Rapport d'activités 2004 - FNR

fnr.lu

Rapport d'activités 2004 - FNR

Fonds National

de la Recherche Luxembourg

» RAPPORT D’ACTIVITES 2004


Fonds National

de la Recherche Luxembourg

» RAPPORT RAPPORT D’ACTIVITES 2004 2004


Fonds National de la Recherche


RAPPORT D’ACTIVITES 2004

TABLE DES MATIERES

6

10

14

20

21

33

39

51

63

69

91

93

100

Summary / Résumé

Préfaces

par Romain Henrion, Président du Conseil d’Administration

par Jean-Frank Wagner, Président du Conseil Scientifique

I. Missions et fonctionnement

II. Les programmes de recherche pluriannuels en cours

» Programme SECOM

» Programme NANO

» Programme EAU

» Programme BIOSAN

» Programme PROVIE

» Programme VIVRE

» Programme TRASU

» Programme SECAL

III. Les mesures d’accompagnement

116

118

119

121

123

127

IV. Collaborations internationales en 2004

» ESF

» ERCIM

» COST

» ERA-NET

» AUTRES

130

134

138

V. Autres activités en 2004

VI. Activités prévues en 2005 et au-delà

VII. Bilan financier 2004

FONDS NATIONAL DE LA RECHERCHE

6, rue Antoine de Saint-Exupéry (3 e étage)

B.P. 1777 | L-1017 Luxembourg – Kirchberg

Tél. +352 26 19 25 – 1

Fax +352 26 19 25 – 35

fnr@fnr.lu

www.fnr.lu

Table des matières

5


The National Research Fund was set up by the Law of May 31, 1999 in order to stimulate research

activities in Luxembourg with the aim

» to create new competence and knowledge,

» to strengthen existing competence and knowledge and

» to develop national and international synergies in order to increase the attractiveness of

Luxembourg as a scientific and economic site of excellence.

Projects and Highlights:

Multiannual national R&D priority programmes:

The following multiannual research programmes have been launched since 2000:

Duration Programme Title Budget

2000 – 2007 Security and efficiency of new practices in e-commerce 7.500.000 €

for all socio-economic actors (SE-COM)

How to participate in these programmes?

In the framework of these programmes, the Fund announces periodic calls for research projects.

The selected projects benefit from a financial contribution granted by the Fund.

Further information concerning the calls for research projects can be found on the internet site

of the Fund www.fnr.lu.

To whom are the calls addressed?

Calls are addressed to public institutions, Luxembourg administrations and public establishments

authorized to undertake R&D activities or technology transfer in their respective fields of activity.

6

Summary

SUMMARY

New materials and nanotechnology (NANO) 6.700.000 €

Sustainable management of water resources (EAU) 5.000.000 €

2000 – 2008 Health and Biotechnology (BIOSAN) 6.000.000 €

2002 – 2009 Living tomorrow in Luxembourg (VIVRE) 12.000.000 €

2003 – 2008 Medical aspects of ageing (PROVIE),

Extension of BIOSAN 2.500.000 €

2003 – 2009 Surface treatment (TRASU) 6.000.000 €

2003 – 2009 Food safety (SECAL) 6.000.000 €


Accompanying measures:

In addition to the support of research as such, the Fund subsidizes accompanying measures aiming

to strengthen the general frame of scientific research in Luxembourg. Thus, the Fund launches regular

calls for proposals concerning the promotion of

» scientific awareness,

» international scientific cooperation, and

» national coordination in research.

The accompanying measures are divided into eight categories:

MA1: Various measures for promoting scientific awareness,

national R&D coordination and international scientific cooperation

MA2: Active participation of novice researchers in a scientific conference

MA3: Organisation of a scientific conference in Luxembourg

MA4: a) Publication of a doctoral thesis or b) scientific publication

MA5: Preparation of a European Union research project

MA6: Mobility of researchers

MA7: Promotion of Patents

SF: Science Festival

How to participate in these programmes?

For the accompanying measures MA1/MA3/MA6 the submission dates are on the 1st of April

and the 1st of October of each year.

For the remaining measures, the Fund should be contacted directly.

All the relevant information concerning the accompanying measures can be found in detail on the

internet site www.fnr.lu.

To whom are the calls addressed?

These measures are addressed to a larger public:

» public institutions or services authorised to undertake R&D activities,

» private associations,

» individuals who pursue activities of a scientific nature, including students.

European Partnerships:

The National Research Fund is a member of:

» the European Science Foundation (ESF),

» EUROHORCS, European Union Research Organisations’ Heads of Research Councils,

» ERCIM, European Research Consortium for Informatics and Mathematics,

» ICSU, International Council for Science.

Since 2003, the Fund has been participating in three ‘European Research Area Networks’ (ERA-Net),

concerning research in ageing, materials’ research and research in neurology. In the year 2005, the Fund may

participate in other ERANETs.

