veneilijöiden aiheuttamahäirintä.Kuva 13.4Pikkulepinkäisen reviiritvuosina 2002–2007.2002 2003 20042005 2006 2007Pysyvä reviiriseurantaohjelmanlaskentojen perusteellaPysyvä reviirimuiden havaintojenperusteellaNatura-alueen ra<strong>ja</strong>122 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Metsäalueiden parimäärät nousivat. Pääosa siitäoli rastaiden, punarinnan, talitiaisen <strong>ja</strong> peipon parimäärienkasvua. On mahdollista, että maaliikenneyhteyksiävarten raivatuilta Tryvikenin, Fotängenin<strong>ja</strong> Käärmeniemen metsäalueilta osa linnuistasiirtyi lähimetsiin [33].Vuosi 2004<strong>Satama</strong>n rakentaminen aloitettiin tammikuussa2003. Kesällä aloitettiin ruoppaukset Niinilahdessa<strong>ja</strong> Käärmeniemen itäpuolella sekä <strong>satama</strong>alueentäyttäminen. Alkuvuodesta 2004 aloitettiinItäväylän eritasoliittymän sekä <strong>satama</strong>tien <strong>ja</strong> -radanavo-osuuksien rakentaminen. Porvarinlahden sillanrakentaminen aloitettiin vasta elokuussa, lintujenpesimäa<strong>ja</strong>n jälkeen. <strong>Satama</strong>n itäreunan täyttöjensyvätiivistys aloitettiin maaliskuussa <strong>ja</strong> meriväylänruoppaukset väylän ulko-osan kohteissa huhtikuussa.Porvarinlahden tietunnelin, Labbackan rautatietunnelin<strong>ja</strong> <strong>satama</strong>n itäreunan meluseinän työt alkoivatsyksyllä. Loppusyksystä tehtiin Lehdessaaren <strong>ja</strong>Käärmeniemen louhinto<strong>ja</strong> <strong>ja</strong> louhepenkerettä.Vuonna 2004 tutkimusalueen linnustossa eitapahtunut suuria muutoksia edelliseen vuoteen verrattuna.Porvarinlahden lajimäärä laski hieman eikäkirjokerttua tai ruisrääkkää havaittu lainkaan. Sensi<strong>ja</strong>an pikkulepinkäisen reviirejä lahden alueella olineljä. Ruokokerttusten määrä lähes nelinkertaistui.Porvarinlahden linnustotiheys pysyi ennallaan.Bruksvikenin <strong>ja</strong> Torpvikenin linnusto sekä saaristolintujenkannat seurantaluodoilla <strong>ja</strong> vertailuluodoillapysyivät edellisen vuoden tasolla.Vuoden 2004 tuloksia kuvaavassa raportissa[32] esitettiin myös yhteenveto linnustomuutoksistavuosina 2002–2004. Ensimmäisten seurantavuosientulosten mukaan ei <strong>satama</strong>rakentamisella ollut osoitettavissahaitto<strong>ja</strong> Mustavuoren lehdon <strong>ja</strong> Östersundominlintuvesien Natura-alueen <strong>ja</strong> sen lähiympäristönlinnuille. Rakentamisen ei myöskään havaittuhaitanneen Porvarinlahden kosteikkolinnustoa. Pääosa600 ha:n seuranta-alueen linnustomuutoksistaoli yhteneväisiä vertailualueiden kanssa. Esimerkiksipikkulepinkäisen <strong>ja</strong> ruisrääkän kannanmuutokseteivät poikkea muutoksista muualla Etelä-Suomessa.Koko maassa selvästi vähentynyt kirjokerttuon mahdollisesti kadonnut seuranta-alueelta.Neljän vuoden aikana tapahtuneet muutoksetmerilinnuston kannoissa olivat samansuuntaisiasekä <strong>Vuosaaren</strong> <strong>satama</strong>an johtavan väylän seurantaluodoillaettä vertailuluodoilla.Vuosi 2005Vuonna 2005 <strong>satama</strong>n <strong>ja</strong> liikenneyhteyksien rakentamineneteni. Porvarinlahden ratasilta <strong>ja</strong> meriväylänruoppaukset valmistuivat alkusyksystä. Tie- <strong>ja</strong> ratatunneleidenlouhinta, <strong>satama</strong>kentän täyttö, <strong>satama</strong>nkoillisreunan meluseinän rakentaminen <strong>ja</strong> <strong>satama</strong>nedustan puhdistusruoppaus <strong>ja</strong>tkuivat. Laitureidenrakentaminen aloitettiin.Vuoden 2005 linnustotutkimuksissa havaittiinPorvarinlahden kosteikkoalueen linnuston lajimäärän,parimäärän <strong>ja</strong> suojelupistearvon selvästi kasvaneenedellisestä vuodesta. Suojelupistearvoa nostivatruisrääkän, pikkulepinkäisen <strong>ja</strong> rastaskerttusenreviirit. Kirjokerttua ei edelleenkään havaittu.Bruksvikenin <strong>ja</strong> Torpvikenin lajimäärä <strong>ja</strong> linnustotiheyskasvoivat mutta suojelupistearvo pysyiennallaan. Vesilintujen poikastuotto koko alueellaoli heikko. Metsälintujen reviirimäärä Mustavuoressaoli sama kuin edellisenä vuonna. Kasaberget–Labbackan alueella lajimäärä pieneni selvästi edellisestävuodesta. Saaristolintujen kannat pysyivätennallaan [34].Vuosi 2006Vuoden 2006 loppuun mennessä oli tehty merkittävimmätvuonna 2003 aloitetuista ruoppauksistasamoin kuin suurimmat täytöt. Koillisreunan meluseinävalmistui viimeistä <strong>ja</strong>ksoa lukuun ottamatta.Porvarinlahden alittava tietunneli louhittiin loppuunhelmikuussa <strong>ja</strong> Labbackan ratatunneli syyskuussa.Rakentamisen ei havaittu muuttaneen seurantaalueenlintukanto<strong>ja</strong>. Yhdenkään direktiivi- tai uhanalaisluokitukseenkuuluvan lajin kanta ei viidenensimmäisen seurantavuoden aikana ollut noussuttai laskenut tilastollisesti merkitsevästi.Porvarinlahdella havaittiin kaksi pikkulepinkäisreviiriämutta kirjokertulla tai ruisrääkällä ei yhtään.Sen si<strong>ja</strong>an Porvarinlahden silkkiuikkumäärä kasvoiedelleen, mikä nosti linnustotiheyttä. Bruksvikeninsilkkiuikkujen <strong>ja</strong> muiden lajien määrä sekä linnustontiheys <strong>ja</strong> lahden suojelupistearvo alenivat.Österängenin peltoalueen linnusto laskettiin kolmenvuoden tauon jälkeen. Tänä aikana alue oli tien,radan <strong>ja</strong> meluvallien rakentamisen vuoksi muuttunutpaljon. Meluvallien istutukset olivat kuitenkin lisänneetluonnon monimuotoisuutta verrattuna aikaisempaan,jolloin koko pelto oli tehoviljelyssä. Lajimääräoli lisääntynyt neljällä <strong>ja</strong> reviirimäärä kaksinkertaistunut.Runsain laji oli kiuru, jolla oli 22 reviiriä.Saaristolintujen kannat olivat pysyneet ennallaan,mutta pienet kahlaa<strong>ja</strong>t vähenivät sekä seuranta-että vertailuluodoilla. Mustavuoren metsä-SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö123


alueen lajimäärä oli sama kuin edellisenä vuonna,mutta Kasaberget–Labbacka-alueen lajimäärä kasvoivähän [35].Vuosi 2007Porvarinlahdella oli kaksi pikkulepinkäisreviiriä <strong>ja</strong>Bruksvikenillä yksi. Porvarinlahdella ei todettu ruisrääkänreviireitä, vaan lähimmät olivat <strong>Vuosaaren</strong>huipunrinteillä. Kirjokerttu on havaittu alueella viimeksivuonna 2002. Porvarinlahden <strong>ja</strong> Bruksvikeninkosteikkolintujen pari- <strong>ja</strong> lajimäärät olivat suunnilleensamat kuin edellisenä vuonna.Metsäalueiden linnusto on muuttunut vain hieman.Reviiri- <strong>ja</strong> lajimäärä kasvoivat vähän edellisestävuodesta. Laulurastas <strong>ja</strong> satakieli ovat runsastuneetMustavuoressa tilastollisesti merkitsevästi.Direktiivi- tai uhanalaisluokitukseen kuuluvistalajeista on kivitaskun kanta kasvanut tilastollisestimerkitsevästi. Tähän on ilmeisesti syynä lajillesopivien elinpaikkojen syntyminen rakennustöidenyhteydessä.Vesilintujen poikastuotto tutkimusalueella oliedelleen heikko mutta parani sinisorsalla, telkällä <strong>ja</strong>tukkasotkalla. Saaristolintujen kannat olivat pysyneetpääosin ennallaan sekä seuranta- että vertailuluodoilla[36].Kuva 13.5Kelta- <strong>ja</strong> valkovuokko<strong>ja</strong>Porvarinlahdenlehtoalueella.Kuva: Lauri Erävuori13.4 Kasvillisuuden seuranta13.4.1 Kasvillisuusseurannan tavoitteet<strong>ja</strong> toteuttaminenVuonna 2000 valmistuneen <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenluontovaikutusten seurantaohjelman luonnoksen[17] poh<strong>ja</strong>lta laadittiin vuonna 2001 Kasvillisuudenseurantaohjelma [14]. Sen mukaankasvillisuuden seurannan tehtävät ovat:• Antaa tietoa alueen ympäristön tilasta, luonnonsuojelullisistaarvoista <strong>ja</strong> niiden kehityksestä sekämaaliikenneyhteyksien <strong>ja</strong> <strong>satama</strong>n rakentamisensekä liikenteen <strong>ja</strong> <strong>satama</strong>toimintojen vaikutuksistaniihin.• Tarjota linnustonseurannalle luotettavaa tietoa linnustonelinympäristöjen tilasta <strong>ja</strong> muutoksista.• Dokumentoida mahdollisten hoitotoimien vaikutuksiaalueen luontoon.Kasvillisuuden seuranta aloitettiin vuonna 2002.Samalla seurantaohjelmaa täydennettiin [16], koskapidettiin tarpeellisena seurata kasvillisuutta myösSavion rautatietunnelin vaikutusalueella. Kesä 2002oli erittäin vähäsateinen, <strong>ja</strong> tutkimuksilla saatiin tietoakuivan kesän vaikutuksista erityisesti puustoisiinsoihin. Puustoiset suot <strong>ja</strong> metsäluhdat ovat ns. prio-risoitu<strong>ja</strong> (ensisi<strong>ja</strong>isesti suojeltu<strong>ja</strong>) luontotyyppejä,jotka kuuluvat Mustavuoren lehdon <strong>ja</strong> Östersundominlintuvesien Natura-alueen (FI0100065) suojelunperusteisiin. Näiden luontotyyppien esiintymät Mustavuoren,Porvarinlahden, Labbackan <strong>ja</strong> Kasabergetinalueella kartoitettiin vuonna 1997 [12]. <strong>Satama</strong>nmaaliikenneyhteyksien <strong>ja</strong> tunneleiden suunnittelussaotettiin huomioon luontotyyppien esiintymät<strong>ja</strong> haluttiin estää haitat niille. Labbackan pienistäpuustoisista soista kolme si<strong>ja</strong>itsee rata- <strong>ja</strong> tietunnelinpäällä tai välittömässä läheisyydessä.Labbackan puustoisten soiden seurantaa on tehtyvuosittain. Ensimmäisenä seurantavuonna 2002 laadittiinkohteista yleisluonnehdinta, valokuvattiinkohteet, määriteltiin kasvillisuuden kokonaispeittävyys<strong>ja</strong> perustettiin kasvillisuusruudut. Tunnelirakentamisenvaikutuksia arvioidaan neljälle suolaikulleperustetun yhdeksän pysyvän näytealan avulla.Vastaavia kasvillisuusruutu<strong>ja</strong> perustettiin vertailualueillevuonna 2003 [16]. Kontrollialat valittiin lähialueeltasiten, että ne vastaavat kasvillisuudeltaanmahdollisimman hyvin varsinaisia seuranta-alo<strong>ja</strong>.Näytealoilta tutkitaan vuosittain kasvillisuuskerrokset,kasvilajisto <strong>ja</strong> peittävyysprosentit.Ensisi<strong>ja</strong>isesti suojeltujen luontotyyppien seurantaavarten Natura-alueelle on perustettu kasvillisuusprofiilitmyös kahdelle metsäluhtien esiintymälle <strong>ja</strong>yksi vertailualueelle sekä kaksi metsä/lehtolin<strong>ja</strong>a <strong>ja</strong>yksi suolin<strong>ja</strong>. Profiileista tutkitaan kasvillisuuskerrokset,kasvilajisto <strong>ja</strong> peittävyysprosentit. Kohteetvalokuvataan jokaisella seurantakerralla samoistakiintopisteistä.124 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 13.6Labbackanpuustoiset suotPorvarinlahden lehdon sekä Savion rautatietunnelinvaikutusalueella olevien Kuusijärven puronvarsilehdon,O<strong>ja</strong>ngon kallionaluslehdon <strong>ja</strong> Hakunilanpystykuilun puuston seuranta aloitettiin varsinaisestivuonna 2003 [16]. Savion tunnelin <strong>ja</strong>ksolla olevienseuranta-alueista tutkitaan• puu- <strong>ja</strong> pensaskerrosten lajisuhteet• arvio puuston <strong>ja</strong> pensaskerroksen runsaudesta/peittävyydestä• arvio tammien, tervaleppien ym. puiden kunnosta• pystyyn kuolleiden puiden runsaus/määrä• poh<strong>ja</strong>- <strong>ja</strong> kenttäkerrosten valtalajit• mahdolliset kosteutta ilmentävät poh<strong>ja</strong>- <strong>ja</strong> kenttäkerroksensammal- <strong>ja</strong> putkilokasvit runsaus- <strong>ja</strong>si<strong>ja</strong>intitietoineen• tiedot kohteen virkistyskäytöstä <strong>ja</strong> siitä johtuvastakuluneisuudesta sekä muista haitoista• arvio kohteen luontaisesta sukkessiokehityssuunnasta.Kasvillisuuden seurantaohjelma on laadittu vuoteen2011 saakka. Seuranta käsittää rakentamistaedeltävän a<strong>ja</strong>n, rakentamisa<strong>ja</strong>n <strong>ja</strong> toiminnan alkuvuodet.Sitä oh<strong>ja</strong>avat hankkeesta vastaavien edustajienlisäksi <strong>Helsingin</strong> kaupungin ympäristökeskuksen<strong>ja</strong> Vantaan kaupungin ympäristökeskuksenasiantunti<strong>ja</strong>t.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen kasvillisuuden seurantaon järjestetty <strong>Helsingin</strong> <strong>Satama</strong>n <strong>ja</strong> <strong>Vuosaaren</strong><strong>satama</strong>n liikenneyhteydet -projektin sekä <strong>Helsingin</strong>ympäristökeskuksen yhteistyönä. Raportit vuosilta2002–2007 on julkaistu <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen<strong>ja</strong> VUOLI-projektin julkaisuina.13.4.2 Kasvillisuusseurannan tuloksetVuosi 2002Labbackan kallion päällä olevien puustoisten soidenesiintymien seuranta aloitettiin syksyllä,koska haluttiin saada lähtötietoa kuivan kasvukaudenvaikutuksista kasvillisuuteen. Tavanomaistavähäsateisemman <strong>ja</strong> lämpimämmän kesän vuoksivarpukasvillisuus kärsi kuivuudesta. Myöhäineninventointia<strong>ja</strong>nkohta ei antanut vertailukelpoistalähtötietoa puusto-, pensas- <strong>ja</strong> kenttäkerrosten peittävyydestä[16].Vuosi 2003Vuoden 2003 tulokset kuvaavat tilannetta ennen <strong>satama</strong>nmaaliikenneyhteyksien rakentamista. Edellisenvuoden kuivuuden vaikutuksia havaittiin varsinkinkenttäkerroksen lajistossa. Kahdella puustoisellasuolla oli työkoneiden ajouria. Kuusijärven seurantakohteenkasvillisuus oli selvästi edellistä kuivaa syksyärehevämpää. Muilla rautatietunnelin vaikutusalueenkohteilla ei havaittu muutoksia [1].SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö125


Vuosi 2004Vuonna 2004 inventoitiin vain Labbackan puustoisetsuot <strong>ja</strong> niiden vertailukohteet. Labbackan tunnelitöitäei aloitettu vielä kesällä. Puustoisilla soilla eihavaittu muutoksia edelliseen vuoteen verrattuna [2].Vuosi 2005Labbackan rautatietunnelin rakentaminen oli edennytavolouhintaosuuksien valmistumiseen kesällä2005. Porvarinlahden ratasilta oli melkein valmis.Seurantaan kuuluivat puustoisten soiden lisäksiMustavuoren kasvillisuuslinjojen inventoinnit.Puustoisten soiden kasvillisuudessa ei ollut merkittäviämuutoksia aiempiin tuloksiin verrattuna. Kasvillisuuslinjoillaei havaittu rakennustöiden aiheuttamiamuutoksia. Porvarinlahden lehdon valoisuusoli lisääntynyt ratapihan rakentamisen <strong>ja</strong> edellisenvuoden myrskykaatojen takia. Lehdon lajistossa eikuitenkaan havaittu muutoksia [3].Vuosi 2006Tietunneli Porvarinlahden <strong>ja</strong> Labbackan ali puhkaistiinläpi helmikuussa 2006. Vuoden 2006 kasvillisuudenseurantatulokset kuvaavat rakentamisen aikaisiavaikutuksia. Vuosien 2002–2005 tulokset antavatkuvan kasvillisuuden luontaisesta vaihtelusta.Puustoisten soiden kasvillisuudessa ei havaittumerkittäviä muutoksia aiempiin vuosiin verrattuna.Kesäkuukausien kuivuus näkyi loppukesälläsekä seurantasoilla että vertailualueilla joidenkinlajien lakastumisena. Porvarinlahden lehdon lehtolajistossaei ollut muutoksia, vaikka sanan<strong>ja</strong>lka <strong>ja</strong>vadelma olivat yleistyneet alueella [21].Vuosi 2007Vuonna 2007 seuranta käsitti puustoisten soiden <strong>ja</strong>Porvarinlahden lisäksi Savion rautatietunnelin vaikutusalueenkohteet. Puustoisten soiden kasvillisuudessaei ollut merkittäviä muutoksia aiempiin vuosiinverrattuna. Porvarinlahden lehdon valoisuuden lisääntymiselläei edelleenkään havaittu vaikutuksia lehtolajistoon.Savion rautatietunnelin seurantakohteillaei tapahtunut merkittäviä kasvillisuusmuutoksia [4].13.5 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seuranta13.5.1 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seurannantavoitteet <strong>ja</strong> toteuttaminenLinnuston <strong>ja</strong> kasvillisuuden lisäksi vuonna 2000valmistuneen luontovaikutusten seurantaohjelmanluonnokseen kuului poh<strong>ja</strong>vesien seuranta [17]. Seurantaaloitettiin keväällä 2000 asentamalla Labbackanalueelle poh<strong>ja</strong>vesiputkia <strong>ja</strong> kartoittamallakaivot rautatietunnelin ympäristössä välillä Porvoonväylä–Savio.Syksyllä aloitettiin Labbackanrautatietunnelin <strong>ja</strong> Porvarinlahden tietunnelin sekäSavion rautatietunnelin vaikutusalueilla poh<strong>ja</strong>vesientihennetty seuranta.Seurantaohjelman luonnoksen poh<strong>ja</strong>lta laadittiinvuonna 2001 poh<strong>ja</strong>vesien seurantaohjelma [18],jonka mukaan tavoitteet ovat:• Antaa riittävät lähtötiedot poh<strong>ja</strong>veden nykytilastasuunnittelun aikana ennen rakentamista.• Antaa <strong>ja</strong>tkuvaa tietoa tilanteesta toteutus- <strong>ja</strong> seurantaorganisaatioillemahdollisista poh<strong>ja</strong>vesiolosuhteidenmuutoksista toimenpiteiden ratkaisuavarten.• Varmistaa, että hankkeen vaikutusalueella ei aiheutetaluonnolle <strong>ja</strong> lähiympäristön käytölle haitto<strong>ja</strong>.• Oh<strong>ja</strong>ta rakennussuunnitteluvaiheen tutkimuksiaarvioiduille <strong>ja</strong> todetuille riskialttiille alueille,jotka vaativat tarkempia tutkimuksia.• Antaa perusteita rakennusaikaisen seurantaohjelmantarkentamista varten.• Antaa tarkentavaa tietoa kasvillisuusseurannanlähtökohdiksi arvioitaessa maaliikenneyhteyksienrakentamisen vaikutuksia Porvarinlahden <strong>ja</strong>Labbackan Natura-alueille.Vuonna 2004 valmistui aikaisempaa ohjelmaa täydentävä<strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksienpintavesien, poh<strong>ja</strong>vesien <strong>ja</strong> painumien seurantaohjelma[10]. Sen yhteydessä tehtiin Porvarinlahdentietunnelin <strong>ja</strong> Labbackan rautatietunnelin sekäSavion rautatietunnelin rakennusaikaisten vuoto-,huuhtelu-, pesu- <strong>ja</strong> kasteluvesien hallintaohjelma[10]. Ohjelmissa otettiin huomioon rakentamistakoskevien lupien velvoitteet.Poh<strong>ja</strong>vesiolosuhteiden lisäksi seurataan Kuusijärventulo- <strong>ja</strong> lähtöojien virtaamia, järven pinnankorkeutta, tunnelien vuotovesien määrää <strong>ja</strong> laatuasekä poisjohtamiseen käytettävien ojien virtaamaa<strong>ja</strong> vedenlaatua. Vantaan kaupungin analyysituloksetKuusijärven uimaveden laadusta liitetään seurantaan.Lisäksi seurataan Porvarinlahden <strong>ja</strong> siihenjohtavan o<strong>ja</strong>n vedenlaatua. Porvarinlahdelta otetaan126 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 13.7Ote seurantaohjelmakartasta,väliltäItä-Hakkila – Myras.Kuva: Juha Salmelainen,Ramboll Oyvesinäytteet lahden pohjukasta <strong>ja</strong> ulompaa mereltä.Österängenin meluvallin pinta- <strong>ja</strong> poh<strong>ja</strong>vesivaikutuksiaseurataan, koska valliin on käytetty vanho<strong>ja</strong>autonrenkaita.Painumaherkillä alueilla on seurattu rakennusten<strong>ja</strong> rakenteiden mahdollisia painumia vuodesta 2001.Kiinteistöjen painumaseurannan lisäksi seurataanvoimajohto<strong>ja</strong>, tie-, katu- <strong>ja</strong> piha-alueita sekä maakaasuputkea.Toimenpiteet <strong>ja</strong> seurantatiheys määriteltiin hankkeenvaiheiden mukaan: seuranta ennen rakentamista,kalliorakennusurakan aikana (louhinta,lujitus, tiivistys), tunneleiden sisärakenteiden <strong>ja</strong>varusteiden asennusurakan aikana sekä seuranta tunneleidenkäytön aikana.<strong>Vuosaaren</strong> <strong>satama</strong>radan ratapihan <strong>ja</strong> Savion rautatietunnelinpohjoisen suuaukon välillä on noin 250poh<strong>ja</strong>veden havaintoputkea. Kaivoselvitysten perusteellatunneleiden lähialueella on 1350 kaivoa, joista250 si<strong>ja</strong>itsee ilman kunnallistekniikkaa olevilla alueilla.Seurantaan on otettu noin 100 –200 metrin etäisyydelläolevia porakaivo<strong>ja</strong> sekä ilman kunnallistekniikkaaolevilla alueilla <strong>ja</strong> painumaherkillä alueiltaolevia maakaivo<strong>ja</strong>. Seurattavia kaivo<strong>ja</strong> on noin 160.Seurannassa noudatetaan Suomessa standardoitu<strong>ja</strong>tai yleisesti hyväksyttyjä menetelmiä. Mittaustentekijät ovat ammattihenkilöitä <strong>ja</strong> vesinäytteidenotta<strong>ja</strong>t tehtäväänsä sertifioitu<strong>ja</strong>. Maastohenkilöstölleon laadittu ohjeet.<strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneyhteyksien seurannastavastaa VUOLI-projekti. Vesilain mukaisiinlupapäätöksiin kuuluvien tarkkailu- <strong>ja</strong> seurantaohjelmiennoudattamista valvoo Uudenmaanympäristökeskus. Seuranta on reaaliaikaista. Ohjelmaatäydennetään tai muutetaan tarvittaessa. Raportittuloksista <strong>ja</strong> johtopäätöksistä sekä mahdollisetmuutosesitykset käsitellään ympäristöviranomaistenkanssa kuukausittain. Seurannassa olevien yksityistenkaivojen omistajille <strong>ja</strong> painumaseurannassamukana olevien kiinteistöjen omistajille toimitetaanmittaustiedot vuosittain.SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö127


Kuva 13.8Poh<strong>ja</strong>vedenesiitymismuoto<strong>ja</strong>.1. Läpäisevä maakerros(esi. sora/hiekka),2. Poh<strong>ja</strong>veden pinta,3. Poh<strong>ja</strong>vesi,4. Kalliopoh<strong>ja</strong>vesi,5. Vettä läpäisemätönkerros (esim. savi),6. Orsivesi,7. Paineellinenpoh<strong>ja</strong>vesi,8. Arteesinen kaivo,9. Hyvin vettä johtavakallion heikkousvyöhykeKuva: Juha Salmelainen,Ramboll Oy13.5.2 Poh<strong>ja</strong>- <strong>ja</strong> pintavesien seurannan tuloksetVuodet 2000 –2004Vuosien 2000 –2004 tulokset antoivat merkittäväätausta-aineistoa luonnollisista poh<strong>ja</strong>- <strong>ja</strong> pintavesivaihteluistaseuranta-alueella. Erityisen kuiva kesä2002 näkyi selvästi tuloksissa. Kesän 2004 poikkeuksellisenrunsaat sateet palauttivat poh<strong>ja</strong>vesipinnatmonin paikoin takaisin pitkäaikaisille tasoille [20].Vuosi 2005Vuoden 2005 tulosten perusteella Labbackan rautatietunnelin<strong>ja</strong> Porvarinlahden tietunnelin rakentaminenvaikutti kallioperän poh<strong>ja</strong>vesipintaan laskevastilaajemmin <strong>Vuosaaren</strong> kaatopaikan itäreunalla<strong>ja</strong> suppeasti tunnelien pohjoisella suuaukolla Labbackassa.Maakerrosten poh<strong>ja</strong>vesipinnoissa muutostaei juuri havaittu. Tunnelirakentaminen tai Österängeninmeluvallien rakentaminen ei vaikuttanutpoh<strong>ja</strong>veden laatuun [9].Savion rautatietunnelin rakentaminen alensi kalliopoh<strong>ja</strong>vedenpintaa useita metrejä mm. Långmossabergeninajotunnelin lähialueella, Kaskelanruhjeen alueella, Itä-Hakkilan pientaloalueella <strong>ja</strong>Kuninkaanmäen ajotunnelin ympäristössä. Näilläalueilla vaikutukset maaperän poh<strong>ja</strong>veteen olivatvähäisiä eikä rakentaminen aiheuttanut edes tilapäisiähaitto<strong>ja</strong> yksityisille talousvesikaivoille [9].den tavoin. Kalliopoh<strong>ja</strong>veden virtaussuunnat olivatmonin paikoin kääntyneet kohti tunnelia. Kuusijärvenlänsipuolella poh<strong>ja</strong>veden pintojen aleneminenalkoi syksyllä muuttaa järven purkautumissuuntaapoikkeuksellisesti länteen. Kalliopoh<strong>ja</strong>veden pinnatalenivat monin paikoin ennalta arvioitua enemmän,mutta alenemista ei aiheutunut haittaa. Maaperänpoh<strong>ja</strong>veden pintojen alenemat olivat ennalta arvioitu<strong>ja</strong>pienemmät. Tunnelirakentamisen ei havaittuaiheuttaneen haitto<strong>ja</strong> yksityisille talousvesikaivoilletai Fazerilan poh<strong>ja</strong>vesialueelle eikä muuttaneen merkitsevästipoh<strong>ja</strong>veden virtauskuvaa rautatietunnelin<strong>ja</strong> Savion kaatopaikka-alueen välillä [9].Vuosi 2007Seurantaa tehtiin vuonna 2004 valmistuneen seurantaohjelman<strong>ja</strong> ympäristöviranomaisten kanssa sovittujenmuutosten mukaan.Vuosi 2007 oli harvinaisen lämmin <strong>ja</strong> suuressaosassa maata tavanomaista sateisempi. Poh<strong>ja</strong>vedenpinnat olivat vuoden alussa suuressa osin maataa<strong>ja</strong>nkohdan keskiarvoa korkeammalla. Lumet sulivataikaisin <strong>ja</strong> Etelä-Suomessa poh<strong>ja</strong>vedet kääntyivätlaskuun jo huhtikuun lopulla. Heinäkuun loppupuolensateet kostuttivat maata <strong>ja</strong> moreenimaillapoh<strong>ja</strong>veden pinnat kääntyivät jo nousuun.Tunnelin rakentaminen oli joissakin kohdin alentanutkalliopoh<strong>ja</strong>vedenpintaa tunnelilin<strong>ja</strong>lla <strong>ja</strong> eteläiselläsuuaukolla. Tunnelilin<strong>ja</strong>n ulkopuolella poh<strong>ja</strong>vedenpinnanmuutokset johtuivat luonnollisestasadannasta <strong>ja</strong> valunnasta.Kuva 13.9Suomen kallioperässä vesikulkeutuu rakoilua pitkin.Kuva: Juha Salmelainen,Ramboll OyVuosi 2006Vuoden 2006 kesä <strong>ja</strong> alkusyksy olivat kuivia, <strong>ja</strong> poh<strong>ja</strong>vedenpinnat alenivat yleisesti lähes vuoden 2002tasolle. Loka- <strong>ja</strong> marraskuun runsaat sateet palauttivatpoh<strong>ja</strong>veden pinnat normaalitasolle [9].Savion rautatietunnelin rakentamisen havaittiinalentaneen kalliopoh<strong>ja</strong>veden pintaa edellisen vuo-128 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Savion rautatietunnelin alueella tunnelin rakentaminenoli paikoin alentanut mm. Långmossabergeninajotunnelin lähialueella, Hakunilan kartanonympäristössä, Kaskelan ruhjeen alueella, Itä-Hakkilanpientaloalueella <strong>ja</strong> Kuninkaanmäen ajotunnelinympäristössä kalliopoh<strong>ja</strong>veden pintaa useita metrejä.Kuusijärven länsipuolella poh<strong>ja</strong>veden pintojenaleneminen alkoi syksyllä 2006 muuttaa järvenpurkautumissuuntaa poikkeuksellisesti kohti länttä.Vuonna 2007 virtauskynnys palautui luontaisellepaikalleen.Useimmilla alueilla haitalliset vaikutukset maaperänpoh<strong>ja</strong>veteen olivat melko vähäisiä. Hakunilanalueen eteläreunalla maaperän poh<strong>ja</strong>veden pinnatalenivat vuoden 2006 aikana runsaat kolme metriäeivätkä ne olleet vielä vuoden 2007 lopussa palautuneetkuten useimmilla muilla alueilla. Tunnelirakentamisenei todettu aiheuttaneen haitto<strong>ja</strong> yksityisilletalousvesikaivoille. Fazerilan poh<strong>ja</strong>vesialueen <strong>ja</strong>tunnelin välillä olevissa poh<strong>ja</strong>vesiputkissa ei todettusellaisia poh<strong>ja</strong>veden pinnan muutoksia, jotka voisivatvaikuttaa Fazerilan poh<strong>ja</strong>vesialueen virtauskuvaan.Rakentaminen ei myöskään aiheuttanut merkittäviävirtauskuvan muutoksia rautatietunnelin <strong>ja</strong>Savion kaatopaikan välisellä alueella.Kalliopoh<strong>ja</strong>veden pinnat ovat paikoin alentuneetenemmän kuin ennalta arvioitiin. Siitä ei kuitenkaanole aiheutunut haittavaikutuksia eikä niitä arvioidaaiheutuvan pitemmällä a<strong>ja</strong>n<strong>ja</strong>ksollakaan. Maaperänpoh<strong>ja</strong>veden pintojen alenemat ovat olleet keskimäärinarvioitu<strong>ja</strong> pienempiä. Pidemmällä a<strong>ja</strong>n<strong>ja</strong>ksollaselviää, miten tiivistystoimenpiteet ovat vaikuttaneettunnelin ympäristön poh<strong>ja</strong>veden pintoihin [37].13.6 Vesistö- <strong>ja</strong> kalatalousseurantaKuva 13.10Sedimenttinäytteenottoaläjitysalueelta.Kuva: Sauli Vatanen13.6.1 Vesistö- <strong>ja</strong> kalataloustarkkailuohjelma<strong>Satama</strong>hankkeen vesistö- <strong>ja</strong> kalataloustarkkailuvelvoiteon asetettu Länsi-Suomen vesioikeudenvuonna 1998 <strong>Helsingin</strong> <strong>Satama</strong>lle <strong>ja</strong> Merenkulkulaitoksellemyöntämässä vesiluvassa [17], joka koski<strong>satama</strong>n ensimmäisen vaiheen rakentamista, ruopattavienmassojen läjittämistä mereen, merihiekanottoa, <strong>satama</strong>an johtavan väylän rakentamista <strong>ja</strong> väylänmääräämistä julkiseksi kulkuväyläksi. Seurantavelvoitteetkoskevat <strong>satama</strong>n <strong>ja</strong> väylän rakennustöiden,ruoppausmassojen läjityksen, merihiekan oton<strong>ja</strong> <strong>satama</strong>n käytön vaikutuksia merialueella sekä vaikutuksiakalakantoihin <strong>ja</strong> kalastukseen.Vesistö- <strong>ja</strong> kalataloustarkkailun poh<strong>ja</strong>na onpoikkeuksellisen pitkäaikainen, yli 10 vuotta ennen<strong>satama</strong>hankkeen rakennustöiden käynnistämistäaloitettu ennakkotarkkailu, johon on sisältynyt mm.veden laadun, poh<strong>ja</strong>eläinten, vesikasvillisuuden,sedimentaation <strong>ja</strong> kalaston seurantaa.Vesiluvan edellyttämä ensimmäinen vesistö- <strong>ja</strong>kalataloustarkkailuohjelma valmistui 13. 2. 2003.Tarkkailu aloitettiin keväällä 2003. Rakentamisaikaistatarkkailuohjelmaa on tarkistettu useita kerto<strong>ja</strong><strong>satama</strong>-alueen sedimentistä löytyneen TBT:n(ks. luku 9) <strong>ja</strong> myöhemmin myönnettyjen lupienmääräysten vuoksi sekä vesistötöiden etenemisenmukaan. Merkittävimmät muutokset ovat liittyneetTBT:n pilaamien alueiden puhdistusruoppaukseen.Vesistö- <strong>ja</strong> kalatalousohjelman <strong>ja</strong> siihen tehdyt muutoksetovat hyväksyneet Uudenmaan ympäristökeskus<strong>ja</strong> Uudenmaan työvoima- <strong>ja</strong> elinkeinokeskus.Rakentamisaikainen tarkkailu on ollut sekämenetelmällisesti että alueellisesti poikkeuksellisenkattavaa. Keskeisimpiä menetelmiä <strong>ja</strong> tutkimuksiaovat olleet:• innovatiiviseen tekniikkaan perustuvat veteensekoittuneen kiintoaineen määrää kuvaavansameuden leviämiskartoitukset (sisältävät läpivirtaus-<strong>ja</strong> vertikaaliprofiilimittaukset sekä automaattiasemillatoteutetut sameus- <strong>ja</strong> virtausmittaukset)SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö129