To receive further information, please visit the Fund’s website www.fnr.lu or send an email to fnr@fnr.lu.

The annual report is available in a summarized printed English version upon request at fnr@fnr.lu or may be downloaded from

www.fnr.lu.

Summary

7


Le Fonds National de la Recherche a été créé par la loi du 31 mai 1999 dans le but de donner une

impulsion supplémentaire aux activités de recherche au Luxembourg et notamment afin de:

» favoriser la création de nouvelles compétences,

» renforcer les compétences en place et

» développer des synergies nationales et internationales, afin de rendre le site du Luxembourg

encore plus attrayant en matière scientifique et économique.

Moyens mis en œuvre:

Programmes pluriannuels:

Depuis 2000, le Fonds a travaillé sur les programmes suivants:

Durée Dénomination Budget

2000 – 2007 Sécurité et efficacité des nouvelles pratiques du commerce 7.500.000 €

électronique pour tous les acteurs socio-économiques (SECOM)

Comment participer à ces programmes?

Dans le cadre de ces programmes, le Fonds procède à un ou plusieurs appels à propositions de projets.

Les projets retenus bénéficient alors du concours financier en partie ou totalement du Fonds National

de la Recherche.

Les renseignements relatifs à ces appels sont accessibles via le site www.fnr.lu.

A qui s’adressent-t’ils?

Ces appels s’adressent aux organismes, services et établissements publics luxembourgeois autorisés à

entreprendre, dans les domaines qui les concernent, des activités de recherche ainsi que de développement

et de transfert technologiques.

8

Résumé

RESUME

Matériaux innovateurs et nanotechnologie (NANO) 6.700.000 €

Gestion durable des ressources hydriques (EAU) 5.000.000 €

2000 – 2008 Biotechnologie et Santé (BIOSAN) 6.000.000 €

2002 – 2009 Vivre demain au Luxembourg (VIVRE) 12.000.000 €

2003 – 2008 Processus de vieillissement (PROVIE),

extension du programme BIOSAN 2.500.000 €

2003 – 2009 Traitements des surfaces (TRASU) 6.000.000 €

2003 – 2009 Sécurité alimentaire (SECAL) 6.000.000 €


Mesures d’accompagnement:

En complément au financement de la recherche proprement dite à travers les programmes pluriannuels,

le Fonds subventionne des mesures d’accompagnement pour renforcer le cadre général de la recherche

scientifique au Luxembourg. Ainsi le Fonds lance régulièrement des appels à propositions d’activités

pour la promotion

» de la culture scientifique,

» de la coopération scientifique internationale et

» de la coordination nationale en matière de recherche.

Ces mesures d’accompagnements sont classées comme suit:

MA1: Diverses mesures de promotion de la culture scientifique, de la coopération scientifique

internationale ou de la coordination nationale en matière de recherche

MA2: Participation active de chercheurs débutants à des conférences scientifiques

MA3: Organisation de conférences scientifiques au Luxembourg

MA4: Publication d’ouvrages scientifiques/de thèses de doctorat

MA5: Préparation de projets de recherche européens

MA6: Mobilité des chercheurs

MA7: Promotion de brevets

SF: Festival des Sciences

Comment participer à ces mesures?

Pour les mesures MA1/MA3/MA6, le Fonds procède deux fois par an à des appels avec des délais de

soumission le 1 er avril et 1 er octobre de chaque année.

Pour les autres, il convient de s’adresser directement au Fonds.

Tous les appels pour ces mesures sont consultables sur le site www.fnr.lu

A qui s’adressent t’elles?

Certaines mesures peuvent concerner un public plus large:

» les organismes ou services publics autorisés à entreprendre des activités de R&D,

» les associations, et

» les particuliers poursuivant des activités au service de la recherche, notamment des étudiants.

Le Fonds en Europe:

Le Fonds National de la Recherche est membre de:

» la Fondation Européenne des Sciences (ESF),

» EUROHORCS, European Union Research Organisations’ Heads of Research Councils,

» ERCIM, European Research Consortium for Informatics and Mathematics, et

» ICSU, International Council for Science.

Depuis 2003, le Fonds participe à trois réseaux européens ‘ERANET’ (European Research Area Networks),

concernant la recherche sur le vieillissement, les sciences des matériaux et la neurologie. La participation

à d’autres ERANET sera explorée pour 2005.

Le site internet www.fnr.lu est à votre disposition pour plus d’informations.

Vous pouvez aussi nous envoyer un mail à l’adresse suivante: fnr@fnr.lu

Résumé

9


PREFACE

» Romain Henrion

Romain Henrion

Président du Conseil d’Administration

Après cinq ans d’existence, le Fonds National de la Recherche a invité, en décembre 2004, un comité

d’experts de renommée internationale pour l’aider à s’orienter au niveau du choix de ses futures priorités.