• kiintoaineen leviämisen matemaattinen mallinnus• fysikaalis-kemiallinen vedenlaatututkimus (sisältääveden orgaaniset tinayhdisteet)• vesikasvillisuuden sukelluslin<strong>ja</strong>t <strong>ja</strong> yleiskartoitussekä ilmavalokuvaus• poh<strong>ja</strong>eläintutkimus• sedimentaatiotutkimus• liejusimpukoiden orgaaniset tinayhdisteet <strong>ja</strong> PCB• sedimentin orgaaniset tinayhdisteet, PCB <strong>ja</strong> raskasmetallit• kalojen orgaaniset tinayhdisteet, PCB <strong>ja</strong> elohopea• silakan kututarkkailu• kalanpoikaspyynnit• ammatti- <strong>ja</strong> vapaa-a<strong>ja</strong>nkalastuksen seuranta.Lisäksi tarkkailuun on sisältynyt mm. hiekanottoonliittyvä kiintoainekuormitusseuranta sekä paljonpoh<strong>ja</strong>olosuhteissa tapahtuneiden muutosten selvittämiseksitoteutettu<strong>ja</strong> tarkkuuskaikuluotauksia. Tarkkailualueenlaajuus on ollut pohjois–etelä-suunnassayli 20 km <strong>ja</strong> itä–länsi-suunnassa yli 10 km.Vuosina 2003–2007 toteutetusta vesistö- <strong>ja</strong> kalatalousseurannastaon laadittu vuosiraportit [19, 25–28],joista ilmenevät tiedot vesistötöistä, lupamääräyksistä,ohjelmasta, menetelmistä, toteutuksesta <strong>ja</strong>tuloksista.13.6.2 Vesistö- <strong>ja</strong> kalatalousseurannan tuloksetVuosi 2003<strong>Vuosaaren</strong> <strong>satama</strong>n rakentaminen <strong>ja</strong> vesilupaan liittyvävelvoitetarkkailu aloitettiin vuonna 2003. Vuodenalussa laadittua tarkkailuohjelmaa täydennettiin,koska maaliskuussa <strong>Vuosaaren</strong> <strong>satama</strong>n edustansedimenteistä otetuissa näytteissä todettiin esiintyvänkorkeita TBT-pitoisuuksia.<strong>Satama</strong>-alueelta ruopattiin kesä–joulukuussa 0,30milj. m³ktr meriläjityskelpoisia savimasso<strong>ja</strong>. Uuttatäyttöaluetta tehtiin noin 7 ha. Seurantaan kuuluivatsameuskartoitukset, virtaustutkimukset, veden laadunseuranta,sedimentaation seuranta, TBT-pitoisuuksienseuranta vedestä, sedimentistä, liejusimpukoista<strong>ja</strong> kaloista, vesikasvillisuuden seuranta,poh<strong>ja</strong>eläintutkimus, kalojen kutuseuranta, kalanpoikaspyynnitsekä ammatti- <strong>ja</strong> vapaa-a<strong>ja</strong>nkalastuksenseuranta.Sameuden <strong>ja</strong> kiintoaineen leviäminen rajoittuimuutaman sadan metrin etäisyydelle <strong>satama</strong>n ruoppauskohteista.Kiintoaine ei levinnyt Porvarinlahdelle.Meriläjitysalueen ympäristössä samennustaoli havaittavissa vielä noin 2,5 kilometrin etäisyydelläalueen keskipisteestä. Kiintoaine ei levinnytSöderskärin suojelualueelle. Vedenlaatu- <strong>ja</strong> sedi-Kuva 13.11Sameuden pintakartat<strong>Vuosaaren</strong> <strong>satama</strong>työmaanympäristössäheinäkuussa 2003–2007.Kuva:Luode Consulting OyVuosaari 1.7.2003 Vuosaari 1.7.20041. 7.2003 1. 7.2004100 NTU90 NTU80 NTU70 NTU60 NTU50 NTU40 NTU30 NTU20 NTU10 NTU0 NTUVuosaari 11-07-2005 Sameus11. 7.2005 Vuosaari 11-7-2006 Sameus 11. 7.2006 Vuosaari 5-7-2007 Sameus 5. 7.2007130 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


mentaatiotulosten mukaan ruoppausten vaikutuksetilmenivät selvästi vain Niinilahden näytteissä.Poh<strong>ja</strong>eläimistön tila oli pysynyt ennallaan. Vesikasvustolinjoillaei havaittu töiden vaikutuksia.<strong>Satama</strong>työmaan ympäristön pintasedimenttienTBT-pitoisuudet olivat syksyllä 2003 samalla tasollakuin maaliskuussa. Meriläjitysalueen ympäristössäne olivat samaa tasoa kuin <strong>satama</strong>työmaan ympäristössä.Heinäkuussa <strong>ja</strong> syys–lokakuun vaihteessa liejusimpukoidenTBT-pitoisuudet olivat Kalkkisaarenselällä<strong>ja</strong> sen ympäristössä sekä läjitysalueen ympäristössä<strong>ja</strong> vertailualueella yllättävän korkeita.Kaloissa TBT:tä oli eniten ahvenissa <strong>ja</strong> vähiten kampeloissa.Pitoisuudet eivät olleet niin korkeita, ettäkalojen käyttörajoituksia olisi tarvittu. Kaloissa eitodettu PCB-yhdisteitä.Silakan kutu oli koko tutkimusalueella vilkasta.Poikasnuottaustutkimuksissa oli ennakkotarkkailutulostentapaan suurta vaihtelua. Alueen ammattikalastajistava<strong>ja</strong>a puolet arvioi <strong>satama</strong>rakentamisenhaitanneen kalastusta. Vapaa-a<strong>ja</strong>nkalastajia huolestuttivatrehevöityminen, pyydysten likaantuminen <strong>ja</strong>TBT.lähiympäristön <strong>ja</strong> vertailualueiden välillä. Meriläjitysalueella<strong>ja</strong> sen ympäristössä orgaanisten tinayhdisteidenpitoisuudet sedimentissä <strong>ja</strong> liejusimpukoissalaskivat hieman vuodesta 2003.Silakan kutua havaittiin edellisvuotta vähemmän.Poikasnuottausten perusteella poikasten kunto olihyvä. Ammattikalasta<strong>ja</strong>t ilmoittivat rakennustöidenkarkottavan kalo<strong>ja</strong> <strong>ja</strong> likaavan pyydyksiä.Vuosi 2005TBT:llä pilaantuneita sedimenttejä ruopattiin 0,45milj. m³ktr), <strong>satama</strong>a <strong>ja</strong> väylää ruopattiin yhteensä2,21 milj. m³ktr, savimasso<strong>ja</strong> läjitettiin yhteensä 1,96milj. m³ktr, merihiekkaa otettiin 2,47 milj. proomum³<strong>ja</strong> <strong>satama</strong>a täytettiin noin 25 ha.Seurantaan sisältyivät sameuskartoitukset, mallitarkastelu,veden laadun <strong>ja</strong> sedimentaation seuranta,TBT:n <strong>ja</strong> muiden organotinayhdisteiden pitoisuuksienseuranta, vesikasvillisuuden seuranta, silakankutuseuranta, kalanpoikaspyynnit, ammattikalastuksenseuranta sekä hiekanoton kiintoainekuormitusseuranta.Kuva 13.12TBT-suo<strong>ja</strong>verhokesäkuussa 2005.Kuva: Sami Kurikka/ SkylinefotoVuosi 2004<strong>Satama</strong>hankkeen rakentaminen <strong>ja</strong>tkui vuonna2004 mm. <strong>satama</strong>-alueen <strong>ja</strong> väylän ruoppauksilla(yhteensä 2,55 milj. m³ktr), savimassojen läjityksillä(yhteensä 1,88 milj. m³ktr), merihiekan otolla (1,65milj. proomu-m³) <strong>ja</strong> <strong>satama</strong>n täytöillä (noin 13 ha).Seurantaan sisältyivät sameuskartoitukset, mallitarkastelu,veden laadun <strong>ja</strong> sedimentaation seuranta,TBT:n <strong>ja</strong> muiden organotinayhdisteiden pitoisuuksienseuranta vedestä, sedimentistä, liejusimpukoista<strong>ja</strong> kaloista, sekä vesikasvillisuuden seuranta, kalojenkutuseuranta, kalanpoikaspyynnit, ammattikalastuksenseuranta <strong>ja</strong> hiekanoton kiintoainekuormituksenseuranta.Kalkkisaarenselällä havaittiin välillä voimakastaveden samentumista, joka ulottui Skatanselälle.Sameusarvojen nousu liittyi merihiekan purkamiseen<strong>satama</strong>-alueen täyttöihin. Meriläjitysalueellasameuden havaittiin pysyvän pääosin poh<strong>ja</strong>n läheisyydessä<strong>ja</strong> läjitysalueen rajojen sisällä. Hiekanotonsameutta lisäävä vaikutus oli ennakoitua vähäisempää.Söderskärin vesikasvillisuuslinjoilla ei todettumuutoksia.TBT:n <strong>ja</strong> muiden orgaanisten tinayhdisteidenpitoisuudet sedimentissä, liejusimpukoissa<strong>ja</strong> kaloissa laskivat selvästi edellisestä vuodesta.Pitoisuustasoissa ei todettu ero<strong>ja</strong> <strong>satama</strong>työmaanPuhdistusruoppausten suo<strong>ja</strong>rakenteiden (penkereet<strong>ja</strong> suo<strong>ja</strong>verho) sisäpuolella todettiin veden voimakastasamentumista. Suo<strong>ja</strong>rakenteet toimivat kuitenkinerittäin hyvin <strong>ja</strong> estivät kiintoaineen leviämisen.Suo<strong>ja</strong>rakenteiden ulkopuolella samentuminen rajoittuityökohteiden välittömään läheisyyteen. Loppuvuodestameriläjityskelpoisten massojen intensiivisenruoppauksen <strong>ja</strong> merihiekan kuljetusten aikanasamentunutta vettä havaittiin myös Kalkkisaarenselänulkopuolella. Meriläjitysten aikana havaittiinsameuden kulkeutumista poh<strong>ja</strong>n lähellä vielä noin2,5 kilometrin päässä läjitysalueen keskipisteestä.Vaikutukset sisäsaariston vesikasvillisuuteenolivat vähäisiä. Ulkosaariston kasvillisuuslinjoillaSATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö131


havaittiin elpymistä edellisestä vuodesta. Sölderskärinalueelle ei ollut vaikutuksia.TBT:n <strong>ja</strong> muiden orgaanisten tinayhdisteidenpitoisuudet <strong>satama</strong>-alueen ympäristön sedimenteissä,liejusimpukoissa <strong>ja</strong> kaloissa laskivat edelleenverrattuna vuosiin 2003 <strong>ja</strong> 2004. Kalojen haitta-ainepitoisuuksissaei todettu ero<strong>ja</strong> <strong>satama</strong>-alueen <strong>ja</strong> vertailualueidenvälillä. Meriläjitysalueella sedimenttienorgaanisten tinayhdisteiden pitoisuudet pysyivätsuunnilleen edellisen vuoden tasolla, mutta liejusimpukoissapitoisuudet laskivat edelleen.Silakan kudun heikkeneminen antoi viitteitä siitä,että <strong>satama</strong>työt ovat voineet haitata kudun onnistumista.Poikasnuottaussaalis oli kuitenkin moninkertainenedellisvuosiin verrattuna. Ammattikalastajienmukaan <strong>satama</strong>- <strong>ja</strong> väylätyöt häiritsivät edelleenkalastusta.Vuosi 2006Vesistötyöt sisälsivät <strong>satama</strong>-alueen ruoppauksia<strong>ja</strong> savimassojen läjityksiä 0,99 milj. m³ktr, merihiekanottoa 2,20 milj. proomu-m³ <strong>ja</strong> <strong>satama</strong>n täyttöjänoin 32 ha. Lisäksi keväällä 2006 täydennettiinvähän puhdistusruoppausta <strong>satama</strong>n toisen vaiheenalueella. Seurantaan kuuluivat sameuskartoitukset,mallitarkastelu, veden laadun <strong>ja</strong> sedimentaationseuranta, TBT:n <strong>ja</strong> muiden organotinayhdisteidenpitoisuuksien seuranta, vesikasvillisuuden seuranta,poh<strong>ja</strong>eläintutkimus, silakan kutuseuranta, kalanpoikaspyynnit,ammatti- <strong>ja</strong> vapaa-a<strong>ja</strong>nkalastuksen seurantasekä hiekanoton kiintoaineskuormitusseuranta.Ruoppausten sameusvaikutukset rajoittuivat työkohteidenvälittömään läheisyyteen. Vähäisempiäkiintoainesmääriä kulkeutui myös Kalkkisaarenselälle<strong>ja</strong> edelleen Uutelan edustalle. Meriläjitysalueellasameuden havaittiin töiden aikana kulkeutuvanpoh<strong>ja</strong>n lähellä noin kahden kilometrin päähän.Sameusarvot laskivat kuitenkin läjitysten jälkeenerittäin nopeasti.Vesistötöiden havaittiin heikentäneen sisäsaaristonvesikasvillisuuden elinolosuhteita, ulkosaaristossaelpyminen <strong>ja</strong>tkui. Söderskärin vesikasvillisuudessaei ollut muutoksia.TBT:n <strong>ja</strong> muiden orgaanisten tinayhdisteidenpitoisuudet <strong>satama</strong>-alueen ympäristön sedimenteissä,liejusimpukoissa <strong>ja</strong> kaloissa laskivat tai pysyivätsuunnilleen vuoden 2005 tasolla. Läjitysalueellasedimentin pitoisuudet pysyivät suunnilleen edellisenvuoden tasolla, mutta liejusimpukoiden pitoisuudetlaskivat edelleen selvästi.Silakan kutu oli hieman edellisvuotta runsaampaa.Poikasnuottaussaalis oli edellisvuosia pienempi.Osa ammattikalastajista ilmoitti siirtyneensäkalastamaan ainakin osittain muille alueille. Vapaaa<strong>ja</strong>nkalasta<strong>ja</strong>tkokivat levä-, sameus- <strong>ja</strong> hajuhaitatongelmiksi.Vuosi 2007Vesirakennustyöt keskittyivät laitureiden rakentamiseen.<strong>Satama</strong>n länsi- <strong>ja</strong> itäosien laiturirakenteetvalmistuivat pääosin vuoden loppuun mennessä.Meriväylä otettiin käyttöön 31. 12. 2007. Meriläjitysalueellevietiin masso<strong>ja</strong> ainoastaan 0,007 milj. m³ktr.Seurantaan sisältyivät sameuskartoitukset, mallitarkastelu,veden laadun <strong>ja</strong> sedimentaation seuranta,TBT:n <strong>ja</strong> muiden organotinayhdisteiden pitoisuuksienseuranta, vesikasvillisuuden seuranta, silakankutuseuranta, kalanpoikaspyynnit <strong>ja</strong> ammattikalastuksenseuranta.Sameus- <strong>ja</strong> muut vedenlaatuvaikutukset olivathyvin vähäisiä. <strong>Satama</strong>työmaan lähellä kertyi keräimiin<strong>ja</strong> kasvillisuuspohjille sedimenttiä selvästiedellisvuosia vähemmän.Sisäsaaristossa jo ennen <strong>satama</strong>n rakentamistaalkanut rakkolevän peittävyyden väheneminen näyttipysähtyneen. Ulompana rakkolevä on runsastunut.Merisätkimen väheneminen viittaa kartoitusalueenrehevyyden <strong>ja</strong>/tai veden sameuden lisääntymiseenviimeisten viiden vuoden aikana.Sedimenttien TBT:n <strong>ja</strong> muiden organotinayhdisteidenpitoisuudet olivat asettuneet jo edellisvuosinatietylle tasolle, mikä oli todettavissa erityisesti<strong>satama</strong>työmaan ympäristössä. Liejusimpukoidenorganotinapitoisuudet näyttivät saavuttaneet jonkinlaisentaustatason. Kalojen organotinapitoisuudetolivat alhaisia verrattuna vuosien 2003–2004tasoon.Silakka kuti edelleen lähes kaikilla sisäsaaristonperinteisillä kutupaikoilla. Poikasnuottaussaalis oliennätyksellisen suuri. Ammattikalastajien siikasaaliitkasvoivat muutaman vuoden vähäisten saaliittenjälkeen, minkä vuoksi ammattikalastajilla ei ollut<strong>satama</strong>hankkeen vaikutuksista erityistä huomauttamista.132 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


13.7 <strong>Vuosaaren</strong> <strong>satama</strong>toiminnan ympäristöluvan velvoitteet<strong>Helsingin</strong> kaupungin ympäristölautakunta myönsi<strong>Vuosaaren</strong> <strong>satama</strong>n toiminnalle ympäristöluvan26.3.2002. Siinä määritellään <strong>satama</strong>toiminnan aloittamisenjälkeen toteutettavasta seurannasta [7].Ympäristöluvassa on annettu seuraavat velvoitteet<strong>satama</strong>n toiminnan tarkkailuun <strong>ja</strong> raportointiin:• <strong>Satama</strong>n toiminnasta on pidettävä kir<strong>ja</strong>a, josta käyilmi <strong>satama</strong>ssa käyneiden laivojen määrä, tavaraliikenteenmäärä, vaarallisten aineiden määräIMDG-luokituksen mukaisesti kappaletavarana<strong>ja</strong> säiliötavarana ilmoitettuna.• <strong>Satama</strong>n päästöistä ilmaan on kalenterivuosittainlaadittava raportti, jossa on kuvattava laskennallisetrikkidioksidipäästöt (t/a), typen oksidien päästöt(t/a), pölypäästöt (t/a) <strong>ja</strong> haihtuvien hiilivetyjenpäästöt (t/a). Tarkastelut on tehtävä päästölähdekohtaisesti(laivat, työkoneet, autot). Lisäksi onarvioitava polttoaineiden kulutus päästölähteittäin.Raportti on toimitettava <strong>Helsingin</strong> kaupunginympäristökeskukseen seuraavan vuoden helmikuunloppuun mennessä.• <strong>Satama</strong>n aiheuttaman melun tarkkailusta on laadittavatarkkailusuunnitelma. Se on esitettävä <strong>Helsingin</strong>kaupungin ympäristölautakunnalle hyväksyttäväksivuoden 2007 loppuun mennessä.• Toiminnan muuttumisesta, lopettamisesta tai pitkäaikaisestakeskeyttämisestä on ilmoitettava<strong>Helsingin</strong> kaupungin ympäristökeskukselle.• Sellaisista onnettomuuksista tai vaaratilanteista,joista saattaa aiheutua terveyshaitto<strong>ja</strong> tai muutaympäristön pilaantumisen vaaraa, on välittömästiilmoitettava <strong>Helsingin</strong> kaupungin ympäristökeskukselle.Ympäristöluvassa on annettu seuraavat velvoitteet<strong>satama</strong>n toiminnan tarkkailuun <strong>ja</strong> raportointiin.Velvoitteita perusteltiin lupapäätöksessä seuraavasti:• <strong>Satama</strong>n toiminnan laadun <strong>ja</strong> laajuuden seuraaminenon tarpeen luvanmukaisuuden arvioinnissa(Terveydensuojelulaki 11§).• Ilmapäästöjen raportointi on tarpeen ilman epäpuhtauspitoisuuksienseurantaa varten <strong>ja</strong> niidenvähentämistarpeen arvioimiseksi (Terveydensuojelulaki2§, Terveydensuojeluasetus 2§).• Melutasojen tarkkailu on tarpeen ympäristön terveellisyyden<strong>ja</strong> sille aiheutetun rasituksen seuraamiseksi.Suunnitelman esittäminen ennenseurannan aloittamista on tarpeen viranomaisenarviointia varten (Naapuruussuhdelaki 17§, Terveydensuojeluasetus2§).• Tieto toiminnassa tapahtuvista muutoksista ontarpeen arvioitaessa toiminnan laajuutta <strong>ja</strong> ympäristöluvantarkistamisen tarvetta (Terveydensuojelulaki10§).• Terveydensuojeluviranomaisella on oltava tietoonnettomuuksista <strong>ja</strong> vaarallisista tilanteista,jotta mahdollisiin toimenpiteisiin terveyshaitanehkäisemiseksi voidaan välittömästi ryhtyä (Terveydensuojelulaki2§).Lisäksi luvan mukaan <strong>Vuosaaren</strong> <strong>satama</strong>n ongelmajätehuoltoon järjestettävä niin, että jätteistä eiaiheudu terveyshaittaa. Valvontaa varten jätteidensiirto<strong>ja</strong> <strong>ja</strong> kir<strong>ja</strong>npitoa ongelmajätteistä on voitavaseurata (Terveydensuojelulaki 22§, Terveydensuojeluasetus2 <strong>ja</strong> 12§).<strong>Satama</strong>toiminnan ympäristölupaviranomainenon nykyään Länsi-Suomen ympäristölupavirasto <strong>ja</strong>ensisi<strong>ja</strong>inen valvontaviranomainen on Uudenmaanympäristökeskus. Tarkkailun tulokset toimitetaansekä Uudenmaan ympäristökeskukselle että <strong>Helsingin</strong>kaupungin ympäristölautakunnalle.13.8 Ympäristötietopalvelu<strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteydet -projekti kehittiympäristöseuranto<strong>ja</strong> varten interaktiivisen ympäristöseurantatietojenselainpalvelun. Se toteutettiinSpatialWeb-tekniikalla. Palvelulla on voitu hallita,raportoida <strong>ja</strong> arkistoida poh<strong>ja</strong>- <strong>ja</strong> pintavesien korkeutta,virtaamaa <strong>ja</strong> laatua koskevia tieto<strong>ja</strong> sekäpainumamittauksia, katselmointe<strong>ja</strong>, tärinämittauksia<strong>ja</strong> yleisöpalautetta.Hankkeen suunnitteli<strong>ja</strong>t, rakenta<strong>ja</strong>t, valvo<strong>ja</strong>t,rakennutta<strong>ja</strong>t, seurantojen tekijät sekä viranomaiset<strong>ja</strong> asukkaat ovat voineet käyttää karttapalvelua,osoitehakua <strong>ja</strong> etsiä tieto<strong>ja</strong> hankkeesta. Mm. tunneleidenlouhinnan etenemistä on voitu seurata reaaliaikaisena.Tietopalveluun on kir<strong>ja</strong>ttu yleisöltä saatu palaute<strong>ja</strong> siihen annetut vastaukset. Palautetta on ollutmahdollista etsiä kartoilta useilla hakuehdoilla, <strong>ja</strong>yhteydenotoista on voitu tehdä raportte<strong>ja</strong> [13].SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö133


13.9 Ympäristöseurantojen <strong>ja</strong>tkaminen<strong>Vuosaaren</strong> <strong>satama</strong>n käyttöönoton jälkeen hankkeentoteuttamista varten perustetut organisaatiot, <strong>Helsingin</strong><strong>Satama</strong>n VUOSA-projekti <strong>ja</strong> valtion VUOLIprojektipuretaan. Ohjelmien mukaisten ympäristöseurantojen<strong>ja</strong>tkamisesta vastaavat vuodenvaihteen2008 –2009 jälkeen <strong>Helsingin</strong> <strong>Satama</strong>, Tiehallinto,Ratahallintokeskus <strong>ja</strong> Merenkulkulaitos [30]. Lupavelvoitteiden<strong>ja</strong> luontovaikutusten seurantaohjelmienmukaan <strong>ja</strong>tketaan <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenympäristöseuranto<strong>ja</strong>:1. Porvarinlahden tietunnelin seurantaa tehdäänainakin seitsemän vuotta tunnelin käytön aikana.Tämän jälkeen ohjelmaa tarkistetaan.2. Labbackan rautatietunnelin <strong>ja</strong> Savion rautatietunnelinseurantaa tehdään ainakin seitsemän vuottatunnelin käytön aikana. Tämän jälkeen ohjelmaatarkistetaan.3. Österängenin rengasmeluvallin seurantaa tehdäänviisi vuotta meluvallin valmistumisesta neljä kertaavuodessa. Sen jälkeen seurantaa <strong>ja</strong>tketaanneljä vuotta kerran vuodessa.4. Kasvillisuuden seurantaohjelma on laadittu vuoteen2011 saakka. Vuonna 2011 laaditaan yhteenvetoseurantatuloksista.5. Linnustonseurantaa tehdään vielä kolmena vuonna<strong>satama</strong>n käyttöönoton jälkeen. Laa<strong>ja</strong>n seurannanviimeinen vuosi on 2011, minkä jälkeen laaditaanyhteenveto seurannoista. Porvarinlahden ratasillanlinnustovaikutuksia seurataan viisi vuotta eli2008 –2012.6. Vesistö- <strong>ja</strong> kalataloustarkkailun rakentamisaikainenseuranta <strong>ja</strong>tkuu vuonna 2008, minkä jälkeenlaaditaan yhteenveto tuloksista <strong>ja</strong> <strong>ja</strong>tketaan käytönaikaistaseurantaa.7. <strong>Vuosaaren</strong> <strong>satama</strong>n ympäristöluvan velvoitteidenmukainen seuranta aloitetaan <strong>satama</strong>toiminnanalkaessa.Kuva 13.13<strong>Vuosaaren</strong> <strong>satama</strong>4. 9. 2008Kuva: Sami Kurikka /Skylinefoto134 SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


L ä h t e e t:1. Erävuori, L., Johansson, H. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenkasvillisuuden seuranta 2003. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 2/2004. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto2. Erävuori, L., Johansson, H. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenkasvillisuuden seuranta 2004. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 3/2005. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto3. Erävuori, L., Johansson, H. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenkasvillisuuden seuranta 2005. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 3/2006. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto4. Erävuori, L., Poh<strong>ja</strong>nmies, K. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenkasvillisuuden seuranta 2007. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2008. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto5. <strong>Helsingin</strong> kaupunginhallituksen pöytäkir<strong>ja</strong> 13. 12. 1999.6. <strong>Helsingin</strong> kaupunginhallituksen pöytäkir<strong>ja</strong> 14. 10. 2002.7. <strong>Helsingin</strong> kaupungin ympäristölautakunta, esityslista26. 3. 2002.8. Insinööritoimisto Paavo Ristola Oy. Ympäristövaikutustenarviointiselostus, <strong>Helsingin</strong> <strong>satama</strong>hanke 29. 9. 1995.<strong>Helsingin</strong> kaupunki.9. Jokela, R. <strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteydet, ratapiha–Savion rautatietunnelin pohjoinen suuaukko. Pintavesien,poh<strong>ja</strong>vesien <strong>ja</strong> painumien seurannan vuosiraporttien2005 <strong>ja</strong> 2006 yhteenvedot. Muistio.10. JP-Suoraplan Oy, Maa <strong>ja</strong> Vesi Oy. <strong>Vuosaaren</strong> <strong>satama</strong>nmaaliikenneyhteyksien pintavesien, poh<strong>ja</strong>vesien <strong>ja</strong> painumienseurantaohjelma. Porvarinlahden tietunnelin <strong>ja</strong>Labbackan rautatietunnelin sekä Savion rautatietunnelinrakennusaikaisten vuoto-, huuhtelu-, pesu- <strong>ja</strong> kasteluvesienhallintaohjelma. <strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteydetVUOLI -projekti 3. 11. 2004.11. Koskimies, P. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseurantaohjelma Osa I, Linnustovaikutustenseurantaohjelma. <strong>Helsingin</strong> kaupungin ympäristökeskuksenjulkaisu<strong>ja</strong> 6/2001.12. Kurtto, A., Helynranta, L. Boreaaliset metsäluhdat <strong>ja</strong>puustoiset suot Mustavuoren <strong>ja</strong> Porvarinlahden–Labbackan–Kasabergetinalueella. <strong>Helsingin</strong> kaupunginympäristökeskuksen monisteita 9/1999.13. Lehtonen, S. Ympäristöseurantatietojen interaktiivinenraportointi, insinöörityö 20. 4. 2007. <strong>Helsingin</strong> ammattikorkeakouluStadia.14. LT-Konsultit Oy. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseurantaohjelmat Osa II, Kasvillisuuden seurantaohjelma.<strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneprojekti2001.15. Länsi-Suomen vesioikeuden päätökset 9. 7. 1998 nrot 48–52 1998/3, Vaasana hallinto-oikeuden päätös 24. 2. 2000nro 00/0010/2 <strong>ja</strong> korkeimman hallinto-oikeuden päätös24. 10. 2002 taltionro 2638.16. Maa <strong>ja</strong> Vesi Oy. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen kasvillisuudenseurantaohjelman täydennysosa <strong>ja</strong> vuoden 2002tilanne. VUOLI-projekti 2003.17. Maa <strong>ja</strong> Vesi Oy. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseuranta – linnusto, kasvillisuus <strong>ja</strong> poh<strong>ja</strong>vesi.Seurantaohjelman luonnos 31. 5. 2000. <strong>Helsingin</strong> <strong>Satama</strong><strong>ja</strong> Uudenmaan tiepiiri.18. Maa <strong>ja</strong> Vesi Oy. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen luontovaikutustenseurantaohjelmat Osa III, Poh<strong>ja</strong>vesien seurantaohjelma.<strong>Vuosaaren</strong> <strong>satama</strong>n maaliikenneprojekti2001.19. Niinimäki, J., Paasivirta, L., Heitto, A., Oulasvirta, P.,Vatanen, S. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen vesistö- <strong>ja</strong>kalatalousseuranta 2003. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2004. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto20. Salmelainen, J. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen poh<strong>ja</strong>- <strong>ja</strong>pintavesien seuranta vuonna 2004. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 2/2005. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto21. Turkulainen, S., Erävuori, L. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenkasvillisuuden seuranta 2006. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2007. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto22. Uudenmaan ympäristökeskus 13. 3. 1996. Lausuntoympäristövaikutusten arviointiselostuksesta, <strong>Helsingin</strong><strong>satama</strong>hanke.23. Uudenmaan ympäristökeskus 19. 3. 1998. Mustavuorenlehto <strong>ja</strong> Östersundomin lintuvedet (FI0100065) Naturaalueentietolomake.24. Valtioneuvoston päätös 3. 12. 1999. Luonnonsuojelulain66§:n 2 momentissa tarkoitettua poikkeusta koskevanUudenmaan liiton hakemuksen käsittely.25. Vatanen, S. Haikonen, A. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2007. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2008. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto26. Vatanen, S., Haikonen, A. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2006. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2007. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto27. Vatanen, S., Niinimäki, J., Haikonen, A. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen vesistö- <strong>ja</strong> kalatalousseuranta 2005.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen julkaisu<strong>ja</strong> 1/2006. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto28. Vatanen, S., Niinimäki, J. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenvesistö- <strong>ja</strong> kalatalousseuranta 2004. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenjulkaisu<strong>ja</strong> 1/2005. http://www.vuosaaren<strong>satama</strong>.fi/ymparisto29. <strong>Vuosaaren</strong> <strong>satama</strong>, seuranta. Kokousmuistio 8. 4. 1997.30. <strong>Vuosaaren</strong> <strong>satama</strong>n ympäristöseurantojen <strong>ja</strong>tko. Muistio18. 1. 2008.31. Yrjölä, R., Koivula, M. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta2002. <strong>Helsingin</strong> kaupungin ympäristökeskuksenjulkaisu<strong>ja</strong> 1/2003. http://www.hel.fi/ymk/julkaisut32. Yrjölä, R., Luostarinen, M., Tanskanen, A. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen linnustonseuranta 2004. Linnustomuutoksetvuosina 2002–2004. <strong>Helsingin</strong> kaupunginympäristökeskuksen julkaisu<strong>ja</strong> 5/2005. http://www.hel.fi/ymk/julkaisut33. Yrjölä, R. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta2003. <strong>Helsingin</strong> kaupungin ympäristökeskuksen julkaisu<strong>ja</strong>8/2003. http://www.hel.fi/ymk/julkaisut34. Yrjölä, R. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta2005. <strong>Helsingin</strong> kaupungin ympäristökeskuksen julkaisu<strong>ja</strong>2/2006. http://www.hel.fi/ymk/julkaisut35. Yrjölä, R. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta2006. <strong>Helsingin</strong> kaupungin ympäristökeskuksen julkaisu<strong>ja</strong>4/2007. http://www.hel.fi/ymk/julkaisut36. Yrjölä, R. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseuranta2007. Käsikirjoitus.37. Öhberg, P. Yhteenveto vuoden 2007 pintavesien, poh<strong>ja</strong>vesien<strong>ja</strong> painumien seurantatuloksista.SATAMAHANKKEEN YMPÄRISTÖSEURANNAT<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö135