Les experts ont confirmé que pour un pays de la taille du Luxembourg il est primordial de poursuivre

une recherche stratégique dans un nombre de domaines limité, domaines définis en collaboration avec

tous les acteurs concernés, suivant la méthode que le Fonds applique depuis sa création en 1999.

Les experts ont ajouté que le Fonds devrait également tirer des conclusions pour de futurs programmes

de son analyse des forces et faiblesses réalisée pour ses programmes en cours.

Étant donné que les premiers programmes pluriannuels du Fonds viendront à échéance en 2007, nous

venons de lancer un appel à propositions afin de déterminer des thématiques prometteuses pour les

nouveaux programmes pluriannuels de recherche qui seront mis en place à partir de 2006. Les propositions

qui nous parviendront dans le cadre de cet appel seront discutées avec tous les partenaires potentiels

au Luxembourg afin de ne cibler que les axes de recherche prioritaires que nous proposerons au

Gouvernement pour orienter la politique R&D du pays.

Nous avons également l’intention d’entamer, encore en 2005, une étude foresight afin de découvrir

et d’analyser de nouvelles opportunités pour la recherche au Luxembourg, et ceci en collaboration avec

les différents acteurs du monde économique, politique et de la société en général. En parallèle, le Ministère

de la Recherche envisage de réaliser avec l’OCDE une évaluation de la recherche au Luxembourg.

Les résultats de ces deux études constitueront certainement un outil essentiel pour la définition des

futures priorités de recherche pour le pays.

Au niveau des programmes pluriannuels en cours, après une première phase de mise en place des compétences

au niveau national, le besoin de collaborations scientifiques renforcées avec l’étranger se fait

ressentir. Dans le contexte du développement de l’espace européen de la recherche, les coopérations

au niveau des projets de recherche devront donc être amplifiées.

Afin d’encourager cet élan, le Fonds est en train d’élaborer un nouveau programme INTER visant à

une meilleure promotion de la coopération scientifique internationale, moyennant la participation à

des activités de recherche bi- ou multilatérales existantes ou futures. Ce programme sera prochainement

soumis au Conseil de Gouvernement pour accord.

10

Préface


Afin d’assurer la suite des activités déjà engagées, les acteurs de la recherche au Luxembourg devront

continuer à recevoir le soutien nécessaire. Au niveau des bâtiments et infrastructures, les perspectives

sont prometteuses. La Cité des Sciences, de la Recherche et de l’Innovation sera construite à partir de

2005 sur les friches d’Esch-Belval et constituera une occasion extraordinaire pour réunir différents acteurs

d’orientations complémentaires.

L’esprit d’entrepreneur devra se développer autour de ces pôles de recherche afin de permettre le transfert

du savoir vers des micro-entreprises créées par des chercheurs, en collaboration avec le secteur privé.

Dans ce domaine, nous suivrons l’exemple d’autres pays qui ont su combiner de manière efficace des

politiques de recherche avec d’autres instruments afin d’accroître leur compétitivité.

Nous avons ainsi pris note, avec beaucoup d’intérêt, de la signature d’un accord de coopération entre

la Société Nationale des Crédits à l’Investissement et les trois centres de recherche publics afin de soutenir

des start-ups avec le capital à risque nécessaire pour la première phase de leur existence. De tels

instruments, visant les acteurs de la recherche publique, ont fait défaut jusqu’à présent.

Le Fonds est également conscient qu’il ne suffit pas d’intéresser un public adulte à la recherche, mais

que, pour mieux préparer l’avenir, il faut surtout éveiller l’intérêt des jeunes pour la recherche. Les activités

telles que développées par exemple par le Science Club, ainsi que le Science Festival – qui sera organisé

pour la cinquième fois en octobre 2005 – vont dans ce sens.

Le développement de l’Université du Luxembourg offre, de son côté, un nouveau potentiel de développement

de la recherche au niveau national. Nous avons déjà pu nous échanger à plusieurs reprises avec

les responsables de l’Université et nous sommes conscients de l’importance d’une étroite collaboration

entre l’Université et les organismes de recherche qui pourra se manifester par exemple au sein des projets

du Fonds.

Le Fonds National de la Recherche continuera à s’investir afin de rendre le Luxembourg encore plus

attrayant du point de vue scientifique et économique.

Romain Henrion

Président

Préface

11


PREFACE

» Jean-Frank Wagner

Jean-Frank Wagner

Président du Conseil Scientifique

Pour le Fonds National de la Recherche, l’année 2004 a été une année de premiers bilans.

Les premiers projets de recherche se sont terminés avec succès, et les premières évaluations des programmes

en cours – SECOM, NANO, EAU, BIOSAN et VIVRE – ont eu lieu lors de réunions de comités de pilotage,

composés d’experts étrangers indépendants.