14<strong>Satama</strong>n rakentamiseen liittyvätympäristöhankkeet14.1 Johdanto<strong>Vuosaaren</strong> <strong>satama</strong> on rakennettu pääasiassa entiselletelakka-alueelle <strong>ja</strong> meritäytöille, mutta rakentamisenalle on jäänyt myös aiemmin virkistyskäytössäolleita alueita <strong>ja</strong> reittejä sekä paikallisesti arvokkaitaluontokohteita. <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen ympäristönasemakaavaan otettiin mukaan mm. luonnonsuojelualueiksisuunnitellut lähialueet sekä entinenkaatopaikka <strong>ja</strong> täyttömäki. Asemakaavassa osoitettiinkorvaavat virkistysyhteydet, jotka yhdistävätratapihan erottamiksi jääneet alueet. Lähialueidensuojelulla, kunnostuksella, maisemoinnilla <strong>ja</strong> hoidollakorvataan aluemenetyksiä <strong>ja</strong> <strong>satama</strong>hankkeenhaitto<strong>ja</strong>. Tavoitteena on toimenpiteiden toteuttaminen<strong>satama</strong>rakentamisen aikana.Kuva 14.1Mustavuoren lehto <strong>ja</strong>Östersundomin lintuvedetNatura-alueen <strong>ja</strong>sitä ympäröivien luonnonalueidenseuranta<strong>ja</strong> hoito. 5 214LS63331 Porvarinlahden hoito- <strong>ja</strong> käyttösuunnitelmanlaatiminen <strong>ja</strong> Porvarinlahden kunnostaminen2 Mustavuoren–Porvarinlahden-luonnonsuojelualueenhoito- <strong>ja</strong> käyttösuunnitelman laatiminen3 Sipoon Östersundomissa si<strong>ja</strong>itsevien Natura 2000-verkostoon kuuluvien lintuvesien (Bruksviken,Torpviken, Kapellviken) <strong>Helsingin</strong> omistamien osiensuojeleminen luonnonsuojelulain no<strong>ja</strong>lla4 <strong>Vuosaaren</strong> kaatopaikan <strong>ja</strong> täyttömäenkunnostaminen <strong>ja</strong> maisemointi5 Mellunmäen luhdan säilyttäminen <strong>ja</strong> hoitaminen6 <strong>Vuosaaren</strong> <strong>satama</strong>n koillisreunan luonnonmukaisenranta-alueen kehittäminenLS <strong>satama</strong>-aluevirkistysalueteknisen huollon aluetyöpaikka-alue, teollisuus/toimisto/<strong>satama</strong>kerrostalovaltainen alue, asuminen/toimitilapientalovaltainen alue, asuminenkeskustatoimintojen alueluonnonsuojelualueNatura-aluekulttuurihistoriallisesti, rakennustaiteellisesti<strong>ja</strong> maisemakulttuurin kannalta merkittävää alue14.2 <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamispäätökseen liittyvät päätöksetKaupunginhallitus päätti 14. 10. 2002 kaupunginvaltuuston9. 10. 2002 tekemän <strong>Vuosaaren</strong> <strong>satama</strong>nrakentamispäätöksen toimeenpanon yhteydessä [1]mm. kehottaa <strong>Helsingin</strong> <strong>Satama</strong>a• osallistumaan Mustavuoren lehto <strong>ja</strong> Östersundominlintuvedet Natura 2000 -alueen niiden kaupunginomistamien osien hoitoon, jotka ovat <strong>Vuosaaren</strong><strong>satama</strong>n vaikutusalueella <strong>ja</strong> sisällyttämääntästä aiheutuvat kustannukset <strong>satama</strong>n toteuttamiskustannuksiin• suunnittelemaan yhteistyössä <strong>Helsingin</strong> kaupunginympäristökeskuksen <strong>ja</strong> rakennusvirastonkanssa <strong>ja</strong> toteuttamaan <strong>Vuosaaren</strong> <strong>satama</strong>n koillis-reunaan luonnonmukaisen ranta-alueen ottaen erityisestihuomioon linnuston elinolot <strong>ja</strong> ranta-alueenkäytön virkistykseen <strong>ja</strong> luonnon tarkkailuun.Lisäksi kaupunginhallitus päätti• todeta, että Uudenmaan ympäristökeskukselle tehdäänerillinen esitys Östersundomin lintuvesiensuojelemiseksi luonnonsuojelulain no<strong>ja</strong>lla• kehottaa <strong>satama</strong>lautakuntaa toimimaan aktiivisestiÖstersundomin lintuvesien käyttö- <strong>ja</strong> hoitosuunnitelmantoteuttamiseksi <strong>ja</strong> <strong>Helsingin</strong> <strong>Satama</strong>ahuolehtimaan osana <strong>satama</strong>hanketta käyttö- <strong>ja</strong>hoitosuunnitelman toteuttamisesta Porvarinlahdenosalta.136 SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K I R J O I T TA J APirkko Pulkkinen, MMM (ympäristönsuojelu), LuK (suunnittelumaantiede),työskentelee johtavana ympäristötarkasta<strong>ja</strong>na <strong>Helsingin</strong>kaupungin ympäristökeskuksessa. Hän on ollut ympäristötoimenedusta<strong>ja</strong>na <strong>Vuosaaren</strong> <strong>satama</strong>n valmistelussa vuodesta 1989 alkaen.14.3 Uusia luonnonsuojelualueitaMustavuoren lehdon <strong>ja</strong> Östersundomin lintuvesienNatura-alueesta (FI0100065) on Natura-lomakkeessaesitetty suojeltavaksi Mustavuoren lehto luonnonsuojelulailla,Kasaberget <strong>ja</strong> Labbacka maankäyttö<strong>ja</strong>rakennuslailla <strong>ja</strong> Östersundomin lintuvedet vesilaintai luonnonsuojelulain keinoin. <strong>Helsingin</strong>kaupunki muodostaa omistamistaan Natura-alueenosista luonnonsuojelualueet.14.3.1 Östersundomin lintuvesienluonnonsuojelualueen perustaminenUudenmaan ympäristökeskus päätti 15. 12. 2003 <strong>Helsingin</strong>kaupungin hakemuksesta perustaa Sipooneteläosaan Östersundomin lintuvesien luonnonsuojelualueen[9]. Pinta-alaltaan noin 92 hehtaarinsuojelualueeseen sisältyy <strong>Helsingin</strong> kaupunginSipoossa omistamat <strong>ja</strong> Valtakunnalliseen lintuvesiensuojeluohjelmaansekä Mustavuoren lehdon<strong>ja</strong> Östersundomin lintuvesien Natura-kohteeseenkuuluvat alueet. Lisäksi luonnonsuojelualueeseenkuuluu Natura 2000 -alueen ulkopuolisia, luonnonsuojelullisestiarvokkaita pieniä saaria sekä lehto- <strong>ja</strong>niittyalueita.Rauhoitusmääräykset kieltävät mm. rakentamisen,maaperän vahingoittamisen, ojittamisen, kasvien<strong>ja</strong> eläinten vahingoittamisen, liikkumisen moottoriajoneuvoillasekä koirien <strong>ja</strong> kissojen irtipitämisen.Lintujen pesimärauhan turvaamiseksi liikkuminenon kielletty maastoon merkittävien reittien ulkopuolella1. 4.–31. 7. Luonnonsuojelualueelle on laadittuhoito- <strong>ja</strong> käyttösuunnitelma. Alueen annetaankehittyä pääasiassa luonnon ehdoilla. Linnustoa pitkälläaikavälillä köyhdyttävää umpeenkasvua pyritäänhidastamaan parantamalla veden virtausta <strong>ja</strong>luomalla pieniä avovesiallikoita. Rantaniittyjen laidunnustasuositellaan <strong>ja</strong>tkettavaksi. Lintutorni, katselulava,opasteet <strong>ja</strong> polkujen merkintä oh<strong>ja</strong>avat alueenulkoilu- <strong>ja</strong> luontoharrastuskäyttöä.14.3.2 Mustavuori–Porvarinlahden luonnonsuojelualueenlaajentaminen <strong>ja</strong> Porvarinlahdenetelärannan luonnonsuojelualueen perustaminenLuonnonsuojelulain mukaan suojellut <strong>ja</strong> suojeltaviksisuunnitellut Mustavuori–Porvarinlahti-luonnonsuojelualuelaajennuksineen sekä uusi Porvarinlahdenetelärannan luonnonsuojelualue merkittiin<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavaan.<strong>Helsingin</strong> kaupungin ympäristökeskus teetti vuonna1987 perustetulle <strong>ja</strong> laajennettavaksi esitettävälleMustavuori–Porvarinlahti-alueelle uuden hoito- <strong>ja</strong>käyttösuunnitelman [12] <strong>ja</strong> <strong>Helsingin</strong> <strong>Satama</strong> Porvarinlahdenetelärannan rauhoitettavaksi esitettävälleluonnonsuojelualueelle hoito- <strong>ja</strong> käyttösuunnitelman[13]. Suunnitelmien poh<strong>ja</strong>ksi <strong>Helsingin</strong> <strong>Satama</strong> teettiPorvarinlahden kasvillisuusselvityksen [14].Aiemmin rauhoitetun Mustavuori–Porvarinlahtiluonnonsuojelualueenpinta-ala kasvaa 36 hehtaarista47 hehtaariin. Alue on pääosin metsää, muttasiihen sisältyy länsireunassa kaistale Mellunmäenluhtaa <strong>ja</strong> keskiosassa maatunutta <strong>ja</strong> osin pensoittunuttaPorvarinlahden ruoikkoa. Laajennuksen tärkeinperuste on luonnonsuojelualueen rajojen muuttaminennoudattamaan Natura-alueen rajo<strong>ja</strong>. Hoito- <strong>ja</strong>käyttösuunnitelmassa esitetään Porvarinlahden itäpuolisenrantaniityn laiduntamista. Muita hoitotoimiaovat niittyjen raivaaminen <strong>ja</strong> niittäminen sekäkulunoh<strong>ja</strong>us. Luonnonsuojelualue on suosittua virkistysaluetta.Lintujen pesimäaikana 1. 4.–31. 7. kulkuon sallittu vain merkityillä poluilla. Rauhoituksentarkoituksena on linnuston <strong>ja</strong> kasvillisuuden suojelu.Perustettava Porvarinlahden etelärannan luonnonsuojelualuesi<strong>ja</strong>itsee Porvarinlahden vesialueellasekä Porvarinlahden, <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong><strong>satama</strong>radan välisellä maa-alueella. Pinta-alasta onvesialuetta 20 ha <strong>ja</strong> maata 24 ha. Koko vesialue <strong>ja</strong>kapea kaistale maatunutta rantaviivaa kuuluu Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien Naturaalueeseen<strong>ja</strong> Porvarinlahti valtioneuvoston vuonna1982 vahvistamaan Valtakunnalliseen lintuvesiensuojeluohjelmaan.Luonnonsuojelualueen sisäänjää Tryvikin maatila, jonka pellot ovat maatalouskäytössä.Porvarinlahti on matala, reheväkasvuinenmerenlahti, jonka linnusto <strong>ja</strong> vesikasvillisuus ovatmonipuolista. Etelärannan maa-alue on pääosin metsäinen.Rauhoituksen tarkoitus on linnuston <strong>ja</strong> kasvillisuudensuojelu. Uuden luonnonsuojelualueenra<strong>ja</strong>us on Natura-alueen ra<strong>ja</strong>usta laajempi <strong>ja</strong> rajoittuuratapihaan <strong>ja</strong> <strong>satama</strong>an.SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö137


Kuva 14.2Kuvasar<strong>ja</strong> Porvarinlahdenalueesta.1956 19651984 200414.4 <strong>Vuosaaren</strong> kaatopaikan <strong>ja</strong> täyttömäen kunnostaminen <strong>ja</strong> maisemointi<strong>Satama</strong>-alueen luoteispuolella si<strong>ja</strong>itsee <strong>Vuosaaren</strong>vanha kaatopaikka, joka toimi 1960-luvun alussaLoh<strong>ja</strong>n Kalkki Oy:n kaatopaikkana. Se siirtyi <strong>Helsingin</strong>kaupungille vuonna 1963 <strong>ja</strong> Pääkaupunkiseudunyhteistyövaltuuskunta YTV:lle vuonna 1983.Yhdyskuntajätteen kaatopaikkana sitä käytettiinvuosina 1966 –1975 <strong>ja</strong> 1979 –1988. Sen pinta-ala onnoin 25 ha, <strong>ja</strong> sinne on sijoitettu jätteitä noin 3,4miljoonaa tonnia. Vuonna 1997 aloitettiin kaatopaikanmaisemointi.Kaatopaikan sulkemisen jälkeen alueen itäosassa,osittain vanhan kaatopaikan päällä on toiminut ylijäämämassojenvastaanottopaikka vuosina 1990 –1996. Täyttö aloitettiin uudelleen vuonna 1998, <strong>ja</strong>sitä <strong>ja</strong>tkettiin vuoteen 2005. Kaatopaikan <strong>ja</strong> ylijäämämassojenyhteispinta-ala on noin 38 ha. Täyttöalueelleon sijoitettu ylijäämämaita noin viisi miljoonaakuutiometriä [6].<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavassakaatopaikka merkittiin maisemanhoitoalueeksi, jokavarataan tutkimus-, opetus- <strong>ja</strong> luonnonseurantakäyttöön.Täyttöalue ympäristöineen merkittiin lähivirkistysalueeksi.Asemakaavassa kaatopaikan alueelleosoitettiin ohjeelliset ulkoilureitistö <strong>ja</strong> ratsastusreitistö.Uusi virkistysalue suunniteltiin osaksi <strong>Vuosaaren</strong>Uutelasta Sipoon Talosaareen johtavaa virkistysaluevyöhykettä[3].<strong>Helsingin</strong> kaupungin rakennusvirasto on kunnostanutkaatopaikan <strong>ja</strong> täyttömäen aluetta, <strong>Vuosaaren</strong>huippua[6]. Tavoitteena on ollut alueenkunnostaminen virkistyskäyttöön samanaikaisesti<strong>satama</strong>rakentamisen kanssa. Näin pyritään korvaamaan<strong>satama</strong>n alle jääneitä virkistys- <strong>ja</strong> luontoalueita.<strong>Vuosaaren</strong>huipusta luodaan monipuolinen virkistysalue,joka houkuttelee käyttäjiä <strong>ja</strong> vähentääluonnonsuojelu- <strong>ja</strong> Natura-alueiden kuormitusta.Alue on seudullisten <strong>ja</strong> paikallisten virkistysreittienristeämispaikka.Täyttöalueen maisemointiin siirrettiin myösläheisen <strong>Vuosaaren</strong> <strong>satama</strong>työmaan puhtaat pintamaat.Suo<strong>ja</strong>vyöhyke Natura-alueen puolella säilytettiinluonnonmukaisena, <strong>ja</strong> sitä lähinnä olevat alueetviimeisteltiin mahdollisimman nopeasti.<strong>Vuosaaren</strong>huippua maisemoitaessa on pyrittyluomaan sopivia elinolosuhteita mm. kirjokertulle <strong>ja</strong>pikkulepinkäiselle. Nämä lintulajit kuuluvat lähei-138 SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


sen Mustavuoren lehdon <strong>ja</strong> Östersundomin lintuvesienNatura-alueen suojelun perusteisiin [7], <strong>ja</strong>niitä on linnustonseurannoissa havaittu myös kaatopaikan<strong>ja</strong> täyttömäen alueella. Kaatopaikan <strong>ja</strong> täyttöalueenlinnustoa seurattiin vuosina 2003–2005. <strong>Vuosaaren</strong><strong>satama</strong>hankkeen linnustonseurantaa on tehtyvuodesta 2002.<strong>Vuosaaren</strong>huipun alueella on havaittu myös uhanalainenperhoslaji, jonka suojelemiseksi tehtiin suojelu-<strong>ja</strong> hoitosuunnitelma koko alueen maisemointisuunnitelmanyhteydessä. Suunnitelmassa otettiinhuomioon perhoslajin elinpaikkavaatimukset kutenravintokasvit <strong>ja</strong> biotooppien pinta-ala.<strong>Helsingin</strong> kaupungin rakennusviraston käsityöpa<strong>ja</strong>llemyönnettiin <strong>Vuosaaren</strong>huipun toteutuksestavuoden 2006 Countdown-kunniakir<strong>ja</strong> [11]. Countdown2010 on Maailman luonnonsuojeluliitonIUCN:n <strong>ja</strong> Euroopan unionin aloittama hanke, jonkatavoitteena on pysäyttää tai ainakin huomattavastihidastaa luonnon monimuotoisuuden vähenemistä.<strong>Vuosaaren</strong>huippu valittiin vuoden parhaaksiteoksi monimuotoisen luonnon puolesta. Kaatopaikan<strong>ja</strong> maantäyttöalueen noin 60 ha laajuisen,yhtenäisen avoimen alueen luonnonmukainen maisemointipalkittiin hienona esimerkkinä pitkäjänteisestätyöstä luonnon hyväksi. Kestävää kehitystätukevina toimintatapoina pidettiin mm. maa-aineksensiirtämistä <strong>Vuosaaren</strong> lähialueilta kerros kerrokseltailman välivarastointia niin, että maaeliöstö,kasvit <strong>ja</strong> siemenpankki ovat säilyneet elävinä. Näinon taattu biotooppien kasvun <strong>ja</strong>tkuminen täyttömäellä.Alueelle on istutettu pelkästään kotimaisiakasvilaje<strong>ja</strong>.Runsaan kymmenen vuoden kunnostustyön tuloksena<strong>Vuosaaren</strong>huipulla on havaittu yli 390 putkilokasviasekä 9 uhanalaista, 16 silmälläpidettävää <strong>ja</strong>38 muuten huomionarvoista hyönteislajia. Alueestaon muodostunut suosittu luontoretki- <strong>ja</strong> lintuharrastuskohde,jolla vierailee paljon myös opiskeli<strong>ja</strong>- <strong>ja</strong>ammattiryhmiä sekä Suomesta että ulkomailta.Kuva 14.3Suunnitelma<strong>Vuosaaren</strong>huipusta [6].SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö139


14.5 Mellunmäen luhdan säilyttäminen <strong>ja</strong> hoitaminenMellunmäen luhta si<strong>ja</strong>itsee Itäväylän sekä Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien Natura-alueenvälissä. Osa luhdasta kuuluu Natura-alueeseen<strong>ja</strong> Mustavuoren–Porvarinlahden-luonnonsuojelualueeseen.Luhdan viereen, Itäväylän <strong>ja</strong> Kallvikintienristeyksen koillispuolelle on rakennettu Fallpakanpohjoisosan asuntoalue. Sen asemakaava perustuuhuolellisiin luonto- <strong>ja</strong> maisemaselvityksiin. Asemakaavantavoitteena on myös Mellunmäen luhdansuojelu. Vuonna 2000 tehdyn linnustoselvityksenmukaan alueella oli mm. kaksi ruisrääkän <strong>ja</strong> yksipikkulepinkäisen reviiriä [5]. Molemmat lajit kuuluvatviereisen Natura-alueen suojelun perusteisiin[7], <strong>ja</strong> niiden elinympäristöjen säilyminen <strong>ja</strong> hoitootetaan huomioon Natura-aluetta ympäröivien alueidenkäytön <strong>ja</strong> hoidon suunnittelussa.Fallbackan pohjoisosan asemakaavassa niittyalueetmerkittiin maisemallisesti arvokkaaksi pelto- <strong>ja</strong>niittyalueeksi, jota on hoidettava avoimena maise-matilana. Luhta merkittiin maisemallisesti arvokkaaksiluhta-alueeksi, jota tulee hoitaa <strong>ja</strong> kehittääsen luonto- <strong>ja</strong> maisema-arvot huomioon ottaen. Kaavanmukaan alueelle voidaan johtaa pitkospuut. Asemakaavaanmerkittiin likimääräinen paikka luhdanvesitasapainon säätelemiseksi tarvittavaa painannettavarten.Kaupunkisuunnitteluviraston laatiessa vuonna2003 valmistunutta Fallpakan pohjoisosan asemakaavaa<strong>Helsingin</strong> kaupungin rakennusvirasto teettivuonna 2002 Mellunmäen niityn <strong>ja</strong> Nybondaksenympäristön hoito- <strong>ja</strong> käyttösuunnitelman [2]. Seperustui hydrogeologiseen selvitykseen, <strong>ja</strong> siinäesitetään perusratkaisut luhdan vesitasapainon säilyttämiseksi.Fallpakan alueen sadevedet johdetaanniittyalueen reunaan Kallvikintien itäpuolelle suunnitellunpainanteen kautta. Ruisrääkän pesimäympäristöksisoveltuvaa niittyä laajennetaan.14.6 <strong>Vuosaaren</strong> <strong>satama</strong>n koillisrannan <strong>ja</strong> lähialueiden kehittäminen<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaavanyhtenä tavoitteena on ollut muodostaa <strong>satama</strong>n koillisrannastasekä koillispuolella si<strong>ja</strong>itsevista Varissaaresta<strong>ja</strong> Kalkkisaaresta yleinen virkistysalue.Asemakaavassa <strong>satama</strong>-aluetta ra<strong>ja</strong>a +13,0 metriäkorkea melueste, jonka taakse on merkitty noin 25metriä leveä istutettava alue. Varissaari on osoitetturetkeily- <strong>ja</strong> ulkoilualueeksi. Kalkkisaaren koillisosaon varattu retkeily- <strong>ja</strong> ulkoilualueeksi <strong>ja</strong> muu saariluonnonsuojelualueeksi [3].<strong>Helsingin</strong> <strong>Satama</strong> teetti vuonna 2006 valmistuneensuunnitelman <strong>Vuosaaren</strong> <strong>satama</strong>n koillisrannansekä viereisen Varissaaren <strong>ja</strong> Kalkkisaaren välisenalueen toteuttamisesta lintu- <strong>ja</strong> virkistysalueeksi[4]. Suunnitelman lähtökohtina ovat kaupunginhallituksen14. 10. 2002 kehotus virkistysalueen suunnittelusta<strong>ja</strong> <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen linnustonseurantaaoh<strong>ja</strong>avan työryhmän ehdotus kahlaa<strong>ja</strong>lietteenperustamisesta alueelle. Alueen luontoarvoista saatiinvuonna 2005 lisätietoa Suomen ympäristökeskuksen<strong>ja</strong> <strong>Helsingin</strong> yliopiston Kasvimuseonasiantuntijoiden maastokäynneillä sekä <strong>Helsingin</strong>kaupungin ympäristökeskuksen geologin tekemälläkartoituksella. Suunnitelman toteuttaminen edellyttäävielä koko alueen saamista kaupungin omistukseen.Suunnittelussa on käytetty hyväksi Ruotsista <strong>ja</strong>Englannista saatu<strong>ja</strong> kokemuksia keinotekoisistakahlaa<strong>ja</strong>lietteistä. Suomessa ei ole aiemmin rakennettuvastaavanlaista aluetta. Hanke aiotaan toteuttaakahdessa vaiheessa. Ensin rakennetaan meluseinäntakana oleva maa-alue ulkoilu- <strong>ja</strong> virkistyskäyttöön.Varissaaren <strong>ja</strong> mantereen välinen alue kunnostetaanvesilintujen pesintään nykyistä paremmin soveltuvaksi.Toisessa vaiheessa aiotaan tehdä kahlaa<strong>ja</strong>lintu<strong>ja</strong>houkutteleva alue Varissaaren <strong>ja</strong> Kalkkisaarenväliin. Veden korkeuden säätelyllä luodaan padottavaanaltaaseen optimaaliset olosuhteet kasvi- <strong>ja</strong>pieneläintuotannolle vesilintu<strong>ja</strong> <strong>ja</strong> kahlaajia varten.Ruoikkomosaiikin <strong>ja</strong> avoveden lisäämisellä parannetaanlintujen elinympäristöjä alueella.Koillisrannan alueen lähellä si<strong>ja</strong>itsee Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien Naturaalue,jonka suojelu perustuu mm. 11 lintudirektiivinmukaiseen lajiin [7]. Kalkkisaaren <strong>ja</strong> Varissaarenvälisen alueen hoitaminen <strong>ja</strong> kahlaa<strong>ja</strong>lietteen perustaminenovat lintudirektiivin tarkoittamaa Naturaalueenulkopuolella si<strong>ja</strong>itsevan elinympäristönhoitoa <strong>ja</strong> ekologisten tarpeiden mukaista uuden biotoopinaikaansaamista.Kalkkisaaren luonto on osoittautunut uusillamaastokäynneillä poikkeuksellisen arvokkaaksi.Saari aiotaan rauhoittaa kokonaan luonnonsuojelu-140 SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 14.4Havainnekuva koillisrannanmaisemointisuunnitelmasta,ArkkitehtityöhuoneArtto Palo Rossi Tikka Oyalueeksi valtakunnallisesti merkittävän <strong>ja</strong> erittäinkulutusherkän kalliokasvillisuuden, geologistenarvojen <strong>ja</strong> huomattavan lokkikolonian perusteella.Kalkkisaaren kallioperä koostuu hienorakenteisesta,kerroksellisesta sarvivälkeliuskeesta, joka on tuffiittia,alun perin vulkaanista tuhkaa. Tuffiitissa olevatkarbonaattikerrokset ovat rapautuneet usean sentinsyvyisiksi uriksi. Tuhkan <strong>ja</strong> kalkin sedimentaatio ontapahtunut mereen noin 1900 miljoonaa vuotta sitten.Kalkki on peräisin meren pieneliöiden tai levientoiminnasta [4].Saaressa kasvaa 191 luonnonvaraista putkilokasvilajia,mikä ylittää monien suurempien saarten lajimäärät.Kasvillisuuteen kuuluu useita harvinaisia <strong>ja</strong>jopa uhanalaisia laje<strong>ja</strong>. Vastaavaa kalkkikallioketokasvillisuuttaon <strong>Helsingin</strong> yliopiston Kasvimuseonasiantuntijoiden mukaan Suomessa vain Ahvenanmaalla[4].Suomen ympäristökeskuksen kasviasiantunti<strong>ja</strong>löysi maastokäynnillään vuonna 2005 Kalkkisaarestayhden Suomelle uuden jäkälälajin <strong>ja</strong> yhden uhanalaisenlajin sekä useita harvinaisia <strong>ja</strong> hyvin harvinaisiajäkälälaje<strong>ja</strong> <strong>ja</strong> useita huomionarvoisia sammallaje<strong>ja</strong>.Kalkkisaari on valtakunnallisesti merkittävä kallioaluesekä kasvillisuudeltaan että kalkinvaati<strong>ja</strong>lajistonperusteella [4]. Saarelle tarvitaan luontoarvojensäilyttämiseksi <strong>ja</strong> luonnontilaisuuden voimistamiseksiluvanvaraisuuteen perustuva <strong>ja</strong> talvia<strong>ja</strong>nkinkattava liikkumisrajoitus maihinnousukieltoineen.Saareen voidaan järjestää oh<strong>ja</strong>ttu<strong>ja</strong> kasviretkiä.<strong>Satama</strong>n koillisreunan taakse kunnostettavaviheralue muotoillaan siten, että rantaviivasta tuleemahdollisimman luonnonmukainen. Kahlaa<strong>ja</strong>paikankohdalle rakennetaan näköalapaikka. Viheralueelleistutetaan yksittäispuita <strong>ja</strong> puuryhmiä. Koillisrannanmerenpuoleiseen päähän muodostetaan sopiviatasanteita rannalta onkimiseen <strong>ja</strong> uisteluun.L ä h t e e t1. <strong>Helsingin</strong> kaupunginhallitus, pöytäkir<strong>ja</strong>note 14.10.2002,1305§. Kaupunginvaltuuston 9. 10. 2002 tekemien päätöstentäytäntöönpano. Teknistä tointa johtavan apulaiskaupunginjohta<strong>ja</strong>ntoimiala, 13.2. <strong>Helsingin</strong> kaupunkisuunnitteluvirasto, kaavoitusosasto2002. <strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö, asemakaava.3. LT-Konsultit Oy. Mellunmäen niityn <strong>ja</strong> Nybondaksenympäristön hoito- <strong>ja</strong> kehittämissuunnitelma. <strong>Helsingin</strong>kaupungin rakennusviraston julkaisu<strong>ja</strong> 2002:15 / Viherosasto.4. Ramboll, Kala- <strong>ja</strong> Vesitutkimus Oy, ArkkitehtihuoneArtto Palo Rossi Tikka Oy. <strong>Vuosaaren</strong> <strong>satama</strong>n koillisrannansekä viereisen Varissaaren <strong>ja</strong> Kalkkisaaren välisenalueen toteuttaminen lintu- <strong>ja</strong> virkistysalueeksi30. 5. 2006. <strong>Helsingin</strong> <strong>Satama</strong>.5. Suomalainen Insinööritoimisto Oy, YmpäristösuunnitteluEnviro Oy. Broändan purolaakso. <strong>Helsingin</strong> kaupunkisuunnitteluvirastonjulkaisu<strong>ja</strong> 2001:8.6. Suunnittelukeskus Oy. <strong>Vuosaaren</strong> kaatopaikka <strong>ja</strong> täyttömäki.Kunnostussuunnitelma <strong>ja</strong> luonnos maisemointisuunnitelmaksi20. 11. 2001. <strong>Helsingin</strong> kaupungin rakennusvirastoHKR – ympäristötuotanto.7. Uudenmaan ympäristökeskus 19. 3. 1998. Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien (FI0100065) Naturatietolomake<strong>ja</strong> kartta.8. Uudenmaan ympäristökeskus, tiedote 10. 6. 2003. <strong>Vuosaaren</strong>kaatopaikka kunnostetaan.9. Uudenmaan ympäristökeskus, tiedote 15. 12. 2003.Sipoon Östersundomissa suojeltu arvokkaita lintulahtia.10. VUOSA-projekti, VUOLI-projekti. <strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong>ympäristö. Esite 2005.11. Ympäristöministeriö, tiedote 1. 12. 2006. <strong>Vuosaaren</strong>Huippu on paras teko monimuotoisen luonnon puolesta.12 Ympäristösuunnittelu Enviro Oy. Mustavuoren–Porvarinlahdenluonnonsuojelualueen hoito- <strong>ja</strong> käyttösuunnitelma2005 –2014. Käsikirjoitus 2004. <strong>Helsingin</strong> kaupunginympäristökeskus.13. Ympäristösuunnittelu Enviro Oy. Porvarinlahden etelärannanluonnonsuojelualueen hoito- <strong>ja</strong> käyttösuunnitelma2005 –2014. Käsikirjoitus 2004. <strong>Helsingin</strong> <strong>Satama</strong>.14. Ympäristösuunnittelu Enviro Oy. Porvarinlahden kasvillisuuskartoitus2003. <strong>Helsingin</strong> <strong>Satama</strong>, <strong>Helsingin</strong> kaupunginympäristökeskus.15. Yrjölä R. Östersundomin lintuvesien hoito- <strong>ja</strong> käyttösuunnitelma.Kapellviken, Torpviken, Bruksviken. Käsikirjoitus2006. <strong>Helsingin</strong> kaupungin ympäristökeskus.SATAMAN RAKENTAMISEEN LIITTYVÄT YMPÄRISTÖHANKKEET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö141


15Räjähtämättömien lentopommien aiheuttamariski <strong>satama</strong>n rakentamisessa15.1 Johdanto<strong>Vuosaaren</strong> <strong>satama</strong>n suunnittelun aikana 1990-luvullakävi ilmi, että kansan suussa kierteli kertomuksiasodan aikaisista pommeista Vuosaaressa. Niitä olilöytynyt rakentamistoiminnan yhteydessä. Myöslehdissä löytyi kertomuksia, joissa vanhat ihmisetmuistelivat pommituksia <strong>ja</strong> löytyneitä ammuksia.<strong>Satama</strong>n suunnitteli<strong>ja</strong>t päättivät selvittää asiaa tarkemminyhdessä <strong>Helsingin</strong> Sotilasläänin Esikunnankanssa. <strong>Helsingin</strong> <strong>Satama</strong> pyysi helmikuussa 2002kirjoitta<strong>ja</strong>a laatimaan tutkielman <strong>Helsingin</strong> pommituksistatarkoituksena selvittää, olisiko <strong>Vuosaaren</strong>alueella mahdollisesti räjähtämättömiä lentopomme<strong>ja</strong><strong>satama</strong>n <strong>ja</strong> sen väylien rakentamista a<strong>ja</strong>tellen.Selvitysten perusteella tultiin siihen tulokseen,että oli pieni mahdollisuus, että pomme<strong>ja</strong> löytyy<strong>satama</strong>n <strong>ja</strong> meriväylän alueelta. Räjähtämättömienpommien aiheuttama riski todettiin kuitenkin vähäiseksi.<strong>Satama</strong>n <strong>ja</strong> liikenneyhteyksien rakentamisprojektienyhteydessä tehdyissä riskianalyyseissä asiakuitenkin huomioitiin.Vuosaari jäi pääkaupungin pommituksissa sivusuunnaksi,mutta alueelle oli pudotettu pomme<strong>ja</strong> <strong>ja</strong>osa niistä olisi voinut jäädä suutareiksi. Ruoppaustöidenaikana ei tehty havainto<strong>ja</strong> räjähtämättömistälentopommeista. Sen si<strong>ja</strong>an väylältä löytyi 40 000vuotta vanha mammutin kyynärluu, joka on luovutettuLuonnontieteellisen keskusmuseon kokoelmiin.Ratapiha-alueen kaivutöiden yhteydessä löytyiyksi palopommi, jonka Puolustusvoimien asiantunti<strong>ja</strong>ttekivät vaarattomaksi.Vuonna 1944 Nordsjö ei ollut sotilaallisesti tärkeäkohdealue, mutta nyt tilanne on muuttunut. <strong>Vuosaaren</strong>uusi <strong>satama</strong> on mahdollisessa sotilaallisessakriisitilanteessa eräs pääkaupunkiseudun tärkeimpiästrategisia kohteita. Se täytyy ottaa huomioon ilmapuolustuksenjärjestelyissäkin.15.2 Talvisodan ilmahyökkäyksissä isot tappiotTalvisodan aikana 1939 –1940 Neuvostoliiton ilmavoimatpommittivat 690 paikkakuntaa Suomessa.Pääkaupungissa ilmahyökkäyksiä tapahtui vain kahdeksankertaa vähäisin voimin (54 lentoa). Hyökkäystenkohteina olivat erityisesti kantakaupunki,Malmin lentokenttä <strong>ja</strong> Santahaminan merilentoasema.Osa viholliskoneista oli hävittäjiä. Ilmatorjuntaampui viisi konetta alas. Pommituksissa 97henkilöä kuoli <strong>ja</strong> 260 haavoittui sekä 55 rakennustatuhoutui tai vaurioitui. Vaikka eräitä muita kaupunke<strong>ja</strong>pommitettiin paljon enemmän, olivat henkilötappiotHelsingissä silti pahimmat. On arveltu, etteipääkaupunkia haluttu tuhota, koska se oli tarkoitusmiehittää. Myös ulkovaltojen vastalauseilla saattoiolla vaikutusta asiaan. Sanottiin, että ”Suomi pommitettiinmaailmankartalle”.15.3 Jatkosodan alkuvuosina Helsinkiä pommitettiin 36 kertaaJatkosodan alkaessa Neuvostoliiton ilmavoimatpommittivat useita paikkakuntia Suomessa. Kesäkuunlopulla 1941 Helsinkiä pommitettiin kaikkiaanviisi kertaa; vihollinen pudotti 61 miinapommia, 21palopommia <strong>ja</strong> 5 sirpalepommia. Vuoden 1941 ilmapommituksissakuoli 30 henkilöä <strong>ja</strong> haavoittui 188.Vuoden 1942 aikana Helsinkiin kohdistui 16pommitusta, pääasiassa yöaikaan. Aineelliset vahingotolivat vähäiset, tulipalo<strong>ja</strong> syttyi vain kuusi.Henkilötappioita kuitenkin aiheutui, 61 henkilöäsai surmansa <strong>ja</strong> 73 haavoittui. Tähän aikaan <strong>Helsingin</strong>ilmapuolustus ei vielä ollut yhtä tehokastakuin pari vuotta myöhemmin. Erityisesti keinotpimeähyökkäysten torjuntaan olivat rajoitetut.Vuoden 1943 kuluessa Helsinkiä pommitettiin15 kertaa vähäisin voimin <strong>ja</strong> heikoin tuloksin. Tulipalo<strong>ja</strong>syttyi 10. Pommituksissa kuoli 3 henkilöä <strong>ja</strong>21 haavoittui.Vuosaari ei kuulunut pommitusten piiriin, koskasiellä ei ollut pommituskohteitakaan.142 RÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aAhti Lappi, eversti evp., on entinen ilmatorjunnan tarkasta<strong>ja</strong><strong>ja</strong> ilmasotahistorioitsi<strong>ja</strong>. Hän on julkaissut useita teoksia.15.4 <strong>Helsingin</strong> suurpommitukset helmikuussa 194415.4.1 Pommien määrä<strong>ja</strong> pommitusten a<strong>ja</strong>nkohdatStalin antoi Neuvostoliiton kaukotoimintailmavoimille(ADD) hyökkäyskäskyn jo joulukuussa 1943,mutta huonojen sääolojen <strong>ja</strong> muiden tehtävien takiaSuomen pommitusten aloittaminen viivästyi.Helsinkiä pommitettiin suurin voimin kolme kertaa10 vrk:n väliajoin. Aikataulun säännöllisyys lieneepelkkä sattuma, sillä ADD:llä oli välissä muitakintehtäviä. Sääolojen piti olla mahdollisimmanhyvät, jotta yöpommituksissa olisi löydetty maalit.Helsinki oli parhaiten suo<strong>ja</strong>ttu kohde, joten myössuunnittelu vei enemmän aikaa. Pommituslentojen<strong>ja</strong> pommien määrät olivat seuraavat:6. / 7. 2. 728 konetta, 6 991 pommia16. / 17. 2. 383 konetta, 4 317 pommia26. / 27. 2. 896 konetta, 5 182 pommiaYhteensä suoritettiin 2 007 pommituslentoa <strong>ja</strong> pudotettiin16 490 pommia painoltaan 2 604,5 tonnia.Ensimmäisessä hyökkäyksessä pudotettiin enitenpomme<strong>ja</strong>, joista pienten palopommien osuusoli lähes 50 %. Keskimmäinen pommitus oli heikompi.Viimeisessä hyökkäyksessä oli mukana enitenkoneita, <strong>ja</strong> pommeista 70 % oli räjähdyspomme<strong>ja</strong>,osa varsin iso<strong>ja</strong>.Räjähdyspomme<strong>ja</strong> (miinapomme<strong>ja</strong>) oli yhteensä9 398 kpl, suurimmat painoivat 5 000, 2 000 <strong>ja</strong> 1 000kg. Eniten käytetyissä 250 kg pommeissa oli 113–118kg räjähdysainetta, <strong>ja</strong> 100 kg pommeissa 32–46 kg.Palopomme<strong>ja</strong> pudotettiin 7 092 kpl. Niitä oli kahtaeri lajia, naftapommi <strong>ja</strong> termiittipommi. Osa lieneeollut rypälepomme<strong>ja</strong> (ns. ”Molotovin leipäkori”),joissa emopommin sisällä oli suuri määrä 1–1½ kgpikkupomme<strong>ja</strong>.15.4.2 Ilmatorjuntarykmentti 1puolusti pääkaupunkia<strong>Helsingin</strong> ilmapuolustuksesta vastasi Ilmatorjuntarykmentti1 (It.R 1) everstiluutnantti Pekka Jokipaltionjohdolla. Rykmenttiin kuului neljä raskasta <strong>ja</strong>yksi kevyt ilmatorjuntapatteristo sekä valonheitinpatteristo.Yksiköt oli ryhmitetty täysympyräpuolustukseenkaupungin ympärille siten, että jokaisellaraskaalla patteristolla oli 90 asteen torjuntasektori.Aluksi oli käytössä 12 raskasta (75–88 mm)it.patteria, lopussa 15. Neljällä raskaalla patterillaoli käytössään Ir<strong>ja</strong>-tulenjohtotutkat. Kevyen ilmatorjuntapatteriston(III/It.R 1) organisaatioon kuuluikevyitä 20 <strong>ja</strong> 40 mm:n ilmatorjunta<strong>ja</strong>oksia (16)matalatorjuntaa varten. <strong>Helsingin</strong> edustan saarillaolevat rannikkoilmatorjuntapatterit (3) osallistuivattorjuntaan, samoin Isosaaren 152 mm:n rannikko-Kuva 15.1<strong>Helsingin</strong> pommituksissapudotettiinerilaisia räjähdys- <strong>ja</strong>palopomme<strong>ja</strong>, joistasuurimmat olivat5 000 kg:n painoisia.RÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö143


Kuva 15.2Ilmatorjuntarykmentti1:n raskaiden pattereidenryhmitys mahdollistitorjuntatulenulottamisen viholliskoneisiinennen kuinne olivat pomminpudotusetäisyydelläkantakaupungista.Kuva 15.3Autenttinen piirrossulkuammuntakartastaosoittaa, missä oli torjuntatulenpainopiste.Uloimmat sulut olivatNordsjön päällä.Hyökkäystä torjuttaessa16.–17. 2. 44 ammututsulut. Keskellä näkyykunkin sulun numero,vieressä ampumiskerrat,mikäli niitä onenemmän kuin yksi.patteri. Torjunnassa oli mukana eräitä tilapäisyksiköitäkinmm. Ilmatorjuntakoulusta <strong>ja</strong> merivoimista.Rykmentin pääpiirteinen ryhmitys 6. 2. 1944 selviääoheisesta kuvasta 15.2. <strong>Vuosaaren</strong> (Nordsjön) alueellaei aluksi ollut tuliyksiköitä.Raskas ilmatorjuntapatteri(tutka)Raskas ilmatorjuntapatteri(ei tutkaa)Rannikkotykistön patteri (it)It.R 1:n torjuntakeskusPatteristojentorjuntasektorin ra<strong>ja</strong>Pomminpudotuskehämax.Raskaiden pattereidenkantamakehäVihollisen pommituslentojen painopistesektori olikaakko, missä kovimman vastuun torjunnasta kantoimajuri Pentti Paateron Raskas Ilmatorjuntapatteristo1, jonka raskaat patterit (3) olivat Santahaminassa<strong>ja</strong> Laa<strong>ja</strong>salossa (Degerö). Koillissektorista vastasimajuri Reino Oksasen Raskas Ilmatorjuntapatteristo4. Sen kahden patterin tuliasemat olivat Kasavuoressa(Roihuvuori) <strong>ja</strong> Viikissä. Luoteissektorissa olikapteeni Aki Marteen I Patteristo (3 patteria) <strong>ja</strong> lounaissektorissamajuri Kaarlo Seppälän II Patteristo(4 patteria). Taistelujen aikana suoritettiin joitakinryhmitysmuutoksia. Herttoniemessä oli viimeisenpommituksen aikana yksi raskas it.patteri.Neljä valonheitinpatteria (36 valonheitintä, 12kuulosuunninta) oli ryhmitetty kaupunkiin <strong>ja</strong> senulkopuolelle. Valonheitinpatteriston 2. Patterin(Osasto H) komentopaikka oli Nordsjön kartanonalueella, päällikkönä oli luutnantti A. Hokkanen.Sen alaisen 31. Valonheitin<strong>ja</strong>oksen ryhmät (3) olisijoitettu Vuosaareen Skatan, Sasekan <strong>ja</strong> Nordsjönkartanon alueille. Valonheittimiä oli myös saarilla,mm. Itä-Villingissä, Eestiluodossa <strong>ja</strong> Pirttisaaressa.Raskas ilmatorjuntatykistö ampui taivaalle yli34 000 kranaattia (75–76 –88 mm), kevyet (20 –40mm) ilmatorjuntatykit yli 12 000. Viimeisen pommituksentorjunnassa raskaat patterit ampuivat enemmänkranaatte<strong>ja</strong> (14 240) kuinsuomalainen kenttätykistökesällä 1944 Talin–Ihantalansuurtaistelussa yhden päivänaikana. Se kertoo jotakintaistelun kiivaudesta.15.4.3 Itsemurhapatteriharhautti VuosaaressaEnnen viimeistä suurhyökkäystäsijoitettiin 22. 2. 1944<strong>Vuosaaren</strong> alueelle (Nordsjönkartano) Ilmatorjuntakoulunmuodostama nelitykkinenraskas it.patteri (sulkupatteri)”Pommi”, jonka päällikkönätoimi kapteeni R.Salminen. Patterin tehtävänäoli harhauttaa vihollista tulittamallakiivaasti <strong>ja</strong> sytyttämälläkokko<strong>ja</strong>. Tehtävän vaarallisuudenvuoksi yksikköäon nimitetty myös ”itsemurhapatteriksi”.Torjuntapäällikön,kapteeni Aake Pesosenkir<strong>ja</strong>n mukaan144 RÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 15.4Tutkatasolta taltioidutviimeisen pommituksenlentoreitit todistavat,että koneet kääntyivättorjunnan vaikutuksestapoispäin ennen kuinolivat oikealla pomminpudotusetäisyydellä.”Pommi lähetti useita bensiinikanistereilla varustettu<strong>ja</strong>pyromaane<strong>ja</strong> sytyttämään noin 20 valmiiksi kasattua kokkoa<strong>ja</strong> pian nämä valetulipalot leimusivatkin kirkkaasti. - - -Valetulipalot samoin kuin patterin tykkien putkivalkeattuntuivatkin harhauttavan osan hyökkääjistä, koska alueellealkoi sataa runsaasti pomme<strong>ja</strong>. Onneksi patteri eikärsinyt tappioita.”Kuvauksesta voi päätellä, että harhautus onnistui.Harhautusta täydennettiin käyttämällä ajoittain vainkaupungin idänpuoleisia valonheittimiä.<strong>Vuosaaren</strong> harhautuksella oli oma positiivinenvaikutuksensa, koska osa pommeista pudotettiinvarsinaisen kaupungin ulkopuolelle. Vaikutusoli kuitenkin ra<strong>ja</strong>llinen, koska harhautusta käytettiinvain viimeisen pommituksen yhteydessä <strong>ja</strong> silloinkinvain osa viholliskoneista lensi <strong>Vuosaaren</strong>ylitse. Päähyökkäyssuunta tuli kaakosta Santahaminanyli. Suomessa elokuussa 2004 vieraillut ADD:nentinen pilotti, kenraalieversti Vasilj Reshetnikovmuisteli suorittaneensa viisi pommituslentoa Helsinkiinhavaitsematta harhautusta. Menetelmä olituttu venäläisillekin. Valaisupommien käyttö tekiyöstä päivän, joten kaupunkia oli vaikea piilottaa.Voihan olla niinkin, että Pommi-patterin kiivas tulitussai viholliskoneet pudottamaan pomminsa ennenaiko<strong>ja</strong>an.Vuotien alkupäässä olevat valopylväät muistuttavatjälkipolvia harhautusoperaatiosta.15.4.4 Miksi pommit eivät osuneet?ADD:n lentorykmenteille oli käsketty yksittäisetpommitusmaalit (51 kpl) <strong>Helsingin</strong> kantakaupunginalueelta, mutta tällaiseen tarkkuuspommitukseenei venäläisillä ollut teknisiä eikä taidollisia edellytyksiä.Tuloksena oli epätarkka aluepommitus.Suur-<strong>Helsingin</strong> alueelle osui 799 pommia, mikä olivain 4,8 % koko pommikuormasta. Vain noin 100pommikonetta tuli torjuntatulesta välittämättä oikeallepomminpudotusetäisyydelle (2,6–3,8 km) käsketystämaalista.Yli 95 % pommeista (15 691 kpl) osui vahinkoaaiheuttamatta maalialueen ulkopuolelle – pääasiassamereen. Tämän katsotaan aiheutuneen It.R 1:n voimakkaansulku- <strong>ja</strong> seuranta-ammunnan pelotusvaikutuksesta.Ensimmäisen pommitusyön jälkeen torjuntaanosallistui myös saksalaisia hävittäjiä. Niidentilille kir<strong>ja</strong>ttiin neljän viholliskoneen pudotus viimeisenpommituksen aikana.It.R 1:n tutkien mittaustietojen avulla taltioitiinpommituskonemuodostelmien lentoreitit. Niistä voidaanhavaita ilmahyökkäysten painopistesektorit.Varsinkin ensimmäisellä pommituskerralla viholliskoneetyrittivät hyökätä kaupunkiin joka suunnalta,vaikka selvä painopiste oli kaakossa. Taltioiduistalentoreittipiirroksista voidaan todeta, ettäpääosa koneista kaartoi pois hyvissä ajoin – ilmeisestitorjuntatulen vaikutuksesta. Kaakkoissektorissaväistö tapahtui enimmäkseen Santahaminan päälläRÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö145


Kuva 15.5Arvio eri alueille pudotetustapommeista.Pääosa pommeistaputosi merialueelle.(5–6 km maalista). Kaikkia lento<strong>ja</strong> ei ehditty havaitaeikä taltioida.Oheisesta kuvasta 15.5 selviää, paljonko pomme<strong>ja</strong>putosi eri alueille. Varsinaisen kaupunkialueenosalta tiedot perustuvat tarkkoihin pommituskarttoihin,mutta muilta osin tulos lienee arvionvarainen.Tuskin kukaan on voinut tarkasti selvittää, mihinpomme<strong>ja</strong> osui merialueella. Pommimäärä arvioitiinaiemmin todellista pienemmäksi, kunnes saatiinkäyttöön venäläisten tutkijoiden viimeiset arkistotiedot(v. 1999). Lentoreittipiirrosten kaartokohtienperusteella voidaan päätellä, että pääosa pommeista(arvio 70 %) putosi mereen Suomenlinnan <strong>ja</strong> Santahaminanetelä- <strong>ja</strong> kaakkoispuolelle. Loput (n. 4 000 –5 000 pommia) putosivat joka puolelle <strong>Helsingin</strong>ympäristöön. Silloisen <strong>Helsingin</strong> kaupungin itä- <strong>ja</strong>kaakkoispuolisille alueille osui paljon pomme<strong>ja</strong>.Laa<strong>ja</strong>salon, Tammisalon, Puotilan <strong>ja</strong> <strong>Vuosaaren</strong> alueillakuoli pommituksissa 13 siviilihenkilöä.15.4.5 Jäikö pomme<strong>ja</strong> suutareiksi?Yleinen havainto sotien a<strong>ja</strong>lta on, että pieni osapommeista <strong>ja</strong> kranaateista ei räjähdäkään, vaan jäälaukeamattomaksi. On oikeastaan yllättävää, kuinkavähän räjähtämättömiä lentopomme<strong>ja</strong> <strong>ja</strong> ilmatorjuntatykistönkranaatte<strong>ja</strong> sotien jälkeen on löytynyt <strong>Helsingin</strong>alueelta. Jos niitä olisi ollut runsaasti, kylläniitä olisi löydettykin enemmän. Maahan osuneistapommeista suurin osa räjähti tai ainakin hajosi iskunvoimasta. On luultavaa, että maahan jääneet suutariton joka tapauksessa löydetty <strong>ja</strong> eliminoitu välittömästisotien jälkeen.Merentutkimuslaitoksen tietojen mukaan merijäätyi <strong>Helsingin</strong> edustalla vuonna 1944 vasta helmikuunpuolivälin jälkeen. Rannan tuntumaan tulipysyvä jääpeite 12. 2. <strong>ja</strong> ohut kiintojää ulottui Harma<strong>ja</strong>nluo vasta 22. 2. Sen ulkopuolella oli ahtojäätä.Kahden ensimmäisen pommituksen aikana meri olisiis kutakuinkin avoin <strong>ja</strong> vasta viimeisen pommituksenaikana heikohkon jään peittämä. Jäähän osuneetpommit räjähtivät luultavasti ihan normaalisti.Vesikään ei ole niin pehmeä elementti kuin luullaan,vaan kärki-iskusytyttimillä varustetut pommiträjähtivät myös suurella todennäköisyydellä avoveteenosuessaan. On tietysti pieni riski olemassa,että joku avoveteen osunut <strong>ja</strong> poh<strong>ja</strong>an uponnutpommi olisi jäänyt suutariksi. Loogisesti a<strong>ja</strong>tellenpommi, joka ei uutenakaan räjähtänyt, tuskin enääräjähtää lähes 60 vuoden kuluttua kovin helposti.Sytytinosa ruostuu <strong>ja</strong> räjähdysaine menettää tehoaankosteuden vaikutuksesta. Joku riski silti on.146 RÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


15.4.6 Toimintaohjeet löydettäessäräjähteeksi epäilty esine<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> liikenneyhteyksien rakentamisprojektienyhteydessä tehdyissä riskianalyyseissäräjähtämättömien lentopommien aiheuttama riskihuomioitiin. Toimenpiteinä päädyttiin siihen, ettäseuraavassa esitetyt asiaa koskevat toimintaohjeetsisällytettiin <strong>satama</strong>hankkeen työmaaohjeisiin:ToimintaohjeetYleistäMaaperään selkeästi kuulumaton esine on aina syytätarkastaa ennen kuin koneellista käsittelyä <strong>ja</strong>tketaan.tiedossa puolustusvoimien ammusupotuksia väyläalueella.Jonkinlaisena riskinä se kuitenkin pitää toisenmaailmansodan aikana Helsinkiin kohdistuneitapommituslento<strong>ja</strong> jotka harhautusten johdosta suuntautuivat<strong>Helsingin</strong> itäpuolelle <strong>ja</strong> osa pommeistailmatorjunnan takia pudotettiin merialueelle.Jos ruoppausmassan seassa havaitaan ampumatarvikkeita,on ruoppaus kohteella keskeytettävä <strong>ja</strong>tehtävä löydöstä ilmoitus tilaa<strong>ja</strong>lle. Ruoppausta ko.kohteella saadaan <strong>ja</strong>tkaa vasta tilaa<strong>ja</strong>n antamalla erityiselläluvalla.Toimenpiteet löydettäessä räjähteeksi epäilty esine• keskeytä työt, älä liikuta esinettä• merkitse löydöksen paikka• estä asiattomien pääsy esineen lähelle• ilmoita epäilyksestä heti työnjohta<strong>ja</strong>llesiIlmoitukset viranomaisilleKaikista räjähde-epäilyistä on aina heti ilmoitettava<strong>Helsingin</strong> Sotilasläänin Esikunnan päivystäjällenumeroon: 0400 503 344, joka käynnistää toimenpiteetasian hoitamiseksi. Ilmoita asiasta välittömästimyös tilaa<strong>ja</strong>n valvo<strong>ja</strong>lle.Kuva 15.6Ruoppaustöiden aikanaei tehty havainto<strong>ja</strong>räjähtämättömistä lentopommeista.Sen si<strong>ja</strong>an väylältä löytyi40 000 vuotta vanhamammutin kyynärluu.Kuva: Juha Kuokkanen / Illusia.bizMuut huomioitavat asiatKun löydös on merkitty, työskentelyä voidaan <strong>ja</strong>tkaaseuraavien suo<strong>ja</strong>etäisyyksien päässä:• Löydös enintään ison pullon kokoinen 100 m• Löydös enintään ämpärin kokoinen 200 m• Löydös ämpäriä suurempi300 mMikäli kokoa ei voida tarkasti määrittää, toimitaansuurimman etäisyyden mukaisesti.Jos kaivinkoneen tai vastaavan kauhassa vedestänousee räjähteeksi epäilty esine, on se laskettavakauhassa pitäen takaisin veteen.Työnjohdolla tulee olla <strong>ja</strong>tkuvasti mahdollisuusilmoittaa vaara-alueesta muille työntekijöille.Työturvallisuusasiakir<strong>ja</strong>Ruoppausprojektien hankinta-asiakirjoihin liittyvässätyöturvallisuusasiakir<strong>ja</strong>ssa (4. 3. 2003) todettiinseuraavaa:Ruoppauskohteiden poh<strong>ja</strong>tutkimuksissa ei oletehty havainto<strong>ja</strong> ampumatarvikkeista. PyynnöstäMerivoimien Esikunta on ilmoittanut, että sillä ei oleL ä h t e e t1. Ilmatorjuntarykmentti 1:n torjuntatoimiston sotapäiväkir<strong>ja</strong>1. 1. – 21. 7. 1944. (SArk 7790)2. Ilmavoimien ilmatorjuntaosaston (it.2) toimintakertomuksia(It.R 1) 1941– 44. (SArk T 18027)3. Alanen, Pertti & Lappi, Ahti. <strong>Helsingin</strong> ilmapuolustuksentorjuntavoitto 1944. Ilmatorjuntamuseosäätiö, Helsinki2004 (julkaistu myös DVD:nä <strong>ja</strong> käännetty englanniksi)4. Haapanen, Atso. Kohtalon yöt. Apali Oy, Hämeenlinna20045. Helminen, Martti & Lukander, Aslak. <strong>Helsingin</strong> suurpommituksethelmikuussa 1944. WSOY 2004.6. Lappi, Ahti. Ilmatorjunta ilmasodassa 1794–1945, s.448–455. Vaasa 20007. Lappi, Ahti. Kotialueen ilmapuolustuksen torjuntavoitto1944. Jatkosodan pikkujättiläinen, WSOY 20058. Medved, Aleksandr & Hazanov, Dmitrij et Geust, Carl-Fredrik. ADD:n hyökkäykset Helsinkiin helmikuussa1944. Sotahistoriallinen aikakauskir<strong>ja</strong> n:o 18/19999. Mäkelä, Jukka L. Helsinki liekeissä. Juva 196710. Palmu, Pentti. Yön yli päivään. Suomen ilmatorjunnanvaiheita 1925–1990. Helsinki 198911. Penttilä, Eino. Taistelu Helsingistä. Jyväskylä 199312. Pesonen, Aake. Tuli-isku<strong>ja</strong> taivaalle. Hämeenlinna 198213. Pesonen, Aake. Helsinki sodassa. Helsinki 198514. <strong>Vuosaaren</strong> <strong>satama</strong>hankkeen työmaaohjeetRÄJÄHTÄMÄTTÖMIEN LENTOPOMMIEN AIHEUTTAMA RISKI SATAMAN RAKENTAMISESSA<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö147


16<strong>Vuosaaren</strong> <strong>satama</strong>hanke<strong>ja</strong> arkeologiset tutkimukset16.1 JohdantoSuuret rakennushankkeet kohdistuvat usein sellaisillealueille, joilla on muinaismuistolain tarkoittamiakiinteitä muinaisjäännöksiä. Jos muinaisjäännöstäei lasketa valtakunnallisesti arvokkaanasuojeltavaksi, edellyttää muinaismuistolaki senarkeologista tutkimusta ennen rakennustöiden aloittamista.Kulttuurihistoriallisesti arvokkaita kohteitatuhoutuu siis väistämättä. Toisaalta korvauksenasaadaan runsaasti uutta tietoa, sillä rakennushankkeetmahdollistavat laa<strong>ja</strong>t arkeologiset kaivaukset,joita muutoin olisi mahdoton järjestää. <strong>Vuosaaren</strong><strong>satama</strong>radan <strong>ja</strong> -tien eteläosa kulkee ikivanhan Länsisalmenkylän halki. Alueella on tuskin yhtään täysinmuinaisjäännöksetöntä kohtaa. Museovirastonrakennushistorian osaston arkeologit tutkivat vuosina2002–2003 Porvarilahden itärannalla olevia parisataa vuotta vanho<strong>ja</strong> kalkkiuune<strong>ja</strong> <strong>ja</strong> Gubbackassasi<strong>ja</strong>itsevaa 1500-luvulla autioitunutta kylää.16.2 Porvarinlahden kalkkiuunit16.2.1 Historiallinen taustaPorvarinlahden rantojen kalkkiuuneihin suoraan liittyviävanho<strong>ja</strong> asiakirjo<strong>ja</strong> ei ole ainakaan toistaiseksilöydetty arkistoista. Sen verran kuitenkin on varmaa,että <strong>Vuosaaren</strong> seudulta louhittiin 1700-luvun keskivaiheen<strong>ja</strong> 1800-luvun alun välillä runsaasti kalkkikiveäSuomenlinnan rakennustöitä varten [11, 18].Lisäksi tiedetään, että Porvarinlahden rannat omistanutVästerkullan kartano osallistui aktiivisesti kalkkiliiketoimintaan.Kartanonherra majuri Erik Armfeltperusti 1760-luvulla Porvarinlahden suun edustallasi<strong>ja</strong>itsevalle Kalkholmenille kalkkiuune<strong>ja</strong> [15, 16,17]. Vuonna 1770 annettiin kalastajien vaatimuksestamääräys, ettei Västerkullan kalkkikaivoksellasaanut suorittaa räjäytyksiä huhti-, touko- <strong>ja</strong> kesäkuussa[16]. Vuosina 1791–1818 Westerkullaa hallinneenGabriel August Hagelbergin aikana toimitettiinkartanon mailla valmistettua kalkkia <strong>Helsingin</strong>lisäksi Tukholmaan, Haminaan <strong>ja</strong> Viipuriin [15, 16,17] Porvarinlahden kalkkikivivarantojen hyödyntämisenkukoistuskausi oli ilmeisesti lyhyt. Kalkkilouhoksetjäivät käytöstä ennen vuotta 1854 [13]. Vuodelta1904 peräisin olevan tiedon mukaan louhoksethylättiin mahdollisesti jo 1830-luvulla [10].16.2.2 Kalkinpoltto maauunissaKalkinvalmistus oli ennen teollistumistaan monivaiheinen<strong>ja</strong> pitkäkestoinen prosessi. Ennen kalkinpolttoalouhittiin kalkkikiveä <strong>ja</strong> hankittiin polttopuita.Maauunin rakentaminen aloitettiin kaivamalla jyrkkäänrinteeseen u:n muotoinen kuoppa. Kolme rin-Kuva 16.1Piirros kalkkiuunistaennen täyttöä.Kuva: Riina Mäki /Museovirasto148 VUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aVeli-Pekka Suhonen, FM (arkeologia), on työskennellyt tutki<strong>ja</strong>naMuseoviraston rakennushistorian osaston kaivaus- <strong>ja</strong> inventointiprojekteissavuodesta 1999 lähtien.teen puoleista sivua vuorattiin kuumuutta kestävilläkivillä. Uunin poh<strong>ja</strong>lle rakennettiin kivistä holvattutulipesä. Kuopan avoin etuseinä tehtiin kivistä <strong>ja</strong>tiivistettiin joko savella tai kalkkilaastilla. Viimeiseksiuunikuoppa täytettiin kalkkikivillä <strong>ja</strong> peitettiinkalkkikivisoralla, kivillä tai savella [19].Valmistelutöiden päättymisen jälkeen tulipesäänladottiin pitkiä puurunko<strong>ja</strong> <strong>ja</strong> kalkkiuuni sytytettiinpalamaan. Poltto kesti uunin koosta <strong>ja</strong> muista olosuhteistariippuen viidestä vuorokaudesta jopa kuukauteen.Polttamisen yhteydessä suoritettiin kaksikolme kertaa vuorokaudessa tulipesän tyhjentäminentuhkasta <strong>ja</strong> hiilestä. Lisäksi koko a<strong>ja</strong>n vahdittiin,ettei tuli päässyt katon läpi. Kun uuni oli palanutloppuun, se jätettiin jäähtymään muutamaksivuorokaudeksi. Lopuksi kalkkikivi lapioitiin uuninedessä olevalle tantereelle, puhdistettiin epäpuhtaistakivistä, sammutettiin vedellä, seulottiin <strong>ja</strong> kuljetettiinkalkkilatoon [19].Kuten edellisen kappaleen selostuksesta käy ilmi,kalkinpolton jäännökset eivät rajoitu pelkästään itsekalkkiuuniin. Jossain lähellä ovat kalkkilouhokset,työntekijöiden asuinpaikat, kalkkiladot jne. Pelkänkalkkiuunin tutkiminen ei anna tarpeeksi tietoa ”työpaikan”luonteesta. On pakko kääntää katse uunistapois päin. Porvarinlahden kenttätöiden yhteydessäkäytettiin runsaasti aikaa ympäristön kartoitukseen.Vaikka tällä kertaa tutkimusten laajuus oli ra<strong>ja</strong>llinen,osoittautui kokonaisvaltainen a<strong>ja</strong>ttelutapa hyväksilähtökohdaksi. Porvarinlahden rannoilta löytyikolme erillistä kalkinvalmistuspaikkaa. Jokaisellatuotantoyksiköllä olivat omat kalkkilouhoksensa,kalkkiuuninsa <strong>ja</strong> rakennuksensa.16.2.3 Arkeologinen kaivaus<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen vuoksi tutkittu kalkkiuunisi<strong>ja</strong>itsi Porvarinlahden pohjoisrannan kalkkikivilouhostenviereisellä rinteellä, suurin piirteinnykyisen tunnelin aukon kohdalla. Kalkkiuuninäkyi maastossa poh<strong>ja</strong>kaavaltaan pyöreänä maavallinympäröimänä kuoppana. Kalkkiuunin pitkittäisakselioli 12 metriä <strong>ja</strong> poikittaisakseli 10 metriä. Val-Kuva 16.2Kalkkiuunin vallinsisäpuolista kiveystä.Kuva: V.-P. Suhonen /MuseovirastoVUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö149


lin leveys vaihteli kahdesta metristä neljään metriin.Uunikuopan syvyys oli noin kaksi metriä.Arkeologisella kaivauksella pyrittiin saamaan tietoakalkkiuunin rakenteista <strong>ja</strong> käyttöhistoriasta [5].Tarkoituksena oli myös hankkia kokemuksia siitämiten tällaista melko nuorta teollisuushistoriallistakohdetta tulee tutkia. Jo kaivauksen alkuvaiheessaselvisi, että kalkkiuunia oli käytetty jätekuoppananykypäivään saakka. Kaivausten edetessä voitiin kuitenkintodeta, että myöhempien aikojen ihmistoimintaoli hajottanut vain vähän itse kalkkiuunia. Pahimmatvauriot rakenteille olivat syntyneet jo kalkkiuuninviimeisen polton <strong>ja</strong> purkamisen yhteydessä.Kalkkiuuni oli saanut pyöreän ulkoasunsa, kunrinteeseen kaivetun poh<strong>ja</strong>kaavaltaan u:n muotoisenkuopan ympärille oli rakennettu kylmämuurauksellailman laastia harmaa- <strong>ja</strong> kalkkikivistä noinkaksi metriä leveä muuri. Koska muuri oli yläosastaansortunut, sen korkeutta ei voitu enää määrittää.Rinteen puoleisilla kolmella sivulla havaittiintäytemaan päälle perustetun muurin lisäksi ainoastaanuunikuopan poh<strong>ja</strong>n laidalle asetettu<strong>ja</strong> iso<strong>ja</strong> harmaakiviä.Etelässä olleen uunikuopan avoimen osankohdalta löydettiin sen si<strong>ja</strong>an huomattavasti enemmänrakenteita.Kalkkiuunin etelänpuoleisen muurin päällä oli tulipesänsuuaukon holvatusta yläosasta sortuneita kiviä.Etelämuurin sisäsivulla oli ollut tiiliseinä <strong>ja</strong> ulkoreunallatäytemaavalli. Muuri oli perustettu savipat<strong>ja</strong>npäälle kootulle hiekasta, tiilestä <strong>ja</strong> harmaakivistäkoostuvalle kerrokselle. Saven yläosassa oli laakakivistä<strong>ja</strong> tiilistä koostunut taso. Tältä paikalta löytyipunasavikeramiikka-astian pala (KM 2002090: 63).Kalkkiuunin käyttöhistoriasta saatiin vain vähänvarmaa tietoa. Uunikuopan poh<strong>ja</strong>n harmaakivirakenneoli kuitenkin stratigrafian perusteella jokosamanaikainen tai vanhempi kuin reunan kehämuuri.On siis mahdollista, että kalkkiuunia on käytettyuseita kerto<strong>ja</strong>.Kaikesta päätellen Porvarinlahdella kaivettiinmaauunityyppisen kalkkiuunin jäännöksiä. UlrikRudenschöldin mukaan tällaiset kalkkiuunit tulivatUudellamaalla käyttöön 1700-luvun alkupuolella[9]. Tutkitun kalkkiuunin liittyminen Suomenlinnanrakentamiseen näyttää siten ilmeiseltä. Toisaalta tiedotUudellamaalla tapahtuneesta kansanomaisestakalkinpoltosta ovat liian vähäiset varmojen päätelmientekoon. Porvarinlahden kalkkiuuni voi sijoittuamyös 1800-luvun puolelle. Myös <strong>Helsingin</strong> kasvunedellytyksenä oli kalkki <strong>ja</strong> laasti.16.3 Länsisalmen Gubbackan autiotontti16.3.1 Historiallinen taustaEnsimmäiset tarkat tiedot Länsisalmen (ruots. Västersundom)kylän asutuksesta löytyvät vuonna 1540laaditusta Porvoon läänin maakir<strong>ja</strong>sta eli veroluettelosta.Västersundomissa oli kyseisenä vuonna 11talonpoikaistilaa [4]. Vanhemmat kir<strong>ja</strong>lliset lähteetsaattavat kertoa Länsisalmen alueella jo keskia<strong>ja</strong>llatapahtuneeseen autioitumiseen. Vuoden 1540maakir<strong>ja</strong>sta puuttuvat kuningas Maunu Eerikinpo<strong>ja</strong>n19. 12. 1347 Porvoossa päivätyssä tuomiokirjeessämainitut Gudstensby, Överby <strong>ja</strong> Heldersby.Kirjettä 1600-luvulla kopioinut kirjuri on nimennytkylät Västersundomiksi, Sottungsbyksi <strong>ja</strong> Östersundomiksi[8]. Kirjurin perustelut ovat kadonneettavoittamattomiin. Hän on ehkä oikeassa. Toisaaltaon yhtä mahdollista, että Gudstensby, Överby <strong>ja</strong>Heldersby ovat alueen 1500-luvun puolivälin kylienkadonneita edeltäjiä. Nimien ohella myös kylienpaikat ovat saattaneet vaihtua.Länsisalmen kylää kosketti Suomen asutuskehityksessä1500-luvun lopulta isoonvihaan saakkakestänyt taantuma [3]. Autioituminen alkoi Uudellamaallajoukkoilmiönä vuonna 1570 puhjenneesta 25-vuotisesta sodasta. Pitkäaikainen sota johti köyhtymiseenmm. tataarien hyökkäysten, lisääntyneenverotuksen, sotaväenoton <strong>ja</strong> sotilaiden ylläpidon,kuljetusten <strong>ja</strong> majoittamisen vuoksi [15].Länsisalmessa oli veronmaksukyvyttömiä tilo<strong>ja</strong>1580-luvun lopulta lähtien. Kyseessä ei kuitenkaannäytä olleen demografinen autioituminen. Päinvastointilat ovat pysyneet tavalla tai toisella asuttuinavaikeiden aikojen yli. Tilojen omistussuhteissatapahtui kuitenkin suuria muutoksia. Länsisalmentilat päätyivät 1600-luvun alussa yksi toisensa jälkeenaatelisten haltuun [3]. Nykyinen Västerkullankartano syntyi vuonna 1626, kun liivinmaalaiselleaatelismiehelle Reinhold Wunschille läänitetystä 10tilasta erotettiin neljä tilaa säteriksi eli asuinkartanoksi[12].Maanmittari Samuel Broteruksen vuonna 1708laatimalta Länsisalmen kartalta löytyvät Heikbackan,Västerkullan, Labbenin <strong>ja</strong> Sundtorpin tonttimaat.Broteruksen kartta tai sen maanmittauskonseptieivät pal<strong>ja</strong>sta vuonna 1347 mainitun Gudstensbynpaikkaa [1]. Broterus on tosin merkinnyt maanmit-150 VUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


tauskonseptilleen vanhan autioituneen tontin, Gubbackan.Kuten tulemme huomaamaan, Gubbackaajoittuu kuitenkin sata vuotta Gudstenbytä nuoremmaksieli 1400- <strong>ja</strong> 1500-luvuille.Nils Westermarkin vuonna 1764 piirtämään Länsisalmeniso<strong>ja</strong>kokarttaan on merkitty Gubbackanautiotontin kohdalle Heikbackan Heickas- <strong>ja</strong> Nybondas-nimistentilojen omistamat niityt [2]. Kyseessäsaattaa olla vihje näiden talojen alkuperäisestä paikasta.Kylä on siis mahdollisesti siirtynyt 1500-luvulla Gubbackasta pohjoiseen Heikbackaan elinykyiseen Västersundomin keskustaan. Verokirjoissa1500-luvun puolivälissä Västersundomin si<strong>ja</strong>sta joitakinkerto<strong>ja</strong> mainittu Inbyggeby, myöhempi Heikbacka,saattaa hyvinkin olla Gubbackan seuraa<strong>ja</strong>.Inbyggeby-nimi viittaa sisämaahan <strong>ja</strong> on mahdollista,että se on annettu Gubbackasta käsin [14].16.3.2 Gubbackan arkeologiset tutkimuksetGubbackan arkeologiset tutkimukset aloitettiin vuoden2002 syksyllä suoritetulla tonttimaan inventoinnilla<strong>ja</strong> kartoituksella [6]. Tontilla havaittiin parikymmentäenemmän tai vähemmän selvää rakennuksenpoh<strong>ja</strong>a. Autiotontin ajoituksen selviäminen jäi odottamaanseuraavan vuoden kaivauksia.Valmistelutöiden tulosten perusteella avattiinkesällä 2003 Gubbackan autiotontin itäosaan neljäkaivausaluetta <strong>ja</strong> seitsemän koeo<strong>ja</strong>a [7]. Koskakyseessä olivat pelastuskaivaukset, ensisi<strong>ja</strong>isenatavoitteena oli tutkia käytettävissä olleen a<strong>ja</strong>n puitteissamahdollisimman suuri osa tuhoutumaan tulevastatonttimaasta <strong>ja</strong> saada samalla tietoa mm. kylänajoituksesta, rakenteista <strong>ja</strong> esineellisestä kulttuurista.Kaiken kaikkiaan ehdittiin tutkia 884 m² laa<strong>ja</strong> alue.Kaivausalue 1Tonttimaan länsiosaan avattiin 170 m² laa<strong>ja</strong> kaivausalue1. Tutkimusten aikana kävi ilmi, että kaivausalueellaoli kahden rakennuksen jäännökset. Alueeneteläpuolelta pal<strong>ja</strong>stui katkelmia 7 x 6 metriä laa<strong>ja</strong>nrakennuksen kivi<strong>ja</strong>lasta. Eteläseinässä ollut taitepal<strong>ja</strong>sti rakennuksen oviaukon si<strong>ja</strong>innin. Isoista harmaakivilohkareistakoostuneen perustuksen alla olihiekansekaisella savella täytetyt o<strong>ja</strong>t, joiden poh<strong>ja</strong>llaoli jonkin verran hiiltynyttä puuta <strong>ja</strong> kiviä. Rakennuksensisäpuolen kaakkoiskulmassa oli 1,4 x 1,8metriä laa<strong>ja</strong> poh<strong>ja</strong>kaavaltaan u-muotoinen uuninpoh<strong>ja</strong>. Rakennuksesta löydettiin mm. jääkenkä,naulo<strong>ja</strong>, veitsi, luuta <strong>ja</strong> palanutta savea. Esineet eivätajoittaneet rakennusta.Kuva 16.3Yleiskartta Gubbackanrakenteista.Puhtaaksipiirto:P. Hakanpää /MuseovirastoUuniRakennustenkivi<strong>ja</strong>lko<strong>ja</strong> tainiiden osiaVUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö151


Kuva 16.4Kaivausalueelta 1esiin tullut uunin poh<strong>ja</strong>.Kuva: V.-P. Suhonen /MuseovirastoKuva 16.5Punasavikeramiikkaa.Kuva: S.Tirilä /MuseovirastoKaivausalueen 1 koilliskulmasta tuli esille poh<strong>ja</strong>kaavaltaansuorakaiteenmuotoinen, isojen kulmakivienra<strong>ja</strong>ama noin 6,5 x 4,5 metriä laa<strong>ja</strong> kiviröykkiö.Tutkimusten edetessä selvisi, että kyseessä olirakennuksen länsipääty, johon kuuluivat noin 2 x 2metriä laa<strong>ja</strong> uunin poh<strong>ja</strong> <strong>ja</strong> 2,6 x 1,6 metriä laa<strong>ja</strong>kellarikuoppa. Rakennuksesta löytyi mm. naulo<strong>ja</strong>,veitsi <strong>ja</strong> punasavikeramiikka-astioiden kappaleita.Rakennus ajoittuu punasavikeramiikan perusteella1400- <strong>ja</strong> 1500-luvuille.Kaivausalue 2Kaivausalueen 1 pohjoispuolisella rinteellä si<strong>ja</strong>inneelleterassille avattiin 242 m² laa<strong>ja</strong> kaivausalue 2.Myös kaivausalueella 2 oli kaksi vierekkäistä rakennusta.Läntisemmästä rakennuksesta saatiin esillenoin 6 x 4 metriä laa<strong>ja</strong> itäosa. Etelässä <strong>ja</strong> kaakossaoli perustus, joka oli tehty siten, että isojen kivienväleihin oli asetettu pienempiä kiviä <strong>ja</strong> savea. Muuallanäkyi ainoastaan yksittäisiä kivi<strong>ja</strong>lkakiviä siellätäällä. Rakennuksen koilliskulmasta pal<strong>ja</strong>stui noin2 x 2 metriä laa<strong>ja</strong> uunin poh<strong>ja</strong>. Uunista oli jäljelläidässä, pohjoisessa <strong>ja</strong> lännessä noin puolen metrinkorkuiset harmaakivistä laastia <strong>ja</strong> savea sideaineenakäyttäen ladotut seinät. Uunin suuaukon puolellaetelässä oli seinän si<strong>ja</strong>sta kolme suurta kiveä. Uunioli täynnä kiviä. Kiviä poistettaessa löytyi naula,luuta, suomu<strong>ja</strong>, kotilon kuoria <strong>ja</strong> palanutta savea.Uunin seinän vierellä oli idässä <strong>ja</strong> pohjoisessa0,3– 0,5 metriä leveä <strong>ja</strong> 0,1– 0,2 metriä paksu puutaso.Uunin länsi- <strong>ja</strong> eteläpuolella havaittiin puutasonsi<strong>ja</strong>sta pystypaalujen jäännöksiä. Rakennuksestalöytyi mm. veitsi, keihäänkärki, hela, naulo<strong>ja</strong>,hevosenkengän naulo<strong>ja</strong>, tuluspiitä, luuta, palanuttaluuta, palanutta savea, luinen arpakuutio, punasavikeramiikka<strong>ja</strong> raho<strong>ja</strong>. Rahat <strong>ja</strong> punasavikeramiikkaajoittavat rakennuksen 1500-luvulle.152 VUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kuva 16.6Kaivausalueelta 2esiin tullut uunin poh<strong>ja</strong>.Kuva: V.-P. Suhonen /MuseovirastoKaivausalueen 2 itäosasta tuli esille noin 8 x 5metriä laa<strong>ja</strong> rakennuksen poh<strong>ja</strong>. Rakennuksen kahdeksanmetriä pitkä pohjoisseinän perustus <strong>ja</strong>kaantuiidässä olevaan matalaan viisi metriä pitkään maavalliin<strong>ja</strong> lännessä olevaan täytehiekan päälle tehtyynkolme metriä pitkään kivi<strong>ja</strong>lkaan. Länsipuolella seitsemänmetriä pitkä kivi<strong>ja</strong>lka teki ”mutkan” johtuenrakennuksen sisäpuolen kaakkoisnurkassa olleestaKuva 16.7Noppa <strong>ja</strong> 1500-luvunraha. Kuva: S. Tirilä /Museovirastouunista. Kivi<strong>ja</strong>lka sekoittui etelässä <strong>ja</strong> idässä uuninseinän rakenteisiin.Rakennuksen uuni oli perustettu rinteelle täytemaastakootulle terassille. Uunin keskuksena oliisoista kivistä muodostunut noin kaksi metriä halkaisi<strong>ja</strong>ltaanollut poh<strong>ja</strong>kaavaltaan soikea kehä.Uunin seinästä oli pohjoisessa <strong>ja</strong> lännessä jäljellämetrinkorkuiset osat. Etelässä <strong>ja</strong> idässä oli sen si<strong>ja</strong>antallella vain seinien poh<strong>ja</strong>t. Uunin seinät oli tehtyeräänlaiseksi arkkurakenteeksi. Seinän ulkopinnansisäpuolella oli enemmän maata kuin kiviä. Seinänedustalla oli puita sitomassa maata paikoilleen. Kivi-Kuva 16.8Keskiaikaistakivisavikeramiikkaa.Kuva: S. Tirilä /MuseovirastoVUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö153


Kuva 16.9Ongenkoukku.Kuva: S. Tirilä /Museovirasto<strong>ja</strong>lan ulkopuolella oli jäännöksiä sekä seinänsuuntaisistaettä seinästä ulospäin pistäneistä puista.Uunin <strong>ja</strong> rakennuksen lounais- <strong>ja</strong> pohjoisseinienväliin jäi noin 2,5 x 4 metriä laa<strong>ja</strong> sisätila. Kaivaustenedetessä selvisi paikalla olevan täytehiekkaanasetettu<strong>ja</strong> kiviä, joiden päällä oli puulattian jäännöksiä.Rakennuksesta <strong>ja</strong> uunista saatiin löytöinämm. ikkunalasia, lasipikarin pala, palanutta savea,naulo<strong>ja</strong>, tuluspiitä, luuta, palanutta luuta, punasavikeramiikkaa<strong>ja</strong> kivisavikeramiikkapala. Keramiikka<strong>ja</strong> lasipikari ajoittavat rakennuksen 1400- tai 1500-luvuille.Kaivausalue 3Kaivausalueen 2 vierelle itään avattiin 121 m² laa<strong>ja</strong>kaivausalue 3. Tutkimusten aikana selvisi, että myöskaivausalueella 3 oli jäännöksiä ainakin kahdestarakennuksesta.Kaivausalueen luoteisnurkasta tulivat esille noin1,5 <strong>ja</strong> 2 metriä pitkät toisiinsa nähden suorassa kulmassaolleet kivilin<strong>ja</strong>t. Kyseessä oli pääosin kaivausalueenulkopuolelle jääneen rakennuksen kivi<strong>ja</strong>lankaakkoiskulma. Paikalta löytyi mm. naulo<strong>ja</strong>,tuluspiitä, kuonaa, palanutta luuta <strong>ja</strong> palanutta savea.Joukossa ei ollut yhtään ajoittavaa löytöä.Kaivausalueen keskellä oli rinteelle tuodullekivestä <strong>ja</strong> maasta koostuneelle terassille perustettu10 x 4 metriä laa<strong>ja</strong> rakennus. Rakennukseen kuuluneesta2 x 2 metriä laa<strong>ja</strong>sta uunista oli jäljellä vainpoh<strong>ja</strong>osa. Uunin neliömäistä keskustaa reunustivatpoh<strong>ja</strong>maan päälle asetetut isot kivet, joiden väleissäoli pienempiä kiviä <strong>ja</strong> huonokuntoisen tiiliseinänjäännöksiä. Uunin perustukseen liittyneestä puurakenteestanäkyi muistona poh<strong>ja</strong>maassa ollut nelikulmainenhiilikehä. Uunin kohdalta löytyi mm.lukko, veitsi, tuluspiitä, ikkunalasia, luuta, palanuttasavea <strong>ja</strong> kuonaa.Rakennuksen ladotusta kivi<strong>ja</strong>lasta oli tallella vainkatkelmia. Kivi<strong>ja</strong>lka oli jonkinlainen arkkurakenne,sillä sen laidoilla oli isompia kiviä kuin keskellä.Rakennuksesta <strong>ja</strong> uunista löydettiin mm. lukko,veitsi, naulo<strong>ja</strong>, kirves, hevosenkengän katkelma,vyösolki, pora, tuluspiitä, luuta, kuonaa, palanuttasavea <strong>ja</strong> 1500-luvulle sijoittuvaa punasavikeramiikkaa.Kaivausalue 4Kaivausalueen itäpuolelle avattiin 273 m² laa<strong>ja</strong> kaivausalue4. Kaivausalueen 4 eteläosan länsipuoleltapal<strong>ja</strong>stui noin 3 x 4 metriä laa<strong>ja</strong> rakennuksen poh<strong>ja</strong>.Rakennus <strong>ja</strong>tkui länteen kaivausalueen 3 puolelle <strong>ja</strong>liittyi jollakin tapaa siellä olleeseen rakennukseen.Rakennuksen alueelta löydettiin naulo<strong>ja</strong>, punasavikeramiikkaa,tuluspiitä, kuonaa, luuta <strong>ja</strong> palanuttasavea. Punasavikeramiikkapala saattaa olla jokokeskiaikainen tai hiukan nuorempi.Kaivausalueen kaakkoiskulmasta pal<strong>ja</strong>stui noin5 x 3 metriä laa<strong>ja</strong> poh<strong>ja</strong>kaavaltaan suorakaiteenmuotoinenpienistä kivistä koostunut tasainen kiveys.Hiekassa oli kiviä päällekkäin kolmesta neljäänkerrosta. Kiveys ulottui pohjoisessa poh<strong>ja</strong>maahansaakka. Kiveyksen länsipuolella näkyneellä noin0,5 x 0,5 metriä laa<strong>ja</strong>lla alueella oli ympäristöäänvähemmän kiviä. Kyseessä saattoi olla yksinkertaisenuunin/lieden paikka.Kiveyksen kohdalta löytyi luuta, naulo<strong>ja</strong>, hevosenkengännaulo<strong>ja</strong>, veitsi, luuta, palanutta savea <strong>ja</strong>punasavikeramiikkaa. Yksi punasavikeramiikkapalaajoittuu ilmeisesti 1500-luvulle.Koeo<strong>ja</strong>tGubbackan kaivausalueiden lähiympäristöön tehtyjenkoeojien kohdalle osui jäännöksiä maakuoppauunista,vanhasta tiestä <strong>ja</strong> kolmesta rakennuksesta.Maakuoppauunissa on ilmeisesti poltettu joko kalkkiatai tiiliä.154 VUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


16.4 Arkeologisten tutkimusten tuloksetPorvarinlahden kalkkiuuni ajoittuu joko 1700-luvulletai 1800-luvun alkuun. Kalkkiuunin arkeologisentutkimuksen tärkein tulos oli uunityypin tunnistaminen.Ilman kaivauksia ei olisi voitu olla varmo<strong>ja</strong>edes siitä, että kyseessä oli kalkkiuuni. Aiemminpelkästään historiallisista lähteistä tunnetusta Porvarinlahdenkalkkiteollisuudesta saatiin ensimmäisenkerran konkreettista, käsikosketeltavaa tietoa.Gubbackan autiotontin itäosa näyttää kuuluneen1400- <strong>ja</strong> 1500-luvuille ajoittuvaan ryhmäkylään.Kenttätöiden yhteydessä ei havaittu merkkejä vanhemmastatai nuoremmasta rakennustoiminnasta.Gubbackan vanhempi asutus on saattanut si<strong>ja</strong>italännessä eritasoliittymän työmaa-alueen ulkopuolella.Kaivaukset eivät ratkaisseet Gubbackan autioitumisensyytä. Sen si<strong>ja</strong>an on jokseenkin varmaa,että kylästä luopuminen sijoittuu 1500-luvun jälkipuoliskolle.L ä h t e e t j a k i r j a l l i s u u sArkistolähteet, Kansallisarkisto1. Broterus, Samuel 1708. Geometrisk Carta och Afritninguppå Heickbacka by i Bårgo herad, Sibbo S: och HelsingKyrckiogiäll afmät åhr 1708. (Maanmittauskonsepti KA,MMA Helsinki.)2. Westermark, Nils 1764. Wästersundom bys åkrar ochängar i Sibbo sokn, Borgo härad och Nylands län. Affmätår 1764 af Nils Westermark. MMH B11b 7/3.3. Suomen asutuksen yleisluettelo4. Voudintilit. Uusimaa 1540, Porvoon lääni KA 2920; 1543,KA 2936; 1577, KA 3372.Arkistolähteet, Museovirasto, Rakennushistorian osastonarkisto5. Suhonen, V.-P. 2002. Arkeologiset tutkimukset VantaanPorvarinlahdella vuonna 2002.6. Suhonen, V.-P. 2002. Vantaan Länsisalmen kylän autiotontit,inventointi <strong>ja</strong> koekartoitus.7. Suhonen, V.-P. 2004. Vantaan Länsisalmen Gubbackanautiotontin arkeologiset tutkimukset vuonna 2003.Painetut lähteet8. Finlands medeltidsurkunder I. – 1400. Samlade och itryck utgifna af Finlands Statsarkiv genom Reinh. Hausen.Helsingfors 1910.9. Rudenschöld, Ulrik. Kertomus taloudellisista ym. oloistaSuomessa 1738–1741. Todistuskappaleita Suomen historiaanVI. Helsinki 1892.Kir<strong>ja</strong>llisuus10. Eskola P, Hackman V, Laitakari A & Wilkman, W.W.1919: Suomen kalkkikivi. Suomen geologinen toimisto,geoteknisiä tiedonanto<strong>ja</strong> 21.11. Ericsson, Ernst 1939: Det fasta försvaret i Finland.Kungl. fortifikationens historia IV, 10. Stockholm.12. Hagelstam, Magnus 1930: Westerkulla, Herrgårdar i FinlandI. Helsingfors.13. Holmberg, H. J. 1858: Materialier till Finlands Geognosi.Bidrag till natur Finlands naturkännedom, etnografi ochstatistik, IV. Helsingfors.14. Kepsu, Saulo 2005: Uuteen maahan, <strong>Helsingin</strong> <strong>ja</strong> Vantaanvanha asutus. Suomen kir<strong>ja</strong>llisuuden seuran toimituksia1027. Helsinki.15. Kuisma, Markku 1990: <strong>Helsingin</strong> pitäjän historia II, vanhan<strong>Helsingin</strong> synnystä Isoonvihaan 1550–1713. Jyväskylä.16. Kuokkanen, Rauno 1981: Suomen tiiliteollisuuden historia.1 osa , tiilen lyönti <strong>ja</strong> käyttö ristiretkia<strong>ja</strong>lta 1850-luvulle. Helsinki.17. Pargas Kalkbergs Aktiebolag 1898–1948. Pargas 1951.18. Saltikoff B, Laitakari I, Kinnunen K.A. <strong>ja</strong> Oivanen P. 1994:<strong>Helsingin</strong> seudun vanhat kaivokset <strong>ja</strong> louhokset. Geologiantutkimuskeskus, opas 35. Espoo.19. Talve, Ilmari 1965: Suomen kansanomaisesta kalkinpoltosta.Sanan<strong>ja</strong>lka 7.VUOSAAREN SATAMAHANKE JA ARKEOLOGISET TUTKIMUKSET<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö155


17Yhteenveto <strong>Vuosaaren</strong> <strong>satama</strong>hankkeenpäätöksistä <strong>ja</strong> lupamenettelyistä<strong>Vuosaaren</strong> alue liitettiin <strong>Helsingin</strong> kaupunkiinvuonna 1966. Perusteluina olivat tällöin erityisesti<strong>Helsingin</strong> energianhuollon <strong>ja</strong> <strong>satama</strong>n tulevat tarpeet.Vuonna 1992 <strong>Vuosaaren</strong> <strong>satama</strong>hanke sai likipitäennykyisen muotonsa, kun <strong>Helsingin</strong> kaupunginvaltuustohyväksyi Yleiskaava 1992:n. Kaavassanykyiset tavara<strong>satama</strong>-alueet varattiin pääasiassaasumiseen <strong>ja</strong> Vuosaaresta entisen telakan alueeltavarattiin tilaa uudelle kappaletavara<strong>satama</strong>-alueelle.<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointimenettely käynnistyi vuonna 1994heti uuden ympäristövaikutusten arviointimenettelystä(YVA) annetun lain (469/1994) tultua voimaan.YVA-menettelyn arviointiselostuksesta muodostui<strong>ja</strong>tkossa poh<strong>ja</strong> <strong>satama</strong>hankkeen lupa- <strong>ja</strong> päätösprosessille.YVA-menettelyn jälkeen suunnittelu liittyi kiinteästiseutukaavan laadintaan. <strong>Helsingin</strong> kaupunginvaltuustohyväksyi vuonna 1996 <strong>Vuosaaren</strong> <strong>satama</strong>nperustamissuunnitelman <strong>ja</strong> päätti alueen asemakaavanlaatimisesta. <strong>Satama</strong>-alueen <strong>ja</strong> siihen liittyvienliikenneyhteyksien suunnittelua tehtiin rinnankaavoituksen kanssa. Varsinaiset liikenneväylien<strong>ja</strong> <strong>satama</strong>-alueen yksityiskohtaiseen suunnitteluun<strong>ja</strong> toteutukseen liittyneet päätökset oli mahdollistatehdä vasta, kun korkein hallinto-oikeus (KHO) hylkäsikesäkuussa 2002 alueen seutukaavaan <strong>ja</strong> asemakaavaankohdistuneet valitukset.<strong>Vuosaaren</strong> <strong>satama</strong>hanketta koskevat käsittelyt,päätökset <strong>ja</strong> lupamenettelyt ovat kokonaisuutena tarkastellenkuvaava esimerkki monentasoisista haasteista<strong>ja</strong> tavoitteista, joita ympäristölainsäädäntöasettaa suurten infrastruktuurihankkeiden toteuttamiselle.Ensimmäinen taulukkomuotoon koottu versiolaa<strong>ja</strong>sta lupa- <strong>ja</strong> päätösprosessikokonaisuudestatehtiin hankekokonaisuuden lupa-asioiden hallinnoimistavarten. Taulukkoa on myös käytetty esimerkkinä,kun eri tahot ovat esittäneet näkemyksiääninfrahankkeita koskevan lainsäädännön kehittämiseksi.Hankkeeseen liittyvissä lupaprosesseissa onsovellettu kattavasti laa<strong>ja</strong>a ympäristölainsäädäntöämme,sillä rakentamista tapahtui maa- <strong>ja</strong> vesialueellasekä tunneleissa <strong>ja</strong> hankealueen läheisyydessäsi<strong>ja</strong>itsee Natura 2000 -alueita. Monessa lupapäätöksessäon myös ollut kyse pilottiratkaisusta. Hankkeessaon käytetty uusia teknisiä ratkaisu<strong>ja</strong>, jotkaovat olleet ensimmäistä kertaa lupaharkinnan kohteenakuten tributyylitinapitoisten massojen ruoppaaminensuo<strong>ja</strong>rakenteen sisällä <strong>ja</strong> näiden massojenstabilointi <strong>satama</strong>rakenteisiin.Hankkeen suunnittelun aikana tulivat voimaanedellä mainitun ympäristövaikutusten arvioinnistaannetun lain lisäksi muun muassa maankäyttö- <strong>ja</strong>rakennuslaki (132/1999), ympäristönsuojelulaki(86/2000) <strong>ja</strong> luonnonsuojelulaki (1096/1996). Suunnittelunaikana tuli voimaan myös valtioneuvostonpäätös valtakunnallisista alueidenkäyttötavoitteista(VNp 30. 11. 2001). Yleisistä teistä annettuun lakiin(243/1954) lisättiin yleissuunnitelman laillisuuttakoskeva muutos (342/1998) <strong>ja</strong> muutos, joka edellytti,että tien suunnittelun perustana tulee olla alueenkaavoitus (133/1999).Maankäyttö- <strong>ja</strong> rakennuslain siirtymäsäännöstenperusteella <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksiä käsitteleväänseutukaavaan <strong>ja</strong> <strong>satama</strong>-alueen asemakaavaanon sovellettu aiempaa rakennuslakia (370/1958).Päätöksissä <strong>ja</strong> hankkeen ympäristöasioita selvitettäessäon sovellettu edellä mainittujen lakien lisäksivesilakia (264/1961) <strong>ja</strong> muita ympäristöä koskeviasäännöksiä, määräyksiä <strong>ja</strong> ohjeita.Vuosaari liitettiin <strong>Helsingin</strong> kaupunkiin <strong>satama</strong>tarpeidentakia 42 vuotta ennen <strong>satama</strong>n käyttöönottoa.Hankkeen ympäristövaikutusten arviointimenettelynkäynnistymisen <strong>ja</strong> <strong>satama</strong>n valmistumisenvälillä on aikaa 14 vuotta. Hankkeen suurikoko, monet valitukset <strong>ja</strong> uusien lakien soveltaminenvaikuttivat hankkeen suunnittelun <strong>ja</strong> käsittelyjenkestoon. Erityisen haastavaksi hanketta koskevassapäätöksenteossa muodostuivat <strong>satama</strong>n vaikutuksetlähellä si<strong>ja</strong>itsevaan Natura 2000 -alueeseen.Tässä luvussa oleviin taulukoihin 17. 1–17. 4 onkoottu <strong>Vuosaaren</strong> <strong>ja</strong> sen liikenneyhteyksien suunnittelun<strong>ja</strong> rakentamisen kannalta keskeiset päätökset<strong>ja</strong> luvat. Taulukoissa on esitetty päätösmenettelynkesto, valitustie <strong>ja</strong> päätöksen keskeinen sisältö <strong>ja</strong>sen merkitys hankkeen toteuttamisen kannalta sekämahdolliset prosessiin liittyneet erityispiirteet. Tau-156 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


K i r j o i t ta j aRiitta Rämä, varatuomari, asiana<strong>ja</strong><strong>ja</strong>, toimii ympäristöoikeuteenerikoistuneessa Asianajotoimisto Naturata Oy:ssä. Hän on toiminutvuosia erilaisten infrastruktuurihankkeiden oikeudellisena asiantunti<strong>ja</strong>na<strong>ja</strong> ollut mukana <strong>Vuosaaren</strong> <strong>satama</strong>n väyläprojektissa vuodesta 1999alkaen <strong>ja</strong> <strong>Vuosaaren</strong> <strong>satama</strong>hankkeessa vuosina 2003–2006.lukkoa on pyritty lyhentämään jättämällä siitä poisseuraavat yksittäisiin suppea-alaisiin hankkeisiinkohdistuvat lupa- <strong>ja</strong> ilmoitusasiat:• Maankäyttö- <strong>ja</strong> rakennuslain no<strong>ja</strong>lla myönnetytrakennus- <strong>ja</strong> toimenpideluvat, joita on haettuyksittäisiin rakennuskohteisiin, joita on <strong>satama</strong>alueellalukuisia.• <strong>Satama</strong>n maaliikenneyhteyksille maankäyttö- <strong>ja</strong>rakennuslain no<strong>ja</strong>lla myönnetyt maisematyö-,rakennus- <strong>ja</strong> toimenpideluvat, joita on haettuyksittäisiin kohteisiin noin 20.• TBT-pitoisten massojen ruoppaamista koskevatlupa-asiat, jotka koskevat yksittäisiä <strong>ja</strong> pienempiäruoppausalueita-/toimenpiteitä. Asioita onyhteensä noin 10.• Ympäristönsuojelulain no<strong>ja</strong>lla annetut ratkaisutmeluilmoituksiin, joita jätettiin käsiteltäväksihankkeen toteuttamisen eri vaiheissa kymmeniä.• Keravan <strong>ja</strong> Vantaan tekemät asemakaavapäätökset,jotka ovat koskeneet tunnelin, ajotunneleiden<strong>ja</strong> pystykuilujen merkitsemistä kaavoihin. Kaavaasioitaon ollut alle kymmenen kappaletta. Ratalin<strong>ja</strong>vaikuttaa myös tulevaisuudessa sen läheisyydessäolevaan asemakaavoitukseen siten, ettärautatietunnelin välittömään läheisyyteen ei sallitaesim. porakaivojen <strong>ja</strong> maalämpöputkien asentamista.Myös talojen perustamistavalle saatetaanasettaa erityismääräyksiä riippuen alueen maaperäolosuhteista.Taulukkoihin on kir<strong>ja</strong>ttu päätöksiä <strong>ja</strong> lupa-asioitayhteensä lähes 40 kpl. Lähes kaikista keskeisistäpäätöksistä on valitettu ensin hallinto-oikeuteen <strong>ja</strong>edelleen korkeimpaan hallinto-oikeuteen. Suurin osaasioista on ratkaistu ympäristönsuojelu- tai vesilainno<strong>ja</strong>lla, jolloin päätöksistä on valitettu ensin Vaasanhallinto-oikeuteen (VHAO) <strong>ja</strong> sieltä edelleenkorkeimpaan hallinto-oikeuteen (KHO). Ministeriöidentekemistä päätöksistä on valitettu suoraanKHO:een.Korkein hallinto-oikeus on ratkaissut kesäkuun2008 loppuun mennessä yhteensä 24 asiaa, jotkaovat koskeneet <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksienrakentamista. Valitusten yleisin käsittelyaikaensimmäisen asteen päätöksestä korkeimmanoikeusasteen lainvoimaiseen päätökseen olikeskimäärin puolestatoista vuodesta kahteen vuoteen.Nopeimmat valitusprosessit käytiin läpi noinvuodessa <strong>ja</strong> enimmillään valitusprosessien käsittelykesti jopa yli neljä vuotta.Kokonaisuutena arvioiden lupaprosesseista voidaantehdä seuraavat keskeiset havainnot:• Samo<strong>ja</strong> valitusperusteita käsiteltiin useissa prosesseissa<strong>ja</strong> monta kertaa eri oikeusasteissa.Samojen valitusperusteiden käsittely vaati huomattavanmäärän viranomaisresursse<strong>ja</strong>.• Valitta<strong>ja</strong>tahot olivat pääsääntöisesti samo<strong>ja</strong> suurimmassaosassa valitusprosesse<strong>ja</strong>.• Työt <strong>satama</strong>ssa ovat edenneet töidenaloituslupienperusteella valituksista riippumatta, koska työton useimmissa tapauksissa voitu aloittaa valituksistahuolimatta. Valitukset eivät siten suoranaisestiviivyttäneet hankkeen toteuttamista.• Suunnittelu eteni myös eri tasoilla kaavojen vahvistustilanteesta<strong>ja</strong> päätösprosessien vaiheistariippumatta. Tähän sisältyi turhan suunnittelunriski, joka ei toteutunut.• <strong>Satama</strong>n rakennustyöt <strong>ja</strong> yksityiskohtainen suunnittelu<strong>ja</strong> päätökset luvista käynnistyivät, kunKHO hylkäsi seutukaavasta <strong>ja</strong> asemakaavasta tehdytvalitukset.Taulukoissa 17. 1–17. 4 on esitetty ensin <strong>satama</strong>a taikoko <strong>satama</strong>hanketta koskevat päätökset <strong>ja</strong> sitten liikenneyhteyksiäkoskevat päätökset. Taulukossa 17.5on esitetty yhteenvetona <strong>Vuosaaren</strong> <strong>satama</strong>a koskevattärkeimmät suunnittelu- <strong>ja</strong> toteutusvaiheet.YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö157


Taulukko 17.1<strong>Satama</strong>-alueen maankäyttöä<strong>ja</strong> liikenneyhteyksiensijoittamistakoskevat päätöksetLupa-/päätösprosessiTaa<strong>ja</strong>maseutukaava- valmistelu alkoi 1988- lainvoimaiseksi 1997Päätökset:Seutukaavaliiton liittovaltuusto 15. 12. 1992YM 18. 6. 1996KHO 8. 7. 1997Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaTaa<strong>ja</strong>maseutukaava koski koko <strong>Helsingin</strong> seutukaavaliiton aluetta.Siinä oli esitetty <strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> sen liikenneyhteydet.Tavaraliikennettä palvelevat vanhat <strong>satama</strong>-alueet Jätkäsaaressa<strong>ja</strong> Sompasaaressa osoitettiin taa<strong>ja</strong>matoimintojen alueeksi.Ympäristöministeriö jätti vahvistamatta seutukaavanmm. <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> sen maaliikenneyhteyksien osalta.KHO kumosi liittovaltuuston <strong>ja</strong> ministeriön päätökset <strong>Vuosaaren</strong><strong>satama</strong>lle tarkoitetun liikennealuevarauksen osalta <strong>ja</strong> palautti asianUudenmaan liiton maakuntahallitukselle uudelleen käsiteltäväksi.Jätkäsaaren <strong>ja</strong> Sompasaaren aluevaraukset jäivät voimaan.<strong>Helsingin</strong> Yleiskaava 1992- vireille 1990- lainvoimaiseksi 1996Päätökset:<strong>Helsingin</strong> Kvsto 9. 12. 1996YM 1. 10. 1996Tavara<strong>satama</strong>toiminnot keskitettiin kaavassa Vuosaareen, jolloinJätkä- <strong>ja</strong> Sompasaaren tavaraliikenne<strong>satama</strong>-alueet muutetaanasuinalueiksi.Yleiskaavaa ei ole vahvistettu, joten sillä ei ole rakennuslain mukaistaoikeudellisesti oh<strong>ja</strong>avaa vaikutusta.Kaavaa varten tehdyt selvitykset <strong>ja</strong> suunnitelmat ovat toimineetperusteluna myöhemmin asemakaavoitetun <strong>satama</strong>-alueenlaajuudelle <strong>ja</strong> kaavaratkaisuille.YM kumosi kaavan <strong>satama</strong>an johtavien liikenneväylien osalta,koska kaavan mukaan väylät olisi voitu toteuttaa myös maanpäällisinäratkaisuina, joka olisi ollut ympäristön kannalta haitallista.<strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä koskeva seutukaava- Valmistelu alkoi, kun KHO palauttitaa<strong>ja</strong>maseutukaavan <strong>Vuosaaren</strong> <strong>satama</strong>n<strong>ja</strong> sen liikenneyhteyksien osaltaUudenmaan liitolle 1997- lainvoimaiseksi 2002Päätökset:Uudenmaan liitto 28. 12. 1999YM 24. 1. 2002KHO 26. 6. 2002<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristön asemakaava- vireille 1996- lainvoimaiseksi 2002Päätökset:Hgin Kvsto 8. 12. 1999YM 25. 1. 2002KHO 26. 6. 2002Seutukaava koski vain <strong>Vuosaaren</strong> <strong>satama</strong>a <strong>ja</strong> sen liikenneyhteyksiä.Seutukaava oli perustana useassa myöhemmin annetussa <strong>Vuosaaren</strong><strong>satama</strong>a koskevassa asiassa.Kaavan vahvistaminen mahdollisti <strong>satama</strong>hankkeen <strong>ja</strong>tkosuunnittelun<strong>ja</strong> myöhemmin tehtyjen yksityiskohtaisempien suunnitelmienhyväksymisen.Päätöksen antamisen yhteydessä KHO arvioi ensimmäisen kerran<strong>satama</strong>n vaikutuksia <strong>satama</strong>n läheisyydessä si<strong>ja</strong>itsevan Natura-alueenluonnonarvoihin. KHO:n päätöksen mukaan hanke ei heikentäisimerkittävästi Natura-alueen perustamisen poh<strong>ja</strong>na olleita luonnonarvo<strong>ja</strong>.Päätöksestä valittivat mm. eri asukas- <strong>ja</strong> luontojärjestöt <strong>ja</strong> alueenyksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin.<strong>Satama</strong>n asemakaavassa määriteltiin <strong>satama</strong>n <strong>ja</strong> sen liikenneyhteyksiensijoittuminen (<strong>Helsingin</strong> alueella) sekä <strong>satama</strong>n viereistenalueiden maankäyttö yksityiskohtaisesti.Asemakaava on yhdessä seutukaavan kanssa <strong>satama</strong>a koskevienmonien muiden lupien perusta.KHO ratkaisi asian samassa yhteydessä seutukaavan kanssa <strong>ja</strong> viittasiasemakaavapäätöksessä seutukaavasta antamaansa päätökseen.Päätöksestä valittivat pääasiassa samat tahot kuin seutukaavasta.Valitukset hylättiin.158 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Lupa-/päätösprosessiKaakkois-Vantaan osayleiskaava- vireille 1995- lainvoimaiseksi 2004Päätökset:Vantaan Kvsto 17. 6. 2002<strong>Helsingin</strong> HAO 11. 6. 2003KHO 3. 3. 2004Valtakunnalliset alueidenkäyttötavoitteet- vireille 1999- lainvoimaiseksi 2001Päätökset:Valtioneuvosto 30. 11. 2000KHO 26. 11. 2001Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaOsayleiskaavaan merkittiin Vantaan alueelle sijoittuvat tie- <strong>ja</strong> rautatieyhteydet.Osayleiskaava perustui seutukaavaan, jota koskevatpäätökset oli jo aiemmin tehty. Osayleiskaavalla ei siten ollut yksinäänratkaisevaa merkitystä esim. rakentamisen aloittamisen kannalta.<strong>Vuosaaren</strong> <strong>satama</strong>n osalta päätöksestä valittivat alueen yksityisetmaanomista<strong>ja</strong>t.<strong>Satama</strong>n liikenneyhteyksien rakentamista koskevat valitukset hylättiin.<strong>Vuosaaren</strong> <strong>satama</strong>a koskevalta osin KHO viittasi seutukaavasta tekemäänsäpäätökseen.Valtakunnallisten alueidenkäyttötavoitteiden mukaan alueidenkäytönsuunnittelussa tulee varautua <strong>Vuosaaren</strong> <strong>satama</strong>an. Päätökselläei ollut välitöntä vaikutusta <strong>satama</strong>n rakentamisen kannalta, muttaalueidenkäyttötavoitteissa vahvistettiin <strong>Vuosaaren</strong> <strong>satama</strong>n merkitysalueiden käytön suunnittelussa erityisesti <strong>Helsingin</strong> seudulla.Päätöksestä valittivat yksityiset <strong>satama</strong>n lähialueen maanomista<strong>ja</strong>t <strong>ja</strong>luontojärjestö.Valitukset jätettiin tutkimatta, koska päätös ei välittömästi vaikuttanutvalittajien oikeuteen, velvollisuuteen tai etuun.Natura 2000 -verkostoehdotus/Natura-alueen ra<strong>ja</strong>usta koskeva päätös- ensimmäisen kerran nähtävillä 1997- lainvoimaiseksi 2000Päätökset:VN 20. 8. 1998KHO 14. 6. 2000Poikkeus Natura-alueen heikentämiskiellosta- vireille 1999- lainvoimaiseksi 2000Päätökset:VN 2. 12. 1999KHO 20. 12. 2000Natura-alueiden vahvistamisen yhteydessä määriteltiin myös ne luontoarvot,jotka olivat alueiden Natura 2000 -verkostoon sisällyttämisenperustana.Päätöksestä valittivat luontojärjestö <strong>ja</strong> yksityiset maanomista<strong>ja</strong>t.KHO hylkäsi valitukset em. Natura-alueen osalta <strong>ja</strong> ehdotus pidettiin<strong>Vuosaaren</strong> lähialueiden Natura-alueiden osalta sellaisenaan voimassa.Uudenmaan liitto pyysi valtioneuvostolta seutukaavan hyväksymiseksilupaa poiketa luonnonsuojelulain 66 §:n mukaista Natura-alueenluontoarvojen heikentämisestä koskevasta kiellosta.UUS oli antamassaan lausunnossa todennut <strong>satama</strong>hankkeen heikentävänmerkittävästi Natura-luontoarvo<strong>ja</strong>.Valtioneuvosto päätti, ettei <strong>Vuosaaren</strong> <strong>satama</strong>n seutukaavaehdotusheikennä merkittävästi Natura-alueen luontoarvo<strong>ja</strong> <strong>ja</strong> Uudenmaanliiton hakemus luonnonsuojelulain 66 §:n mukaisen päätöksen tekemisestähylättiin tarpeettomana.KHO kumosi VN:n päätöksen, koska katsoi, ettei poikkeusmenettelyyntule siirtää luonnonsuojelulain 65 §:n mukaista arviointi- <strong>ja</strong> lausuntomenettelyäeikä lupaviranomaiselle säännönmukaisesti kuuluvaapäätösvaltaa.Päätöksestä valittivat eri asukas- <strong>ja</strong> luontojärjestöt sekä yksityisetmaanomista<strong>ja</strong>t.KHO hylkäsi yksityisten maanomistajien valitukset <strong>ja</strong> jätti tutkimattayhteisöjen tekemät valitukset, koska ne eivät olleet paikallisia tai rekisteröityjäyhdistyksiä.<strong>Satama</strong>n rakentamispäätös- vireille <strong>ja</strong> lainvoimaiseksi 2002Päätökset:<strong>Helsingin</strong> Kvsto 9. 10. 2002(valitustie <strong>Helsingin</strong> HAO -> KHO)<strong>Helsingin</strong> kaupunginvaltuusto teki päätöksen <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamisesta.Päätös antoi <strong>Helsingin</strong> <strong>Satama</strong>lle valtuutuksen aloittaa<strong>Vuosaaren</strong> <strong>satama</strong>n rakentamisen.Päätöksestä ei valitettu.YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö159


Lupa-/päätösprosessiPäätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaKalkkisaaren <strong>ja</strong> Kalkkisaaren vesialueen lunastaminen- asia ensimmäisen kerran vireille 2004<strong>ja</strong> sen käsittely <strong>ja</strong>tkuu osittain vielä tätäkirjoitettaessaPäätökset:- Vesialueen lunastaminen (8,1 ha)YM 8. 9. 2004KHO 7. 2. 2005- Käyttöoikeuden saaminen Varissaarta <strong>ja</strong>Kalkkisaarta ympäröivälle alueelle (1,04ha)LSY 23. 6. 2005,lainvoimainen (valitustie VHAO -> KHO)- Kalkkisaaren lunastaminen:lunastustoimikunta 8. 9. 2004MO 4. 5. 2005KKO 22. 12. 2005- Kalkkisaaren SL-alueen <strong>ja</strong> vesialueenlunastaminen, uusi lupahakemus (YM:ssä käsiteltävänä)Kalkkisaari <strong>ja</strong> sitä ympäröivät vesialueet si<strong>ja</strong>itsevat <strong>Vuosaaren</strong><strong>satama</strong>n välittömässä läheisyydessä. Osa kiinteistön omistajista onvastustanut lunastusta <strong>ja</strong> siksi alueeseen on kohdistunut useita erimenettelyitä. Näitä on kuvattu kutakin omana kohtanaan.<strong>Helsingin</strong> kaupunki haki maa-alueiden lunastamista lunastustoimikunnalta.Lunastustoimikunta myönsi luvan lunastaa V-alueen, muttaVR- <strong>ja</strong> SL-alueiden osalta lunastuksen edellytykset eivät täyttyneet.<strong>Helsingin</strong> kaupunki valitti päätöksestä maaoikeuteen. MO määräsimyös VR-alueen lunastettavaksi. KKO ei myöntänyt asiassa valituslupaa.YM myönsi <strong>Helsingin</strong> kaupungille oikeuden lunastaa 8,1 hehtaarinsuuruinen Kalkkisaaren vesialue. Päätöksestä valitti yksityinen maanomista<strong>ja</strong>.KHO kumosi YM:n päätöksen, koska se katsoi, ettei asiassaoltu esitetty selvitystä siitä, miksi suunnitellut toimenpiteet edellyttäisivätomistusoikeuden siirtämistä <strong>Helsingin</strong> kaupungille.Kalkkisaarta ympäröivä vesialue (1,04) oli jäänyt <strong>satama</strong>a koskevanlupakokonaisuuden ulkopuolelle. <strong>Helsingin</strong> <strong>Satama</strong> haki lupaaalueiden lunastamiseen LSY:ltä, joka myönsi luvan. Päätöksestä eivalitettu.<strong>Helsingin</strong> kaupunki on tehnyt Kalkkisaaren SL-alueen <strong>ja</strong> ympäröivänvesialueen lunastamisesta uuden hakemuksen ympäristöministeriölle,jossa asia on käsiteltävänä. Hakemus perustuu alueesta laadittuunuuteen suunnitelmaan 30. 5. 2006.<strong>Satama</strong>tien tiesuunnitelma- vireille 2000- lainvoimaiseksi 2004Päätökset:LVM 3. 2. 2003KHO 3. 3. 2004<strong>Satama</strong>radan lunastuslupa- vireille 2000- lainvoimaiseksi 2004Päätökset:VN 12. 6. 2003KHO 3. 3. 2004Tiesuunnitelma antoi oikeuden tien rakentamiseen <strong>ja</strong> suunnitelmantoteuttamisen kannalta tarpeellisten maa-alueiden hankkimiseen.Päätöksessä myönnettiin oikeus täytäntöönpanoon muutoksenhaustahuolimatta.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin.Radan lunastuslupa antoi oikeuden radan rakentamisen kannaltatarpeellisten maa-alueiden hankkimiseen.Maiden haltuunotto käynnistettiin ennakkohaltuunottoluvan no<strong>ja</strong>llaennen päätösten tuloa lainvoimaiseksi.Päätöksestä valittivat yksityinen maaomista<strong>ja</strong> <strong>ja</strong> yhtiö.Valitukset hylättiin.160 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Lupa-/päätösprosessi<strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> meriväylän vesilupa- vireille 1997- lainvoimaiseksi 2002Päätökset:Länsi-Suomen vesioikeus 9. 7. 1998VHAO 24. 2. 2000KHO 24. 10. 2002Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaLupapäätös antoi <strong>Helsingin</strong> <strong>Satama</strong>lle <strong>ja</strong> Merenkulkulaitokselleoikeuden rakentaa <strong>satama</strong>n <strong>ja</strong> sinne johtavan meriväylän.Luvassa myönnettiin lisäksi <strong>Helsingin</strong> <strong>Satama</strong>lle lunastusoikeus<strong>satama</strong>an kuuluviin maa- <strong>ja</strong> vesialueisiin.Korvaukset määritetään erillisessä toimitusmenettelyssä.Lupaa töiden aloittamiseen ennen päätöksen lainvoimaisuuttaei myönnetty.Lupaa haettiin myös <strong>satama</strong>n II-vaiheen rakentamiseen,mutta hakemus hylättiin ennenaikaisena.Päätöksestä valittavat lukuisat yksityiset maanomista<strong>ja</strong>t, asukas<strong>ja</strong>luontojärjestöt <strong>ja</strong> Uudenmaan työvoima- <strong>ja</strong> elinkeinokeskus.Valitukset hylättiin.Taulukko 17.2<strong>Satama</strong>hankkeenrakentamisen edellyttämätluvat<strong>Satama</strong>toiminnan ympäristölupa- vireille 1999- lainvoimaiseksi 2004Päätökset:<strong>Helsingin</strong> kaupungin ympäristölautakunta3. 4. 2002VHAO 24. 4. 2003KHO 7. 4. 2004Päätöksessä annettiin lupa <strong>satama</strong>n <strong>ja</strong> sen edellyttämien <strong>ja</strong> siihenliittyvien laitosten, rakennelmien <strong>ja</strong> varastojen sijoittamiselle<strong>ja</strong> käyttämiselle Vuosaaressa.Päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin pääosin, ainoastaan <strong>satama</strong>toiminnanaiheuttamaa melua koskevaa lupamääräystä tarkennettiin(seuranta <strong>ja</strong> meluselvityksen laadinta).Lupaan liittyy myös hallintopakkoasia (ks. kohta 17.4).<strong>Satama</strong>n II-vaiheen vesilain mukainen hakemus- vireille 2005- lainvoimaiseksi 2008Päätökset:LSY 5. 6. 2006VHAO 4. 5. 2007KHO 20. 2. 2008Päätöksellä <strong>Helsingin</strong> <strong>Satama</strong>lle myönnettiin oikeus<strong>Vuosaaren</strong> <strong>satama</strong>n laajennusosan eli ns. II-vaiheen rakentamiseen<strong>ja</strong> toteuttamiseen.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta.Valitukset hylättiin.Suo<strong>ja</strong>penkereen rakentaminen <strong>ja</strong> siitä syntyvien TBT -pitoisten massojen läjittäminen (vesilain mukainen lupa)- vireille 2004- lainvoimaiseksi 2005Päätökset:LSY 7. 6. 2004VHAO 7. 9. 2004KHO 19. 10. 2005<strong>Helsingin</strong> <strong>Satama</strong>lle myönnettiin vesilain no<strong>ja</strong>lla oikeus rakentaasuo<strong>ja</strong>penger eristämään TBT-pitoisten massojen ruoppausaluemuusta merialueesta <strong>ja</strong> läjittää TBT-pitoisia masso<strong>ja</strong> <strong>satama</strong>rakenteisiin<strong>ja</strong> meriläjitysalueelle.Suo<strong>ja</strong>pengertä koskeva lupa-asia oli ensimmäinen osa TBT-massojenkäsittelyä koskevaa lupakokonaisuutta. Tässä taulukossa on esitettyainoastaan keskeisimmät TBT-luvat (lisäksi noin 10 kpl muita lupaasioita).Luvassa myönnettiin lupa aloittaa työt muutoksenhausta huolimatta.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t <strong>ja</strong> <strong>Helsingin</strong> <strong>Satama</strong>(ainoastaan KHO-vaiheessa).Valitukset hylättiin pääosin. VHAO lisäsi tarkentavia lupamääräyksiä.KHO tarkensi lupamääräystä siten, että ns. puhtaiden massojen puhtauson varmistettava <strong>ja</strong> TBT-pitoisuudet eivät saa ylittää 3 µg TBT/kg.Puhtaiden peittomassojen määräksi asetettiin 3 miljoonaa kuutiota.<strong>Satama</strong> on jättänyt LSY:n käsiteltäväksi lupahakemuksen tämän lupamääräyksenmuuttamiseksi. KHO on myöhemmin pienempää aluettakoskevan asian yhteydessä antanut tästä poikkeavan lupamääräyksen(määrällinen vaatimus poistettu <strong>ja</strong> pitoisuusra<strong>ja</strong>ksi asetettu 10 µgTBT/kg).YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö161


Lupa-/päätösprosessiPäätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaTBT-pitoisen pintasedimentin puhdistusruoppaaminen suo<strong>ja</strong>penkereiden <strong>ja</strong> suo<strong>ja</strong>verhon rajoittamalla alueella(vesilain mukainen lupa)- vireille 2004- lainvoimaiseksi 2006Päätökset:LSY 20. 12. 2004VHAO 28. 12. 2005KHO 2. 11. 2006<strong>Helsingin</strong> <strong>Satama</strong>lle myönnettiin lupa ruopata TBT-pitoisia pintasedimenttejäsuo<strong>ja</strong>penkereen <strong>ja</strong> suo<strong>ja</strong>verhon rajoittamalla alueella.Luvassa annettiin mahdollisuus aloittaa työt muutoksenhaustahuolimatta.Päätöksestä valittivat yksityisen maanomista<strong>ja</strong>t, kalastuskunta<strong>ja</strong> kalastus- <strong>ja</strong> luonnonsuojeluyhdistys.Ympäristölupa pilaantuneiden sedimenttien hyötykäytölle <strong>satama</strong>rakenteissa- vireille 2004- lainvoimaiseksi 2006Päätökset:LSY 10. 3. 2005VHAO 28. 12. 2005KHO 2. 11. 2006Massastabilointisuunnitelman hyväksyminen- vireille 2006Päätökset:LSY 21. 4. 2006VHAO 4. 5. 2007KHO 20. 2. 2008Valitukset hylättiin pääosin. VHAO:n päätöksessä lisättiin tarkentavialupamääräyksiä (mm. vaatimus ruoppausmassojen peittämisestäns. puhtailla massoilla).<strong>Helsingin</strong> <strong>Satama</strong>lle myönnettiin lupa hyödyntää <strong>ja</strong> käsitellävoimakkaimmin pilaantuneet (<strong>ja</strong> siten meriläjityskelvottomat massat)stabiloimalla ne osaksi <strong>satama</strong>rakennetta.LSY:n päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta. KHO totesi antamassaan päätöksessä, että hankkeen laatuhuomioon ottaen LSY:n ei olisi tullut määrätä, että toiminta voidaanaloittaa ennen päätöksen lainvoimaiseksi tulemista.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin pääosin. VHAO antoi tarkentavia lupamääräyksiä<strong>ja</strong> KHO pysytti päätöksen sellaisenaan voimassa.VHAO:n asettaman lupamääräyksen mukaan <strong>Helsingin</strong> <strong>Satama</strong>ntuli esittää erillinen stabilointisuunnitelma, joka tuli toimittaa ennentöiden aloittamista LSY:n hyväksyttäväksi (ks. alla oleva päätös).Massojen hyötykäyttöluvan mukaan tuli laatia erillinen stabilointisuunnitelma,joka tuli esittää LSY:n hyväksyttäväksi. Suunnitelmassamääriteltiin sideaineet, sideainemäärät, tuotantostabiloinnin aikaisettutkimukset ym. stabilointia koskevat seikat.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin VHAO:ssa <strong>ja</strong> KHO:ssa.Stabiloitavan alueen vesienhallintasuunnitelma on erillisenä asianakäsiteltävänä LSY:ssä, joka ei ole vielä tätä kirjoitettaessa ratkaissutasiaa.Suo<strong>ja</strong>rakenteen ulkopuolisen alueen TBT-pitoisten massojen ruoppausta <strong>ja</strong> läjittämistä koskevavesilain mukainen hakemus- vireille 2005- lainvoimaiseksi 2007Päätökset:LSY 2. 9. 2005VHAO 26. 5. 2006KHO 24. 8. 2007Päätöksessä myönnettiin oikeus ruopata suo<strong>ja</strong>rakenteen ulkopuolisellaalueella (suo<strong>ja</strong>penkereen <strong>ja</strong> -verhon ulkopuolella) oleviaTBT-pitoisia masso<strong>ja</strong>.Päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin pääosin.162 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Lupa-/päätösprosessiPäätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaNs. peittämisvaatimukseen liittyvä muutoshakemusPäätökset:- vireille 2006- tätä kirjoitettaessa ei vielä päätöstä,asia käsiteltävänä LSY:ssä(valitustie VHAO->KHO)Käsitellessään suo<strong>ja</strong>penkereen rakentamista koskevaa lupa-asiaa(ks. edellä päätöskohta ”suo<strong>ja</strong>penkereen rakentaminen”, KHO:npäätös 19.10.2005), KHO asetti lupamääräyksen, jonka mukaan TBTpitoisetruoppausmassat tulee peittää 3 miljoonalla kuutiolla ns. puhtaillamassoilla, joiden TBT-pitoisuudet eivät saa ylittää 3 µg TBT/kg.<strong>Helsingin</strong> <strong>Satama</strong>n hakemus perustuu lähtökohtaan, että läjitettävienmassojen pitoisuus tulee asettaa siten, että läjitysalueen TBT-pitoisuudeteivät kohoa läjitystoiminnan seurauksena. Läjitysalueen TBTpitoisuudetolivat kohonneet jo ennen läjitystoiminnanaloittamista mm. laivaliikenteen takia. <strong>Helsingin</strong> <strong>Satama</strong> on esittänyt,että massojen ra<strong>ja</strong>-arvoksi asetettaisiin 27 µg TBT/kg.UUS on myös tehnyt tämän ns. peittämiskysymyksen osalta hallintopakkohakemuksen,jonka käsittely on kesken LSY:ssa.KHO on eräässä pienempää aluetta koskevassa ruoppausasiassapoistanut peittovaatimuksesta määrälliset edellytykset <strong>ja</strong> asettanutmassojen enimmäispitoisuusra<strong>ja</strong>ksi 10 µg TBT/kg.Merihiekan ottomenetelmän muuttaminen <strong>ja</strong> merihiekan käyttö <strong>satama</strong>n II-vaiheen rakentamiseen(vesilain mukainen lupa)- vireille 2005- lainvoimaiseksi 2007Päätökset:LSY 5. 6. 2006VHAO 4. 5. 2007<strong>Helsingin</strong> <strong>Satama</strong>lle oli aiemmin myönnetty lupa merihiekanottamiseen (Länsi-Suomen vesioikeuden lupa 1998).Ottomenetelmää oli työteknisesti tarpeen muuttaa <strong>ja</strong> merihiekkaaoli tarpeen käyttää myös <strong>satama</strong>n II-vaiheen rakentamiseen.Päätöksessä myönnettiin lupa töiden aloittamiseen muutoksenhaustahuolimatta.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Läjitysalueen muuttamista koskeva hakemus (vesilain mukainen lupa)- vireille 2005- lainvoimaiseksi 2007Päätökset:LSY 14. 12. 2005VHAO 25. 5. 2007VHAO jätti valitukset tutkimatta <strong>ja</strong> päätöksestä ei valitettu edelleenKHO:een.<strong>Helsingin</strong> <strong>Satama</strong>lle oli myönnetty lupa läjittää ruoppausmasso<strong>ja</strong>merialueelle (Länsi-Suomen vesioikeus 1998). Meriläjitysaluetta olitarpeen muuttaa, jonka takia haettiin uutta lupaa.Päätöksessä myönnettiin lupa töiden aloittamiseen muutoksenhaustahuolimatta.Päätöksestä valitti UUS.Vesi- <strong>ja</strong> kalataloudellisen tarkkailuohjelman hyväksyminen <strong>ja</strong> tarkastaminen- ensimmäisen kerran vireille 2003- lainvoimaiseksi 2005Päätökset:Ohjelman hyväksyminenUUS 18. 7. 2003VHAO 29. 9. 2004 (ei valitettu KHO:een)Uudenmaan TE-keskus 12. 5. 2003(ei valitettu)Ohjelman tarkastaminenUUS 18. 6. 2004VHAO 6. 7. 2005 (ei valitettu KHO:een)Uudenmaan TE-keskus 24. 6. 2004VHAO 22. 9. 2005Läjitysalueen laajennuksesta sovittiin <strong>Helsingin</strong> <strong>Satama</strong>n <strong>ja</strong> UUS:nvälisissä neuvotteluissa. VHAO hyväksyi valituksen osittain <strong>ja</strong> muuttiLSY:n päätöstä <strong>Helsingin</strong> <strong>Satama</strong>n <strong>ja</strong> UUS:n sopimalla tavalla.<strong>Satama</strong>n rakentamisen <strong>ja</strong> käyttöönoton vaikutuksia vesistöön<strong>ja</strong> kalatalouteen seurataan tarkkailuohjelman mukaisesti.Uudenmaan TE-keskus hyväksyi tarkkailuohjelman siltä osinkuin kyse oli kalastukseen <strong>ja</strong> kalakantoihin liittyvästä seurannasta.UUS hyväksyi tarkkailuohjelman siltä osin kuin kyse oli vaikutuksistaalueeseen <strong>ja</strong> poh<strong>ja</strong>an.Osasta päätöksistä tehtiin valituksia, joissa valittajina olivat yksityisetmaanomista<strong>ja</strong>t <strong>ja</strong> luonnonsuojeluyhdistykset sekä Sipoon kunta.Uudenmaan TE-keskuksen päätökseen VHAO lisäsi lupamääräyksen,jonka mukaan kaloista tulee määritellä TBT- <strong>ja</strong> TBT:n johdannaistenpitoisuudet.<strong>Helsingin</strong> <strong>Satama</strong>n toimesta tarkkailuohjelmia tarkastettiinaiempien päätösten lupamääräysten mukaisesti <strong>ja</strong> tarkkailutarpeidenlaajentumisen takia. Tarkkailuun sisällytettiin mm. kalojen haittaainepitoisuuksienseuranta.YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö163


Lupa-/päätösprosessiPäätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaNs. miljoonamäen louhinta (Murskaamon ympäristölupa)- vireille <strong>ja</strong> lainvoimaiseksi 2004Päätökset:Hgin ympäristökeskus 27. 7. 2004(valitustie VHAO -> KHO)<strong>Satama</strong>- <strong>ja</strong> yritysalueelta louhittiin huomattava määrä kalliota<strong>satama</strong>-alueen täyttöjä varten. Louhinta <strong>ja</strong> murskaus edellyttivätympäristölupaa.Päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta.Päätöksestä ei valitettu.Pilaantuneiden massojen sijoittaminen <strong>satama</strong>n koillispuoleiseen meluesteeseen- vireille 2004- lainvoimaiseksi 2005Päätökset:UUS 22. 6. 2004VHAO 31. 1. 2005 (ei valitettu KHO:een)Lupa koski lievästi pilaantuneiden <strong>ja</strong> pilaantuneiden massojenvälivarastointia <strong>ja</strong> hyödyntämistä meluesteeseen.Lupa myönnettiin töidenaloittamisluvalla.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin <strong>ja</strong> VHAO:n päätös jäi lainvoimaiseksi.Päätös oli massatalouden kannalta merkittävä <strong>ja</strong> vähensi kuljetustarpeita<strong>ja</strong> kustannuksia.Poh<strong>ja</strong>tuhkan hyödyntämistä <strong>satama</strong>n pintakerroksessa <strong>ja</strong> meluseinän täyttömateriaalina koskeva ympäristölupa- vireille <strong>ja</strong> lainvoimaiseksi 2004Päätökset:UUS 27. 10. 2004 (valitustie VHAO -> KHO)<strong>Satama</strong>n pintakerroksessa <strong>ja</strong> meluseinän täyttömateriaalinahyödynnettiin <strong>Helsingin</strong> Energian Hanasaaren <strong>ja</strong> Salmisaaren voimalaitostenkivihiilen poltossa syntynyttä poh<strong>ja</strong>tuhkaa.Lupa myönnettiin töidenaloittamisluvalla.Päätöksestä ei valitettu.Purkubetonin <strong>ja</strong> -tiilen hyötykäyttö kenttä- <strong>ja</strong> liikennealueiden rakenteissa (ympäristölupa)- vireille 2005 <strong>ja</strong> lainvoimaiseksi 2006Päätökset:UUS 16. 5. 2006(valitustie VHAO -> KHO)<strong>Vuosaaren</strong> <strong>satama</strong>-alueella on si<strong>ja</strong>innut telakkarakennuksia,jotka purettiin telakkatoiminnan loputtua. Purkutöistä kertyi betoni<strong>ja</strong>tiilijätettä, jota hyödynnettiin <strong>satama</strong>kentällä.UUS myönsi toiminnalle ympäristöluvan.Päätöksestä ei valitettu.Tietunnelin vesilain lupa- vireille 2002- lainvoimaiseksi 2005Päätökset:LSY 20. 1. 2004VHAO 7. 7. 2004KHO 25. 2. 2005Ratasillan vesilain lupa- vireille 2000- lainvoimaiseksi 2004Päätökset:LSY 19. 12. 2002VHAO 23. 10. 2003KHO 28. 4. 2004<strong>Satama</strong>tien rakentamiseen tarvittiin vesilain mukainen lupa,koska tie rakennettiin Porvarinlahden alittavaan tunneliin.Tämän lisäksi tietunnelin rakentamisen <strong>ja</strong> käytön yhteydessävaikutetaan jonkin verran poh<strong>ja</strong>vesipintoihin. Tunneli on tiivistettyhuolella, jotta rakentamisella tai käytöllä ei ole vaikutustaLabbackassa oleviin Natura-luontotyyppeihin.Päätöksessä myönnettiin lupa aloittaa työt muutoksenhaustahuolimatta.Töiden tekemistä lintujen pesintäaikana (1. 4.– 31. 7.) rajoitettiin.Päätöksestä valittivat yksityiset maanomista<strong>ja</strong>t <strong>ja</strong> luontojärjestöt.Valitukset hylättiin.Rautatie ylittää Porvarinlahden, jonka rakentaminen edellytti vesilainmukaista lupaa.Päätöksestä valittivat luontojärjestöt <strong>ja</strong> yksityiset maanomista<strong>ja</strong>t.Töiden tekemistä lintujen pesintäaikana (1. 4.– 31. 7.) rajoitettiin.VHAO:n lisäämän lupamääräystarkennuksen mukaan radan sähköjohdottuli merkitä siten, että niistä aiheutuu mahdollisimman vähänhaittaa lintujen muutolle <strong>ja</strong> muulle liikkumiselle. Lisäksi rakentamisenvaikutuksia alueen lintukantoihin <strong>ja</strong> sähköjohtojen vaikutusta lintujenliikkumiseen alueella määrättiin seurattavaksi. Tämä seuranta onosana muuta <strong>satama</strong>n ympäristövaikutusten seurantaa.Valitukset hylättiin.164 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Lupa-/päätösprosessiRautatietunnelin vesilain mukainen lupa- vireille 2002- lainvoimaiseksi 2005Päätökset:LSY 20. 1. 2004VHAO 7. 7. 2004KHO 25. 2. 2005Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannalta<strong>Satama</strong>rataan kuuluu kaksi rautatietunnelia eli Labbackan (0,6 km)<strong>ja</strong> Savion tunnelit (13,5 km).Rautatietunneleiden rakentamisen <strong>ja</strong> käytön yhteydessä joudutaanvaikuttamaan poh<strong>ja</strong>vedenpinnan tasoihin, jonka takia hankkeillehaettiin vesilain mukaiset luvat.Päätöksestä valittivat luontojärjestöt <strong>ja</strong> yksityiset maanomista<strong>ja</strong>t.Valitukset hylättiin.Päätöksessä myönnettiin lupa töiden aloittamiseen muutoksenhaustahuolimatta. Töidenaloittamislupa koski koko Labbackan tunnelia <strong>ja</strong>Savion tunnelin suu-aukko<strong>ja</strong> <strong>ja</strong> ajotunneleita.Myöhemmin haettiin myös erillinen lupa Långmossabergetintyötunnelin rakentamista varten. LSY antoi tästä erillisen päätöksen,josta ei valitettu.Österängenin meluvallin ympäristölupa <strong>ja</strong> maisematyölupa- ympäristölupa vireille<strong>ja</strong> lainvoimaiseksi 2004- maisematyölupa vireille 2004<strong>ja</strong> lainvoimaiseksi 2005Päätökset:Ympäristölupa: UUS 30. 9. 2004(valitustie VHAO –> KHO)Maisematyölupa: Vantaan rv 2. 2. 2005(<strong>Helsingin</strong> hallinto-oikeus -> KHO)Österängenin peltoalueelle rakennettiin meluvalli estämään<strong>satama</strong>n liikenneyhteyksien käytön aiheuttaman melun leviämistäympäristöön. Meluvallin rakennusmateriaalina käytettiin käytöstäpoistettu<strong>ja</strong> autonrenkaita. Tämä edellytti ympäristöluvan hakemista.Meluvallin rakentaminen edellytti myös maankäyttö- <strong>ja</strong> rakennuslainmukaisen maisematyöluvan hakemista.Ympäristö- <strong>ja</strong> maisematyöluvasta ei valitettu.<strong>Satama</strong>veturin tankkauspaikan ympäristölupa- vireille <strong>ja</strong> lainvoimaiseksi 2007Päätökset:LSY 30. 5. 2007 (valitustie VHAO -> KHO)Ympäristölupa koski <strong>satama</strong>veturin tankkauspaikan sijoittamista<strong>ja</strong> käyttöä <strong>satama</strong>-alueella.Päätöksestä ei valitettu.YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö165


Taulukko 17.3<strong>Satama</strong>hankkeenrakentamisaikaisetluvatLupa-/päätösprosessiAsfalttiaseman ympäristölupa- vireille <strong>ja</strong> lainvoimaiseksi 2006Päätökset:<strong>Helsingin</strong> kaupungin ympäristölautakunta30.5.2006 (valitustie VHAO -> KHO)Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaYmpäristölupa koski rakentamisen kannalta tarpeellisen asfalttiasemansijoittamista <strong>satama</strong>-alueelle.Lupapäätöksestä ei valitettu.Diesel-tankkauspisteen alueella olleiden pilaantuneiden maiden käsittely-/ympäristölupa- vireille <strong>ja</strong> lainvoimaiseksi 2004Päätökset:UUS 30.3.2004 (valitustie VHAO -> KHO)MuinaismuistotDiesel-tankkauspiste poistettiin <strong>satama</strong>radan rakentamisen tieltä<strong>ja</strong> samassa yhteydessä alueen pilaantuneet maa-alueet käsiteltiin<strong>ja</strong> poistettiin.Luvan haki<strong>ja</strong>na oli alueella toiminut huoltoasemayrittäjä.Lupapäätöksestä ei valitettu.- Labbackan mäessä si<strong>ja</strong>inneet kalkkiuunit- Gubbackassa si<strong>ja</strong>innut vanha asutusalue- Sodanaikaiset tykkitiet- asiat vireillä vuosina 2004–2005,käsittelijöinä Uudenmaan ympäristökeskus<strong>ja</strong> MuseovirastoMuinaismuistot ovat rauhoitettu<strong>ja</strong>, ellei niitä vapauteta erikseenrauhoituksesta.Museovirasto tutki alueen muinaismuistot, jonka jälkeen kohteetvapautettiin rauhoituksesta.Taulukko 17.4Muut lupa<strong>ja</strong>päätösasiatLupa-/päätösprosessiYmpäristölupaa koskeva hallintopakkohakemus- vireille 2003- lainvoimaiseksi 2004Päätökset:LSY 18.6.2003VHAO 28.4.2004 (päätöksestä ei valitettuedelleen KHO:een)Päätöksen sisältö <strong>ja</strong> merkitys hankkeen toteuttamisen kannaltaHallintopakkoasian vireille pani<strong>ja</strong>t (yksityiset maanomista<strong>ja</strong>t) vaativat,että <strong>satama</strong>n rakentamista ei käynnistetä ennen kuin päätös onsaanut lainvoiman, koska rakentamisen aiheuttamat ympäristömuutoksetovat peruuttamattomia <strong>ja</strong> merkittäviä.Hallintopakkohakemus <strong>ja</strong> siitä tehty valitus hylättiin.Asiasta ei valitettu edelleen KHO:een.Ruoppaustöiden keskeyttämistä koskeva hallintopakkohakemus- vireille 2003- lainvoimaiseksi 2005PäätöksetLSY 28.6.2004VHAO 13.5.2005KHO 30.12.2005Ruoppausmassojen TBT-pitoisuuden selvittyä, UUS antoi<strong>Helsingin</strong> <strong>Satama</strong>lle oikeuden <strong>ja</strong>tkaa ruoppauksia tietyllä alueella.Yksityiset maanomista<strong>ja</strong>t vaativat ruoppausten keskeyttämistälaa<strong>ja</strong>lle ulottuvan ympäristövahingon estämiseksi.Hallintopakkohakemus <strong>ja</strong> valitukset hylättiin.EU:ssa kantelut <strong>ja</strong> vetoomus, jotka koskevat <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamista- vireille 2002Luontojärjestöt tekivät Euroopan parlamentille vetoomuksen<strong>ja</strong> komissiolle kanteluita koskien <strong>Vuosaaren</strong> <strong>satama</strong>n rakentamistaNatura-alueen välittömään läheisyyteen. Asiassa oli myös kysekauppakeskuksen rakentamisesta Sipoon puolelle Östersundomiin.Vuonna 2004 Euroopan parlamentin vetoomusvaliokunta tekitarkastusmatkan <strong>Vuosaaren</strong> <strong>satama</strong>an.Vuonna 2004 saadun komission ilmoituksen mukaan kanteluidenkäsittely <strong>satama</strong>n osalta lopetettiin.Taulukoissa käytetytlyhenteetHAO Hallinto-oikeusKHO Korkein hallinto-oikeusKKO Korkein oikeusKvsto KaupunginvaltuustoLSY Länsi-Suomen ympäristölupavirastoLVM Liikenne- <strong>ja</strong> viestintäministeriöMO Maaoikeusrv Kaupungin rakennusvalvontaTE-keskus Työvoima- <strong>ja</strong> elinkeinokeskusUUS Uudenmaan ympäristökeskusVHAO Vaasan hallinto-oikeusVN ValtioneuvostoYM Ympäristöministeriö166 YHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


1966Vuosaari liitetään Helsinkiin, yhtenä perustelunaon alueen soveltuminen <strong>satama</strong>tarkoituksiin.1967<strong>Vuosaaren</strong> suunnittelukomitean mietintö:<strong>satama</strong> esitetään sijoitettavaksi Bastön niemelle1975<strong>Vuosaaren</strong> <strong>satama</strong>n ensimmäinen yleissuunnitelma,jossa <strong>satama</strong> on Valmetin telakan <strong>ja</strong> Porvarinlahdenvälisellä alueella1982Valtioneuvosto vahvistaa Valtakunnallisen lintuvesiensuojeluohjelman,jossa on mukana Östersundominlintuvesialue.1984<strong>Helsingin</strong> valinnaisia käyttömahdollisuuksia omaavienranta-alueiden maankäyttöselvitys (RAMA), jossaesitetään Jätkäsaaren muuttamista asuinalueeksi<strong>ja</strong> Niinisaaren varaamista <strong>satama</strong>käyttöön1987Päätös Mustavuoren-Porvarinlahden alueenrauhoittamisesta luonnonsuojelualueeksi1989Valtioneuvosto vahvistaa Valtakunnallisen lehtojensuojeluohjelman,jossa on mukana Mustavuoren lehto.1991Vuosaari-Niinisaari osayleiskaavaan liittyvä ympäristövaikutusselvitys,jossa tarkastellaan <strong>Vuosaaren</strong><strong>satama</strong>vaihtoehdon vaikutuksiaVuosaari-Niinisaari osayleiskaavaan liittyväkaavatalousselvitys1992<strong>Vuosaaren</strong> ympäristövaikutusarvio – Sompasaarensiirron vaikutukset<strong>Helsingin</strong> yleiskaavassa <strong>Vuosaaren</strong> telakka-aluevarataan <strong>satama</strong>a varten.1992 –1994Maaliikenneväylien vaihtoehtotarkastelut1994 –1995Ympäristövaikutusten arviointimenettely (YVA)1996<strong>Helsingin</strong> kaupunginvaltuusto hyväksyy <strong>Vuosaaren</strong><strong>satama</strong>n perustamissuunnitelman.1998Valtioneuvoston Natura-päätös2000<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen ympäristövaikutustenseuranta aloitetaan.2001EU:n komission ympäristöasioiden pääosaston vt.pääjohta<strong>ja</strong> ilmoittaa, ettei ympäristöministeriön komissioltapyytämä lausunto ole tarpeen, koska <strong>Vuosaaren</strong><strong>satama</strong>hanke ei todennäköisesti vaikuta Mustavuorenlehdon <strong>ja</strong> Östersundomin lintuvesien Natura-alueenensisi<strong>ja</strong>isesti suojeltaviin luontotyyppeihin tai -lajeihin.2002Ympäristöministeriö vahvistaa <strong>Vuosaaren</strong> <strong>satama</strong>nseutukaavan sekä <strong>Vuosaaren</strong> <strong>satama</strong>n <strong>ja</strong> ympäristönasemakaavan.Korkein hallinto-oikeus hylkää <strong>Vuosaaren</strong> <strong>satama</strong>nseutukaavaa <strong>ja</strong> asemakaavaa koskevat valitukset.<strong>Helsingin</strong> kaupunginvaltuusto päättää<strong>Vuosaaren</strong> <strong>satama</strong>n rakentamisesta.Korkein hallinto-oikeus hylkää <strong>Vuosaaren</strong> <strong>satama</strong>n<strong>ja</strong> meriväylän vesioikeudellisesta luvasta tehdytvalitukset.Eduskunta päättää <strong>Vuosaaren</strong> <strong>satama</strong>nliikenneyhteyksien rakentamisesta.2003<strong>Vuosaaren</strong> <strong>satama</strong>n rakentaminen aloitetaan.<strong>Vuosaaren</strong> telakan edustan meren poh<strong>ja</strong>ssa todetaankorkeita TBT-pitoisuuksia.Uudenmaan ympäristökeskus päättää Östersundominlintuvesien luonnonsuojelualueen perustamisesta.2004Korkein hallinto-oikeus hylkää <strong>Satama</strong>tien suunnitelmanhyväksymispäätöksestä <strong>ja</strong> <strong>satama</strong>radan lunastusluvastatehdyt valitukset.Korkein hallinto-oikeus hylkää <strong>Vuosaaren</strong> <strong>satama</strong>nympäristöluvasta <strong>ja</strong> Porvarinlahden ratasillanvesioikeudellisesta luvasta tehdyt valitukset.EU:n komissio ilmoittaa lopettaneensa kanteluidentutkimisen <strong>Vuosaaren</strong> <strong>satama</strong>n osalta.2005Korkein hallinto-oikeus hylkää rautatietunnelin <strong>ja</strong>tietunnelin vesioikeudellisesta luvasta tehdyt valitukset.TBT:n puhdistusruoppaus telakan edustalla 75 ha:nalueella2007Porvarinlahden tietunneli otetaan käyttöön.2008<strong>Vuosaaren</strong> <strong>satama</strong> otetaan käyttöön.Mustavuoren–Porvarinlahden luonnonsuojelualueenlaajentaminen <strong>ja</strong> Porvarinlahden etelärannanluonnonsuojelualueen perustaminenTaulukko 17.5<strong>Vuosaaren</strong> <strong>satama</strong>nsuunnitteluvaiheet<strong>ja</strong> toteutusYHTEENVETO VUOSAAREN SATAMAHANKKEEN PÄÄTÖKSISTÄ JA LUPAMENETTELYISTÄ<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö167


Tekijät esiin1. Suunnittelu <strong>ja</strong> rakentamisen oh<strong>ja</strong>usAADI arkkitehti- <strong>ja</strong> insinööritoimistoAHMA insinöörit OyAir-Ix OyAir-Ix Talotekniikka OyAkukon OyAlleco OyArkkitehtitoimisto HKP OyArkkitehtityöhuone Artto Palo Rossi Tikka OyAsianajotalo ANPR Oy,AsianajotoimistoHammarström Puhakka Partners OyAsianajotoimisto Project Law OyBentley Finland OyBiota BD OyBuildercom OyCentroid Sito OyOy Confidea Business Consulting LtdCM-Urakointi OySweco CMU OyEkolab Environmental OyElectrowatt Ekono Oy, Pöyry Energy OyEranti Engineering OyEsko Rossi OyElectroscandia OyFinnmap Infra OyOy Finnrock AbGALAB Laboratories GmbHGeokeskus OyGeounion OyGolder Associates Oy<strong>Satama</strong>keskuksen toiminnallinen yleissuunnittelu<strong>Satama</strong>n rakennuttaminen <strong>ja</strong> valvonta, työmaan yleisjohtoVUOLI-projektin suunnittelutta<strong>ja</strong>tehtävät, asiantunti<strong>ja</strong>tehtävätTietunnelin TATE-järjestelmien suunnittelu, asiantunti<strong>ja</strong>tehtävätTullirakennusten LVI-suunnitteluMeluselvityksiäVesistö- <strong>ja</strong> kalatalousseuranta, hydrobiologiset selvityksetPorttialueen <strong>ja</strong> telakka-alueen ympäristön arkkitehtoninenyleissuunnitteluPohjoisen kallioväestönsuo<strong>ja</strong>n arkkitehtisuunnittelu<strong>Satama</strong>keskuksen arkkitehtoninen yleissuunnittelu<strong>Satama</strong>n <strong>ja</strong>lankulkusilta, porttialueen tekniikkapalkit, melumäki,meluseinä, valaistus: arkkitehtisuunnittelu<strong>Satama</strong>tie, arkkitehtisuunnitteluOikeudelliset palvelut, ympäristöjuridiikkaVUOSA-projektin oikeudelliset palvelut, kiinteistösopimukset<strong>Satama</strong>n arkistointijärjestelmän suunnittelu<strong>Vuosaaren</strong> <strong>satama</strong>hankkeen Natura-arviointiLinnustolausunto Porvarinlahden rautatiesiltahankkeesta<strong>Satama</strong>n kunnossapitojärjestelmän suunnitteluATK-ympäristössäVUOLI-projektin ympäristötietojärjestelmän suunnittelu,toteutus <strong>ja</strong> ylläpitoKulunvalvonnan suunnitteluProjektinjohtokonsultti, rakennussuunnittelun valvonta,työmaavalvonta, asiantunti<strong>ja</strong>tehtäviäTBT-ratkaisun toksisuusasiantunti<strong>ja</strong>tehtävätTBT-ratkaisun auditointi<strong>Satama</strong>-altaiden sulanapidon suunnittelu <strong>ja</strong> pulputusTBT-puhdistusruoppauksen <strong>ja</strong> TBT-pilaantuneensedimentin hyötykäytön riskinarvioinnit<strong>Satama</strong>n <strong>ja</strong> <strong>satama</strong>n yritysalueen valonheittimetTietunnelin rakennussuunnitteluSuunnittelutoimeksiantojen auditointiAsiantunti<strong>ja</strong>tehtävätOrgaanisten tinayhdisteiden (mm. TBT) analyysitMaa- <strong>ja</strong> kallioperätutkimuksetPoh<strong>ja</strong>vesien seurantamittauksetTelakka-alueen pilaantuneiden maiden kunnostuksen suunnittelu168 TEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


<strong>Helsingin</strong> Energia / Helen Engineering<strong>Helsingin</strong> kaupunginkaupunkisuunnitteluvirasto<strong>Helsingin</strong> kaupungin rakennusvirasto<strong>Helsingin</strong> kaupungin rakennusvirasto,arkkitehtuuriosasto<strong>Helsingin</strong> kaupungin ympäristökeskus<strong>Helsingin</strong> kaupungin kiinteistövirasto,geotekninen osasto<strong>Helsingin</strong> kaupungin kiinteistövirasto,tonttiosastoInsinööritoimisto Magnus Malmberg OyInsinööritoimisto Niemi OyInsinööritoimisto Paavo Ristola OyInsinööritoimisto Pitkälä OyInsinööritoimisto Pontek OyInsinööritoimisto Saanio & Riekkola OyInsinööritoimisto Tauno Nissinen OyInsinööritoimisto Vahvaselkä OyInstakon OyJP-Suoraplan OyJP-Transplan OyKala- <strong>ja</strong> Vesitutkimus OyKalliosuunnittelu OyKalliotekniikka OySähkö- <strong>ja</strong> televerkon suunnittelu, sähköverkon rakennuttaminen<strong>ja</strong> valvontaValaistuksen suunnittelu, rakennuttaminen <strong>ja</strong> valvontaKaavoitus, maankäyttöön <strong>ja</strong> liikenteeseen liittyviä selvityksiä<strong>ja</strong> suunnitelmiaKatujen <strong>ja</strong> alueiden suunnitteluun <strong>ja</strong> toteuttamiseenliittyviä selvityksiä <strong>ja</strong> suunnitelmiaTullin rakennusten arkkitehtisuunnitteluYmpäristöön liittyviä selvityksiä <strong>ja</strong> suunnitelmiaVUOSA-projektin poh<strong>ja</strong>rakennussuunnittelunasiantunti<strong>ja</strong>tehtävät, poh<strong>ja</strong>tutkimuksetPerustamissuunnitelman toteuttamismallien valmisteluLogistiikka-alueen kehittämisen, maanhankinnan, vuokrasopimusten<strong>ja</strong> pilaantuneen maaperän asiantunti<strong>ja</strong>tehtävätTullin rakennusten rakennesuunnitteluPulputusputkien suunnittelu<strong>Helsingin</strong> <strong>satama</strong>hankkeen ympäristövaikutustenarviointiohjelma <strong>ja</strong> -selostus.<strong>Vuosaaren</strong> täyttömäen laajennuksen ympäristövaikutustenarviointiohjelma <strong>ja</strong> -selostus.Laiturien rakennesuunnittelu (kulmatukimuurit, reunapalkit,paalutetut pistolaiturit), nosturikiskojen kiinnityssuunnitteluPorvarinlahden ratasillan rakennussuunnittelu<strong>Satama</strong>n porttialueen tekniikkapalkit <strong>ja</strong> laitetilarakennukset,rakennesuunnitteluTelakka-altaan patoseinän <strong>ja</strong> altaan kunnostuksenrakennesuunnitteluLiikenneyhteyksien kalliotekniset asiantunti<strong>ja</strong>tehtävät<strong>Satama</strong>radan yleissuunnitelman tarkistus<strong>Satama</strong>n aluevalvonnan suunnittelu<strong>Satama</strong>keskuksen pohjoisen väestönsuo<strong>ja</strong>n sähkösuunnittelu<strong>Satama</strong>n laitetilarakennusten <strong>ja</strong> tullirakennusten sähkösuunnittelu<strong>Satama</strong>keskuksen pohjoisen väestönsuo<strong>ja</strong>n LVIA-suunnittelu<strong>Satama</strong>radan yleissuunnitelman laatiminenSavion rautatietunnelin rakennussuunnittelu, pelastussuunnitelmaVUOLI-projektin maarakennusurakka 1,ratapihan rakennussuunnittelu, asiantunti<strong>ja</strong>tehtävätVesistö- <strong>ja</strong> kalatalousseuranta, koordinointi <strong>ja</strong> raportointiSedimenttitutkimuksetTietunnelin rakennussuunnitteluSuunnittelutoimeksiantojen auditointi, asiantunti<strong>ja</strong>tehtävätLouhinnanaikaiset tärinämittaukset<strong>Satama</strong>keskuksen keskitetty tärinänseurantaTEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö169


Kuvanveistäjä Hannu SirenLAB arkkitehdit OyLT-Konsultit Oy,WSP Finland OyLuode Consulting OyLVI-Consulting Grönroos OyMaa <strong>ja</strong> Vesi OyMaanmittauslaitosMaisema-arkkitehtuuri MMMarsh OyMerenkulkulaitosMericon OyMiuraad OyMuseovirastoNaturata OyPP-Viestintä OyPTCServices OyPöyry Environment OyPöyry Infra OyPöyry Telecom OySCC Viatek OyRamboll Finland OyRejlers OySeppo Janhunen OyPeruskivitaideteos ”Tahto”<strong>Satama</strong>n laitetilarakennukset, arkkitehtisuunnitteluTiejärjestelyjen yleis- <strong>ja</strong> tiesuunnitelma, maarakennusurakka 1Laivanrakenta<strong>ja</strong>ntien eritasoliittymän rakennussuunnittelu,meluselvityksiä <strong>ja</strong> -mittauksia, asiantunti<strong>ja</strong>tehtävät<strong>Satama</strong>keskuksen pohjoisen väestösuo<strong>ja</strong>n rakennussuunnitteluVesistö- <strong>ja</strong> kalatalousseuranta, ruoppaustöiden sameudenleviämisen seurantaYmpäristögeofysikaaliset asiantunti<strong>ja</strong>tehtävät<strong>Satama</strong>n laitetilarakennusten LVI-suunnittelu<strong>Satama</strong>radan alustava yleissuunnitelma <strong>ja</strong> yleissuunnitelmaLuontovaikutusten <strong>ja</strong> poh<strong>ja</strong>vesien seurantaohjelmaSavion rautatietunnelin koepumppaukset <strong>ja</strong> poh<strong>ja</strong>veden mallinnusKasvillisuusseuranta, asiantunti<strong>ja</strong>tehtäviäRadan lunastuslupa-asiakirjojen valmisteluLogistiikka-alueen, Porttikeskuksen, Merimieskeskuksen<strong>ja</strong> <strong>satama</strong>n palvelualueen maisemasuunnittelu<strong>Satama</strong>n suunnittelu- <strong>ja</strong> rakentamisprosessin riskinarviointiMeriväylän tutkimukset <strong>ja</strong> yleissuunnittelu<strong>Satama</strong>n <strong>ja</strong> <strong>satama</strong>n yritysalueen mittauspalvelut,ruoppaussuunnittelu <strong>ja</strong> luotaukset<strong>Satama</strong>hankkeen esitteiden <strong>ja</strong> raporttien visuaalinen suunnittelu<strong>ja</strong> graafinen työArkeologiset tutkimuksetOikeudelliset palvelut, ympäristöjuridiikkaTiedottaminen <strong>Vuosaaren</strong> <strong>satama</strong>hankkeestayleissuunnitteluvaiheessa, viestintäpalvelut<strong>Satama</strong>n oikeudelliset palvelut, hankinnat<strong>Satama</strong>n jätehuoltosuunnittelu<strong>Satama</strong>n <strong>ja</strong>lankulkusillan rakennesuunnittelu<strong>Satama</strong>n arkistointijärjestelyt sekä kunnossapidondokumenttien hallinnan oh<strong>ja</strong>usSelvitys <strong>Vuosaaren</strong> <strong>satama</strong>n suurten erikoiskuljetusten reitistä,maa- <strong>ja</strong> kallioperätutkimuksien täydentäminen, tiejärjestelyjentiesuunnitelman <strong>ja</strong> <strong>satama</strong>radan yleissuunnitelman suunnitelmaaineistontäydentäminen, maarakennusurakka 2, tiejärjestelyjen<strong>ja</strong> <strong>satama</strong>radan ympäristösuunnittelu, asiantunti<strong>ja</strong>tehtävätVUOSA-projektin tietotekniset suunnittelu-, valvonta<strong>ja</strong>auditointitehtävätVUOLI-projektin kalliorakennustöiden valvonta,liikenteenhallintajärjestelmän rakennussuunnittelu<strong>Satama</strong>n aluesuunnittelu, massastabiloinnin suunnitteluTBT-kysymysten asiantunti<strong>ja</strong>tehtävät, sedimenttitutkimuksetLaivaramppien yleis- <strong>ja</strong> rakennesuunnittelu sekä työmaapalvelutYmpäristö- ym. lupien haku- <strong>ja</strong> käsittelypalvelut, työmaapalvelut,vihersuunnittelu, hajunpoistolaitoksen suunnitteluSelvitys <strong>Vuosaaren</strong> <strong>satama</strong>n suurten erikoiskuljetusten reitistäLiikenteenhallintajärjestelmän rakennussuunnitteluMaarakennusurakka 2, tiejärjestelyjen <strong>ja</strong> <strong>satama</strong>radanympäristösuunnitteluLiikenneyhteyksien asiantunti<strong>ja</strong>- <strong>ja</strong> valvontatehtävät<strong>Satama</strong>n vesihuollon sulanapitosuunnitteluYritys- <strong>ja</strong> porttialueen työmaapäällikön tehtävät170 TEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Spokesman OyStrafica OySuomalainen insinööritoimisto OySITO OySITO-Konsultit OySuomen Akustiikkakeskus OySuomen IP-Tekniikka OySuomen Malmi OySuunnittelukeskus OyFCG Planeko OySuunnittelukide OyTielaitos / Tuotanto, Tieliikelaitos, DestiaTraficon OyTrafix OyVesihydro OyViasys OyOy VR-Rata AbYmpäristötutkimus Yrjölä OyYS-Konsultit OyYSP-Yleinen sähköpalvelu OyVibkon OyVTT Materiaalit <strong>ja</strong> rakentaminenTiedottaminen <strong>Vuosaaren</strong> <strong>satama</strong>hankkeesta rakennusvaiheessa,viestintäpalvelut, internet-sivustot, esiintymiskouluttaminen<strong>Satama</strong>hankkeen YHTALI-laskelman <strong>ja</strong> hankeyhteenvetojenpäivittäminen, asiantunti<strong>ja</strong>tehtävätTiejärjestelyjen yleis- <strong>ja</strong> tiesuunnitelma sekä suunnitelmaaineistontäydentäminen, <strong>satama</strong>radan Myraksen ruhjealueenrakennettavuusselvitys <strong>ja</strong> yleissuunnitelman tarkistus, poh<strong>ja</strong>vesienseurantamittaukset, maarakennusurakka 2, tiejärjestelyjen<strong>ja</strong> <strong>satama</strong>radan rakennussuunnittelu, tietunnelin valaistuksensuunnittelu, asiantunti<strong>ja</strong>tehtävät<strong>Satama</strong>n liikenneyhteydet, suunnittelun geotekniset asiantunti<strong>ja</strong>palvelut,kasvillisuuden seurantaohjelman kokoaminen, asiantunti<strong>ja</strong>tehtävät,porttialueen ympäristön yleissuunnittelu<strong>Satama</strong>n laiturirakenteiden poh<strong>ja</strong>rakennussuunnittelu,nosturikiskojen peruspalkkien rakennesuunnitteluMeluselvityksiä <strong>ja</strong> -mittauksiaPuhdistusruoppauksen suo<strong>ja</strong>verhorakenteen suunnitteluMelumuurin rakennesuunnitteluLogistiikka-alueen aluesuunnitteluMaa- <strong>ja</strong> kallioperätutkimukset, kiviaines- <strong>ja</strong> porattavuusselvitys,jännitystilamittauksia, maatutkamittauksiaMaaliikenneväylien esisuunnittelu <strong>ja</strong> ympäristöarviointi,suunnittelutoimeksiantojen auditointi<strong>Satama</strong>n suunnittelutta<strong>ja</strong>tehtävätLumenkaato-laiturin rakennesuunnitteluHinaa<strong>ja</strong>laiturin yleissuunnittelu<strong>Satama</strong>kaaren varastokentän maisemasuunnitteluRuusuniemenkanavan yleissuunnitteluVUOLI-projektin siltaurakan 2 valmisteluPoh<strong>ja</strong>tutkimukset Porvarinlahden alueella, kaivokartoitus,fotogrammetrisen maastomallin mittaus, <strong>Vuosaaren</strong> <strong>satama</strong>nmaaliikenneprojektin geoteknisen suunnittelun valvonta <strong>ja</strong> oh<strong>ja</strong>usMaa- <strong>ja</strong> kallioperätutkimukset, mittauksia, kartoituksia, maastotutkimuksienvalvonta- <strong>ja</strong> asiantunti<strong>ja</strong>tehtävät, geotekniikanasiantunti<strong>ja</strong>palvelutTietunnelin liikenteenhallintajärjestelmän yleis- <strong>ja</strong> rakennussuunnittelu,turvallisuusasiakir<strong>ja</strong>tLogistiikka-alueen liikennetarkasteluLiikenteen oh<strong>ja</strong>us- <strong>ja</strong> opastussuunnitteluPoh<strong>ja</strong>vesinäytteiden otto <strong>ja</strong> analysointi<strong>Satama</strong>hankkeen virtuaalimalli <strong>ja</strong> animaatiotVUOLI-projektin ratasuunnittelun valvonta sekä sähkö-, turvalaite<strong>ja</strong>liikennesuunnittelutehtävät, ratatekniset asiantunti<strong>ja</strong>tehtävät,liikenne-, sähkörata-, turvalaite <strong>ja</strong> tietoliikenneyhteyksiensuunnittelu<strong>Satama</strong>n raiteiston <strong>ja</strong> turvalaitteiden suunnitteluLinnustonseurantaVUOLI-projektin maarakennusurakka 3, rakennussuunnittelu,suunnittelutoimeksiantojen auditointiTietunnelin käyttöjärjestelmän alustava suunnitteluRadan tärinävaimennuksen suunnittelu Savion tunnelissaMassastabiloinnin laadunvarmistuksen auditointi <strong>ja</strong> massastabiloidunalueen rakennettavuusselvitys, stabiloidun päällysrakenteenasiantunti<strong>ja</strong>testitTEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö171


2. RakentaminenABB OyAEG OyAgrekaattipalvelu M. Kumpula OyAnaconda Cabling OyAstlon OyCeler OyCorenet OyBiomaa OyDestia Oy, TieliikelaitosDredging International n.v.Econet Engineering OyEltel Networks OySähköradan kaukokäyttöurakka<strong>Satama</strong>n sähkö- <strong>ja</strong> valaistusjärjestelmän oh<strong>ja</strong>usjärjestelmä<strong>Satama</strong>n valo-oh<strong>ja</strong>uskeskukset, <strong>ja</strong>kokaapitVUOLI-projektin varavoimakoneiden toimitus<strong>Satama</strong>n kaapeleiden päättämisurakkaTullirakennusten automatiikkaVaihteenlämmitysurakka, raiteiden turvalaitteetRatatunnelien radioverkkourakka, Virve-laitteet<strong>Satama</strong>n kulunvalvontaurakka, tietoliikenneverkkoTelakka-alueen pilaantuneiden maa-ainesten puhdistaminenÖsterängenin koerakenteetMaanrakennusurakka 3Tietunnelin asfaltointiTien liikenteenoh<strong>ja</strong>uslaitteetKuntatekniikkaurakka 1 <strong>ja</strong> 3<strong>Satama</strong>n stabiloidun päällysrakenteen urakkaMerihiekan nosto <strong>ja</strong> siirto <strong>satama</strong>n täyttöön<strong>Satama</strong>n neutralointilaitosMeriväylän sähköurakkaRatatunneleiden sähköurakkaRadan sähköistysurakkaKaapelointiurakka TLU3Siltojen kosketussuo<strong>ja</strong>rakenteetE. M. Pekkinen Oy Savion 5. raiteen maanrakennusurakkaES-Projektit OyFira OyGasum Oy<strong>Helsingin</strong> kaupungin rakennusvirasto,HKR-Tekniikka<strong>Helsingin</strong> kaupungin rakennusvirasto,HKR-Ympäristötuotanto, itäinen alueyksikkö<strong>Helsingin</strong> Metallipurkaus Oy<strong>Helsingin</strong> Nosturit Oy<strong>Helsingin</strong> Talosiirto OyHyvinkään Tieluiska OyInsinööritoimisto Seppo Rantala OyJonator OyKaitos OySavion tunnelin kaapelihyllyurakkaTelakka-altaan patoseinän urakkaMaakaasuputken siirto<strong>Satama</strong>keskuksen eteläisen väestönsuo<strong>ja</strong>n saneerausPorvarinmäen <strong>ja</strong> <strong>Satama</strong>kaaren varastokentänviherrakennustyöt<strong>Satama</strong>keskuksen katujen rakentaminenTäyttömäen kunnostus <strong>ja</strong> maisemointiTelakka-alueen rakennusten purku-urakat<strong>Satama</strong>-alueen syvätiivistysurakatTelakka-alueen pienten rakennusten purku-urakkaVUOLI-projektin kuntatekniikkaurakka 2<strong>Satama</strong>-alueelta poistetun TBT-pilaantuneen sedimentinmassastabilointi <strong>satama</strong>kentän poh<strong>ja</strong>rakenteeksiMaanrakennusurakka 2ASiltaurakka 1 (Porvarinlahden ratasilta)Siltaurakka 2<strong>Satama</strong>n 400 V sähkökeskuksetPuhdistusruoppauksen suo<strong>ja</strong>verhorakenteen materiaalitoimitusKalliorakennus-Yhtiöt Oy Savion tunnelilouhintaurakka 4Km Kuutio OyKäärmeniemen <strong>ja</strong> Lehdessaarten alueen rakennustenpurku-urakka172 TEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Kesälahden Maansiirto OyKonevuori OyKymppirakenne OyVUOLI-projektin maanrakennusurakka 2<strong>Satama</strong>n <strong>ja</strong> yritysalueen aluetyöurakoita<strong>Satama</strong>n <strong>ja</strong> yritysalueen maanrakennusurakoitaLaitetilarakennuksetLemminkäinen Oyj VUOLI-projektin asfalttiurakka 1Lemminkäinen Infra Oy,Lemcon OyLoh<strong>ja</strong> Rudus OyMaanrakennusliike Rauno Lehtonen OyMastmasters OyMerenkulkulaitosSavion tunnelilouhintaurakka 3 <strong>ja</strong> 6Savion tunnelin rakennusurakkaKiviaineksen toimitus<strong>Satama</strong>kaari välillä Vuotie–Niinisaarentie <strong>ja</strong> pysäköintialue P4Lin<strong>ja</strong>- <strong>ja</strong> tutkamerkitJääpoijujen <strong>ja</strong> poijuviittojen valmistusMiilukangas Ky Meriväylän reunamerkkien teräsosat 1Navielektro KyNCC Roads OyNiscayah OyNiska & Nyyssönen OyPalin Granit Oy / Loimaan KiviPekkaniska OyPeab Seicon OyQuattroservices OyRakennus Pevito OyRatatek OyRohde Nielsen A / SSaipu OyVTS-laitteet<strong>Satama</strong>n päällystysurakkaSavion tunnelin turvajärjestelmäurakka<strong>Satama</strong>n aluevalvontaSavion 5. raiteen siltaurakkaKäärmeniemen TBT-pitoisen saven väliaikaisen kalliovarastonlouhintaurakka<strong>Satama</strong>n aluetyöurakoita<strong>Satama</strong>n <strong>ja</strong>lankulku- <strong>ja</strong> ramppisiltaurakka (sis. tekniikkapalkit)<strong>Satama</strong>tien eritasoliittymä, <strong>satama</strong>tie <strong>ja</strong> pysäköintialue P3Peruskivitaideteoksen ”Tahto” valmistaminen<strong>Satama</strong>n syvätiivistysurakka<strong>Satama</strong>n C-laiturin kaksoisrampitTullin rakennuksetTullirakennusten putkiurakka<strong>Satama</strong>keskuksen pohjoisen väestönsuo<strong>ja</strong>n sähköurakkaVUOLI-projektin meluaitaurakkaVUOLI-projektin maadoitusurakka<strong>Satama</strong>n ruoppausurakka<strong>Satama</strong>keskuksen pohjoisen väestönsuo<strong>ja</strong>n sprinkleriurakkaSatametalli Oy Meriväylän reunamerkkien teräsosat 2Siemens OySignal Networks Finland OySkanska Oy,Skanska Infra OySuomen Energia-Urakointi OySuomen Vesityö OyLiikenteenoh<strong>ja</strong>usurakka<strong>Satama</strong>n <strong>ja</strong>kelumuunta<strong>ja</strong>tPaloilmaisimien oh<strong>ja</strong>uskeskus<strong>Satama</strong>n paloilmoitusjärjestelmä<strong>Satama</strong>n WLAN-verkkoTunnelilouhintaurakka 1 (Tietunneli <strong>ja</strong> Labbackan tunneli)<strong>Satama</strong>keskuksen pohjoinen kallioväestönsuo<strong>ja</strong><strong>Satama</strong>n kaapelointiurakka, kylmäsähköjen palvelu<strong>ja</strong>Ankkuripainojen valmistusLouhekuljetukset HernesaarestaPienet ruoppaustyötPonttonilaiturin toimitusLouheen vastaanottoTEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö173


Tehomet OyTekmanni OyTerramare OyTTP-Yhtiöt OyTunneltech OyTyöyhteenliittymä Vuolin VeturiDestia <strong>ja</strong> Maanrakennus Veli Hyyryläinen Oy<strong>Satama</strong>n valaisinmastotTullirakennusten sähkö- <strong>ja</strong> IV-urakkaMeriväylän sisäosan ruoppausurakka<strong>Satama</strong>n ruoppaustyö <strong>ja</strong> TBT-puhdistusruoppaus<strong>Satama</strong>n laiturirakenneurakoita <strong>ja</strong> meluseinäurakka<strong>Satama</strong>n yritysalueen valaisinmastotTunneliurakka 1B (Tietunnelin <strong>ja</strong> Labbackan tunnelin sisustustyöt)<strong>Satama</strong>radan <strong>ja</strong> <strong>satama</strong>n <strong>ja</strong> yritysalueen raiteidenpäällysrakenneurakka<strong>Satama</strong>radan suo<strong>ja</strong>-aitaurakkaUS-Asennus Oy Liikennevalourakka 1VarustamoliikelaitosVepe Oy PeltonenVerkonrakenta<strong>ja</strong> Wire OyOy VR-Rata AbWasa Dredging OyYIT Kiinteistötekniikka OyYIT Rakennus OyYIT Teollisuus- <strong>ja</strong> verkkopalvelut OyJääpoijujen <strong>ja</strong> poijuviittojen asennus<strong>Satama</strong>n ISPS-aitaurakkaTievalaistusurakka 1<strong>Satama</strong>n kaapelointiurakkaSavion 5. raiteen päällysrakenneurakkaRadan turvalaiteurakka 1, 2, 4 (käyttöönotto) <strong>ja</strong> 5Ratapihan valaistusurakkaMeriväylän ulko-osan ruoppausurakkaTietunnelin sähköurakkaTietunnelin LVIA-urakkaSavion tunnelin LVIA-urakkaVUOLI-projektin maanrakennusurakka 1Ratapihan eteläpään <strong>ja</strong> pohjoisosan porttialueen stabilointiSavion tunnelilouhintaurakka 2 <strong>ja</strong> 5Tietunnelin jälki-injektointiMeriväylän reunamerkkien pystytys<strong>Satama</strong>n yritysalueen louhintaurakka<strong>Satama</strong>n laiturirakenneurakka<strong>Satama</strong>n nosturikiskourakka<strong>Satama</strong>keskuksen pohjoisen väestönsuo<strong>ja</strong>n LVIA-urakka<strong>Satama</strong>n 20 kV kojeistot3. Yksityiset hankkeetSponda OyjPöyry Architects OyInsinööritoimisto Oy Matti Ollila & CoProjectus Team OySuomen IP-Tekniikka OyMaisemasuunnittelu MM OyRamboll Finnland OyA-Rakennutta<strong>ja</strong>t OyLu<strong>ja</strong>talo OyTrafix OySponda OyjCederqvist & Jäntti ArchitectsFinnmap Consulting OyQuatrocon OyTuomi Yhtiöt OyPakrak OyGatehouse, Hansaterminaali, pysäköintitalo <strong>ja</strong> logistiikka-aluePääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVIS-suunnitteluGeotekninen suunnitteluMaisemasuunnitteluLiikenne-suunnitteluRakennutta<strong>ja</strong>konsulttiPääurakoitsi<strong>ja</strong>OpastesuunnitteluVuosaari Service CenterPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVI-suunnitteluSähkösuunnitteluPääurakoitsi<strong>ja</strong>174 TEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


Sponda OyjVuorelma Arkkitehdit OyFinnmap Consulting OyOy Insinööri StudioA-Rakennutta<strong>ja</strong>t OyPakrak OyJohn Nurminen OyArkkitehtitoimisto Erkki Helamaa<strong>ja</strong> Keijo Heiskanen OyRisto Koskio OyLVI STUDIO OYITP-Sähkö OyRamboll Finnland OLu<strong>ja</strong>talo OyFinnsteve Oy AbArkkitehtitoimisto Kari Unelius,Arkkitehtitoimisto VIA OyInsinööritoimisto Tauno Lehtonen OyInsinööritoimisto Timo Penttilä OyVesucon OyRamboll Finnland OyRakennusosakeyhtiö HartelaRakennustuote OySpeed Group OyArkkitehtitoimisto Junkkari & Käppi OyRI-Plan OyVuorelma Arkkitehdit OyLinos OyITP-Sähkö OyL2 Paloturvallisuus OyMetalvi OyDemaco OyOka OyT & M-kiinteistöt OyArkkitehtitoimisto Havas Rosberg OyWSP Finland OyPöyry Building Services OyBeatron KyPalotekninen insinööritoimistoMarkku Kauriala OyQuattroproject OyHelsinki Seafarers Centre OyARK-house arkkitehdit OyInsinööritoimisto Taskinen & Eiskonen OyLVIS-InsinööritoimistoKarlsson, Karves & Co OyInsinööritoimisto Jouko Kärki OyMaisema-arkkitehtuuri MMRakennutta<strong>ja</strong>palvelu Arto Palo OySuomen Projektiurakointi OyContainer-Depot Ltd OyVirkkunen& Co ArchitectsWSP Finland OyInsinööritoimisto Laa<strong>ja</strong>va OyInsinööritoimisto Tauno Nissinen OyPoh<strong>ja</strong>tekniikka OyOy Marine Container Yard AbArkkitehtitoimisto Juhani Palmqvist OyTyökonekor<strong>ja</strong>amoPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVI- <strong>ja</strong> sähkösuunnitteluRakennutta<strong>ja</strong>konsulttiPääurakoitsi<strong>ja</strong>LogistiikkakeskusPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVI-suunnitteluSähkösuunnitteluGeotekninen suunnitteluPääurakoitsi<strong>ja</strong>RakennuskohteetPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVI-suunnitteluSähkösuunnitteluGeotekninen suunnitteluPääurakoitsi<strong>ja</strong>Pääurakoitsi<strong>ja</strong>, aluerekanteetKiinteistö Oy <strong>Vuosaaren</strong> RahtarinpuistoPääsuunnitteli<strong>ja</strong>RakennesuunnitteluArkkitehtisuunnitteluLVIA-suunnitteluSähkösuunnitteluPaloturvallisuussuunnitteluAlustava LVI-suunnitteluValvontaPääurakoitsi<strong>ja</strong>PortsariPääsuunnitteli<strong>ja</strong>Rakennesuunnittelu, geotekninen suunnitteluLVIA- suunnitteluSähkösuunnitteluPalotekninen suunnitteluPääurakoitsi<strong>ja</strong>MerimiespalvelukeskusPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVIA- suunnitteluSähkösuunnitteluMaisemasuunnitteluRakennutta<strong>ja</strong>konsulttiPääurakoitsi<strong>ja</strong>Konttikor<strong>ja</strong>amoPääsuunnitteli<strong>ja</strong>RakennesuunnitteluLVI- suunnitteluSähkösuunnitteluPoh<strong>ja</strong>tutkimusMCY-Konttikor<strong>ja</strong>amoPääsuunnitteli<strong>ja</strong>TEKIJÄT ESIIN<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö175


SammandragNordsjö hamnprojekt är ett av de ansenligaste samhällsbyggnadsprojekteni Finlands historia. En nyoch modern hamn har byggts i Nordsjö. I projektethar dessutom en ny väg byggts till Ring III, en banförbindelsetill stambanan och en ny farled till hamnen.Allt gods transporteras över hamnen i enheter,d.v.s. antingen i containrar eller på långtradare ellersläpvagnar. Den nya hamnen ligger ca 15 kilometerfrån Helsingfors centrum. Hamnen och företagsområdetinvid bildar ett stort logistikcentrum.De totala kostnaderna för hamnprojektet är ca700 M€, varav kostnaderna för hamnen utgör ca400 M€ och för trafiklederna ca 300 M€. Därutöverriktas ca 400 M€ privata investeringar till området,inklusive logistikcentrumet.När projektet är färdigt upphör verksamheten i degamla hamnarna, Västra hamnen och Sörnäs hamn,och områdena friställs för annat bruk. Nya bostädernära havet kan byggas för ca 30 000 invånare ochdessutom lokaliteter för företag.Hamnplaneringens skedenNordsjö anslöts år 1966 till Helsingfors stad. Inkorporeringenmotiverades då speciellt med Helsingforsstads energiförsörjning och hamnens framtidabehov.De senaste trettio åren har man letat efter hamnplatserinom Helsingfors influensområde och platsernahar undersökts i flera utredningar. På 1990-talet fokuserades hamnutredningarna på omläggningav de nuvarande hamnarna och på planering ochutvärdering av alternativa hamnplatser och trafikregleringar.År 1992, när Helsingfors stad godkände Generalplan1992, fick Nordsjö hamnprojekt så gott somsin nuvarande form. Miljökonsekvensbedömningenav projektet inleddes år 1994, strax efter att den nyalagen om förfarande vid miljökonsekvensbedömninghade trätt i kraft.Helsingfors stadsfullmäktige godkände år 1996etableringsplanen för Nordsjö hamn och beslöt utarbetaen detaljplan för området. Samtidigt med detaljplanenutarbetades också en regionplan för Nordsjöhamn och dess trafikförbindelser, samt en delgeneralplanför Sydöstra Vanda. Hamnområdet inklusivetrafikförbindelserna till hamnen planerades parallelltmed planläggningen.Projektets omfång, många besvär och nya lagargjorde att planeringen och behandlingarna drogut på tiden. De egentliga besluten om den detaljeradeplaneringen och utbyggnaden av trafikledernaoch hamnområdet kunde göras först när högsta förvaltningsdomstoleni Finland i juni 2002 förkastadebesvären mot regionplanen och detaljplanen.Kommissionen för Europa Unionen meddelade20. 7. 2004 att behandlingen av anförda klagomålgällande Nordsjö hamn läggs ned.Byggnadsarbetena inleddes i bör<strong>ja</strong>n av år 2003.Byggandet har förlöpt enligt planerna. Hamnen tasi bruk i november 2008.Minsta möjliga miljöolägenheter utgångspunkti alla planeringsskeden och vid utbyggnadAnsvar för miljön och minsta möjliga miljöolägenhetervar utgångspunkten när hamnen planeradesoch byggdes. Sträckningsalternativet i Borgarstrandsviken,vilka baserar sig på tunnlar och somredan i regionplaneskedet konstaterades skona miljönbäst, valdes till grund för landtrafikförbindelserna.Linjesträckningsalternativet vid Östertokanutsågs med hänsyn till trafikeringen och miljön somdet bästa alternativet till grund för planeringen avhamnfarleden, trots att alternativet var det dyraste.Den fortsatta planeringen fokuserades speciellt påatt anpassa trafiklederna till landskapet och på attminska negativa konsekvenser.Nordsjö hamn har huvudsakligen byggts på ettföre detta varvsområde och på utfyllnad i havet,men områden och rutter som tidigare har använtsför rekreation samt lokalt värdefulla naturobjekt harockså fått ge plats för hamnen. Förlorade områden176SAMMANDRAG<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


och olägenheter som hamnprojektet förorsakar kompenserasgenom att skydda, iståndsätta och utformalandskapet i närområdena kring hamnen. Med enhögklassig arkitektur har uppmärksamhet fästs vidatt bilda en positiv stadsbild och ett trivsamt område.Att identifiera miljörisker och förebygga dem harstyrt byggandet. Samarbetet mellan olika instansergav möjlighet att bl.a. planera flyttningen av massorpå ett fördelaktigt sätt med hänsyn till helheten.Behandlingar, beslut och lovsförfaranden gällandeNordsjö hamnprojekt, vilka tas upp i boken,är som helhet ett illustrativt exempel t.ex. på skiftesrikautmaningar och mål, som miljölagstiftningen iFinland ställer på utbyggnad av stora infrastrukturprojekt.Projektets konsekvenserMånga funktionella fördelar uppnås i och med attHelsingfors Hamns godshamnsfunktioner koncentrerastill Nordsjö. Projektet är lönsamt såväl samhällsekonomisktsom för Helsingfors ekonomi. Projektetföljer också principerna för hållbar utveckling.Detta betonas speciellt nu när målet är att minskatrafikemissioner som en del av åtgärderna för attbekämpa klimatförändringen.De nuvarande godshamnarna i Helsingfors liggermycket olägligt med tanke på transporterna, eftersomhamnarna ligger splittrat i stadens centrum. Denuvarande hamnarnas kapacitet är otillräcklig ochen ytterligare splittring av hamnfunktionerna skullevara oekonomiskt.Miljöolägenheterna minskar när hamnen byggsi Nordsjö. Miljöriskerna vid transporter minskar.Bullret i hamnen och från trafiken berör områdenmed färre invånare än vid de nuvarande hamnarnaoch vid trafiklederna som leder till hamnarna. Konkurrenskonstellationeni godstrafiken gynnar tågen.På de nuvarande hamnområdena i innerstaden kanbyggas bostäder samt affärs- och kontorslokaler.Detta balanserar samhällsstrukturen och minskardärmed också trafiken och trafikemissionerna.Att bygga hamnen invid det värdefulla naturområdetställde höga kvalitetskrav på planeringenoch byggandet. Hamnens konsekvenser för detnärbelägna Natura 2000-området ställde en storutmaning när projektet behandlades. Efter mångabehandlingsskeden gällande Nordsjö hamn ochdess trafikförbindelser ansåg högsta förvaltningsdomstoleni Finland i sitt beslut 2002 att bedömnings-och remissförfarandet påvisar att projektetförsämrar områdets naturvärden. Inget tyder dock påatt försämringen i betydande grad skulle riktas tillde naturvärden som avses i naturvårdslagen 66 § 1mom. och i naturdirektivets artikel 6, vilka var grundentill att objektet F10100065 Svarta backens lundoch Östersundom fågelvatten införlivades med nätverketNatura 2000.Nya tekniska lösningarÅtgärderna för att sanera marken på Nordsjö varvsområdeinleddes redan år 1997. Nu, ett decenniumsenare, kan man konstatera att marken saneradesenligt tidtabellen och tillståndsbestämmelserna.Marksaneringen i Nordsjö lyckades enligt förväntningarnaoch kanske till och med överträffade dem.Det bör dock konstateras att vart och ett saneringsskede,trots grundligt förarbete bjöd på överraskningar,bakslag och utmaningar.I miljöundersökningarna av jordmånen frånNordsjö skeppsdocka konstaterade man förhöjdahalter av tungmetaller, oljebaserade kolväten ochPCB-föreningar. Objektet var ett av de första marksaneringsprojekteni Finland i stor skala, där manmed en riskbedömning med hänsyn till hälsan ochmiljön ställde säkra, men samtidigt teknisk-ekonomiskamål för saneringen. Vid geologiska undersökningarkonstaterades höga halter arsen. Ämnetsursprung utreddes i en riskbedömning som gav vidhanden att arsenen som påträffades i fyllnadsmassornaförekommer i de naturliga mineralerna i bergetsom krossats till makadam. Arsenen, som ärmycket svårlöslig, konstaterades inte skada ekosystemeti det närbelägna havsområdet. Detta möjlig-SAMMANDRAG<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö177


gjorde att massorna kunde användas i fyllnadernaunder ytjorden. På så sätt uppnåddes också betydandekostnadsinbesparingar.Halterna organiska tennföreningar som konstateradesi marksubstansen vid saneringen gav ocksåsanerarna bekymmer, eftersom inga officiella gränsvärdenhade ställts för föreningarna. Helsingforsstad och hamnen samt konsulterna som deltog isaneringen löste frågan i ett gemensamt forskningsprojekt,som resulterade bl.a. i en bestämning av hälsorelaterademålvärden för tributyltenn i marken.Våren 2003, när muddringen av lermassor iNordsjö hamnområde skulle påbör<strong>ja</strong>s, påträffadeshöga halter tributyltenn, d.v.s. TBT på havsbottneni hamnområdet. Massorna som enligt planernaskulle muddras på en del av det framtida hamnområdetkunde inte deponeras på hamnprojektets deponeringsområdetill havs såsom planerats och muddringarnakunde inte göras på vanligt sätt. En teknikmåste utvecklas för att havsbottnen skulle kunnasaneras och vattenbyggnadsarbetena för muddringarnasvidkommande utföras i hamnen. Arbetet indeladesi tre etapper. I den första isolerades det förorenadeområdet med skyddsvallar och skyddsgardinerfrån det omgivande havsområdet. I den andra etappensaneringsmuddrades det förorenade sedimentetfrån havsbottnen och flyttades till ett fyllnadsområdesom hade byggts i f.d. Bastöviken. I den tredje etappenmassastabiliserades det förorenade, deponeradesedimentet så att det kunde användas för grundkonstruktionenunder hamnfältet. Därmed isoleradesTBT permanent från havsmiljön.Ett viktigt mål i planeringstävlingen, som anordnadesår 2005, om hamnens områdesbelysning var attminimera en ”ljusförorening” på skydds- och rekreationsområdena.På basis av det vinnande förslagetinleddes fortsatta planerings- och utredningsarbeten,vars omfattning saknar motstycke i Finland.Många utredningar och omfattande uppföljningarFör Nordsjö hamnprojekt har kanske gjorts flera miljöutredningarän för något annat byggprojekt i Finland.Detta beror på att hamnprojektet ligger invidett värdefullt naturområde, samt på att Finlands miljölagstiftningutvecklades snabbt på 1990-talet ochblev mångsidigare. Utredningarna har på ett betydandesätt också påverkat planeringen och byggandet.Slutresultatet är en fungerande och miljöanpassadhamn.I projektet görs en uppföljning av miljökonsekvensernasom även på internationell nivå ärmycket omfattande. En del av uppföljningarna gjordesredan innan byggnadsarbetena påbör<strong>ja</strong>des, de harpågått under byggnadstiden och fortsätter när hamnverksamhetenhar inletts. I uppföljningsprogrammetingår t.ex. uppföljningen av fågelfaunan och växtligheten,uppföljningen av grund- och ytvattnen samtav marina ekosystemet och fiskeriekonomin.2002178SAMMANDRAG<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


SummaryThe Vuosaari Harbour project is one of the largestinfrastructure undertakings in Finland’s history.A new ultramodern harbour has been built in theVuosaari section of Helsinki along with a new roadleading straight to Ring III, a direct link to themain railway line and a new fairway. The VuosaariHarbour will handle unitized cargo shipped incontainers, trucks and trailers. It is located about 15kilometres from the centre of Helsinki. The harbourand the ad<strong>ja</strong>cent business park will form a largelogistics centre.The total cost of the harbour project is about 700million euros, including about 400 million eurosfor the harbour itself and about 300 million eurosfor traffic channels. Private investments in the area,including the logistics centre, will add about 400million euros on top of this.Once the project has been completed, the WestHarbour and the North Harbour will cease operatingand their sites can be used for other purposes. Theseareas can provide housing for about 30 000 personsas well as commercial premises in a seaside settingclose to the centre of Helsinki.Planning the harbourThe Vuosaari district was annexed to Helsinki in1966. Among the main reasons given for this movewere the city’s future energy and harbour needs.During the past thirty years much thought wasgiven to finding a new location for harbour facilitiesin the Helsinki region, and numerous studieswere conducted. In the 1990s studies focused onreorganizing existing harbours, planning alternativelocations and traffic channels, and comparingdifferent options.In 1992 the Vuosaari Harbour project receivedroughly its present form when the Helsinki CityCouncil approved a new master plan. An environmentalimpact assessment got under way in 1994 assoon as the new Environmental Impact AssessmentAct had entered into force.In 1996 the Helsinki City Council approvedVuosaari Harbour Project Feasibility Study anddecided on the preparation of a new city plan for thearea. While this was being done it was also necessaryto prepare a new regional plan for the harbour andtraffic channels as well as a new local plan for thesoutheast part of neighbouring Vantaa. The planningof the harbour area and traffic channels took placealongside this broader planning work.The large size of the project, the filing ofnumerous petitions and the application of newlegislation prolonged the planning and hearingstage. Final decisions concerning traffic channelsand the detailed planning and construction of theharbour area could only be made after Finland’sSupreme Administrative Court had rejected petitionsopposing the new regional plan and city plan in June2002. On 20 July 2004 the European Commissionannounced that it would stop considering petitionsaimed at stopping the Vuosaari Harbour projectinsofar as these concerned the harbour itself.The harbour’s cornerstone was laid in January2003. Since then construction has proceededaccording to plan. The harbour will go into fulloperation in November 2008.Emphasis on protecting the environmentin every stage of planning and constructionThe point of departure in planning and buildingthe harbour has been environmental responsibilityand the need to avoid negative impacts. When theregional plan was being prepared, the decision wasmade to place land traffic channels in a corridor builtmostly underground so as to cause the least possibledisturbance to the environment. The fairway optionthat was chosen was the one that was judged tobe best for navigation and the environment, eventhough it would cost more to build. Further planninghas paid special attention to preserving the naturallandscape and reducing noise.SUMMARY<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö179


The Vuosaari Harbour has been built mainly onthe site of an old shipyard and extensive fill, butseveral recreation areas and routes along with placesof interest from a nature viewpoint also had tomake way for construction. By protecting, cleaningand landscaping neighbouring areas the projecthas strived to compensate for these losses. Thearchitecture has been designed to create a positiveand pleasant urban scene.Construction has been guided by risk analysis andthe necessary measures have been taken to avoid ormanage environmental detriments. Cooperation withother projects in planning transfers of aggregates, forexample, has ensured the most economical solutionfor all parties.The processes, decisions and permit proceduresdescribed in the book provide a good picture of thechallenges and objectives that Finnish environmentallegislation places on major infrastructure projects.The project’s effectsConsolidating the Port of Helsinki’s harbouroperations in Vuosaari offers many operationalbenefits. The project is feasible both socioeconomicallyand in terms of Helsinki’s own finances.It is also in line with sustainable development. Thisis especially true when it comes to reducing trafficemissions in order to fight climate change.Helsinki’s existing cargo harbours are highlyinefficient because they are located on opposite sidesof the city centre. They lack sufficient capacity andhaving functions separated wastes money.The new harbour in Vuosaari will reducenegative environmental impacts. Risks associatedwith transport can also be avoided. Noise fromthe harbour and harbour traffic will be confined toareas with fewer residents compared with the oldharbours and the corridor leading to the harbour.Rail traffic will be more competitive as a carrier.Housing, commercial premises and offices can bebuilt in the downtown areas now occupied by the oldharbours. This will help balance the social structureand reduce traffic volumes and emissions.Building a new harbour next to an area withconsiderable conservation values placed strictrequirements on the quality of planning andconstruction. The harbour’s impacts on theneighbouring Natura 2000 area made the processextremely challenging. After many stages Finland’sSupreme Administrative Court issued a decision on2002 concerning the Vuosaari Harbour and trafficchannels and noted that the environmental impactassessment and statement process indicated that theproject would cause the deterioration of some habitatsbut it did not show that this would significantlydisturb the species for which the Mustavuori herbrichforest and Östersundom bird wetlands had beenincluded in the Natura 2000 network, as proscribedin section 66:1 of the Nature Conservation Act andArticle 6 of the Habitats Directive,New technical solutionsClean-up measures in the Vuosaari shipyard basinbegan in 1997. Over the past decade contaminatedsoil has been removed according to the agreedtimetable and permit conditions. The clean-upwas successfully conducted and even exceededexpectations. It should be mentioned, however,that every stage of work – regardless of carefulpreparations – produced surprises, setbacks and newchallenges.This was one of the first large-scale clean-upsin Finland in which risk assessment was used tomeet health and environmental as well as technicaleconomicobjectives. In environmental studies ofthe area, elevated concentrations of heavy metals,as well as oil hydrocarbons and PCB-compoundshad been found. Also, elevated arsenic levels werecommonly observed in the area. A geological riskanalysis confirmed the origin of the arsenic to belocal rock that had been crushed and used as fill. Thearsenic, that was proven to be practically insoluble,was found to present no threat to the ecosystemin nearby waters. This made it possible to use soilin subsurface fill, at the same time significantlylowering costs.During the clean-up concentrations of organotincompounds also caused problems since officialguidelines had not been set for them. A riskassessment oriented research project was conductedjointly by the City of Helsinki, the Port of Helsinkiand consultants involved in the clean-up to find a180SUMMARY<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö


solution, and as a result health-based target valuesin soil were set for tributyltin (TBT), among otherthings.In spring 2003, when the dredging of claysediments in the Vuosaari Harbour area was setto begin, elevated levels of tributyltin (TBT) wereobserved in sediment samples. Part of the sedimentthat was meant to be dredged could not be taken outto sea for dumping, nor could dredging proceed inthe normal way. It was necessary to find a solutionso that contaminated sediment could be removedand water construction work could proceed. Thesolution consisted of three main stages. In the firststage the contaminated area was isolated from thesurrounding sea area by protective embankmentsand a silt curtain structure. In the second stage thecontaminated sediment was removed from the seabedby decontamination dredging and was transferredto a filling area built in the former Niinilahti Bay.In the third stage the contaminated sediment wasmass stabilized and utilized as a part of the harbour’sfield structures. In this way TBT was permanentlyisolated from the marine environment.When a competition was arranged in 2005 tocome up with a plan for harbour lighting, one ofthe main goals was to minimize light pollution innearby nature reserves and recreation areas. Furtherplanning and research were conducted on the basis ofthe winning entry, on a scale that was unprecedentedin Finland.Extensive studies and monitoringMore environmental studies have no doubt beenconducted for the Vuosaari Harbour project thanfor any other construction project in Finland. Thisis because of the project’s location next to an areawith considerable conservation values and the rapiddevelopment of environmental legislation in Finlandin the 1990s. Studies have also had an importantinfluence on the planning and implementation of theproject. The result is an efficient harbour that fits inits environment.Environmental monitoring of the project hasbeen extensive even by international standards.Monitoring began on a smaller scale beforeconstruction, was conducted on a regular basisthroughout the construction stage and will befollowed up after the harbour goes into operation.The monitoring programme covers e.g. bird life andplant life monitorings, inland water monitoring andmarine ecosystem and fishery monitoring.2008SUMMARY<strong>Vuosaaren</strong> <strong>satama</strong> <strong>ja</strong> ympäristö181


Julkaisi<strong>ja</strong>t:<strong>Vuosaaren</strong> <strong>satama</strong>n rakennusprojekti, VUOSA<strong>Vuosaaren</strong> <strong>satama</strong>n liikenneyhteydet, VUOLIKartat:© Maanmittauslaitos, lupa nro 875/MML/08© Affecto Finland Oy, Karttakeskus, Lupa L7706/08Taitto:Miuraad OyPainotyö <strong>ja</strong> sidonta:Gummerus Kir<strong>ja</strong>paino Oy 2008ISBN (painettu julkaisu): 978-952-223-250-2ISBN (verkkojulkaisu): 978-952-223-522-0

Hooray! Your file is uploaded and ready to be published.

Saved successfully!

Ooh no, something went wrong!