Les premiers mandats des membres du conseil scientifique et du conseil d’administration du Fonds

National de la Recherche sont venus à leur terme et les deux conseils ont été renouvelés à partir de 2005.

Je voudrais d’ailleurs remercier les membres de ces deux premiers conseils, au nom des responsables

du Fonds, pour le travail accompli et pour leur investissement personnel dans la recherche au Luxembourg.

Les premiers bilans des travaux du Fonds National de la Recherche nous permettent d’affirmer que

nous avons atteint notre objectif principal, à savoir de donner une impulsion supplémentaire à la recherche

au Luxembourg.

En effet, les projets de recherche commencent à donner des premiers résultats très prometteurs, tels

que des premières retombées socio-économiques ou encore des publications scientifiques dans des revues

de renommée internationale.

Au total, durant les cinq premières années de son existence, le Fonds a initié 52 projets de recherche

avec un financement de plus de 40 millions d’euros. Tous ces projets contribuent à rendre le Luxembourg

plus attrayant du point de vue de la recherche, et à attirer des chercheurs, internationaux mais surtout

aussi luxembourgeois, qui n’auraient pas envisagé la possibilité de s’établir ou de retourner au Luxembourg

il y a cinq ans.

Nous devrons continuer à investir dans les compétences et à promouvoir les carrières professionnelles

de ces chercheurs au Luxembourg, aussi bien dans le secteur public qu’en échange avec le secteur

privé. Ceci afin d’offrir des postes plus stables et un environnement de recherche plus intéressant aux

chercheurs de tous niveaux, jeunes et avancés.

Dans ce contexte, nous nous réjouissons de constater que le Gouvernement luxembourgeois attribue

une très grande importance à la recherche et au développement de l’Université du Luxembourg, et

qu’il prévoit de porter à terme l’investissement public relatif à la R&D à 1% du PIB, conformément

aux objectifs établis par le Sommet européen de Barcelone.

12

Préface


Il reste cependant beaucoup à faire si, en tant que pays, nous voulons nous positionner à long terme

sur la scène internationale de la recherche.

Ainsi, les pays asiatiques connaissent un essor sans pareil et investissent de plus en plus dans la recherche,

surtout dans la recherche technologique et biomédicale. Si nous désirons augmenter notre visibilité à

l’avenir, nous devons nous préparer à affronter la mondialisation et les changements inévitables qui y

sont liés et qui se font déjà ressentir dans le monde de la recherche. Il faudra, avant tout, ne pas avoir

peur de ces changements.

En effet, au Luxembourg, nous sommes dans la position assez confortable d’avoir un marché du travail

assez sain et un endettement relativement faible. Il faut être conscient de cet avantage pour pouvoir

le maintenir. Les progrès technologiques et scientifiques sont les seuls à pouvoir assurer notre bien-être

à long terme.

Pour autant, nous ne devrons pas limiter la recherche à des domaines où l’utilité économique paraît

immédiate. Nous avons surtout besoin d’une culture de la recherche qui fasse partie de la culture générale

de chaque membre de notre société. Par cette culture, nous arriverons à créer une ambiance favorable à

la recherche, et à attirer des chercheurs au Luxembourg pour qu’ils y construisent les futures entreprises

et les futures générations du pays.

Dans le présent rapport, vous trouverez des exemples précis de projets de recherche et de résultats en

termes de publications scientifiques ou autres. Je vous souhaite une bonne lecture, tout en espérant

que les activités du Fonds National de la Recherche contribuent à créer au Luxembourg la culture de

la recherche mentionnée.

Jean-Frank Wagner

Président du Conseil Scientifique

Préface

13


I. Missions et fonctionnement

14

Missions et fonctionnement


MISSIONS

En application des dispositions de l'article 2 de la loi du 31 mai 1999 portant création d'un fonds national

de la recherche dans le secteur public, le Fonds a pour mission:

» De recevoir, de gérer et d'employer des allocations et dons provenant de sources publiques ou privées

en vue de la promotion sur le plan national de la recherche et du développement technologique

dans le secteur public, appelés par la suite «R&D», ainsi que

» D'entretenir un processus de réflexion continu en vue de l'orientation de la politique nationale en

R&D, suivant les données économiques et l'évolution scientifique et technologique ainsi que sur la

base d'études approfondies.

Rôle du Fonds

» Elaborer des propositions relatives aux objectifs de la politique nationale en matière de R&D,

» Proposer les actions prioritaires en vue d'atteindre ces objectifs,

» Elaborer, en vue des priorités retenues, des programmes pluriannuels d'activités et contribuer par ce

biais à l'établissement d'un programme pluriannuel de la R&D au plan national,

» Assurer par l'attribution des moyens financiers mis à sa disposition la réalisation de ces programmes

d'activités pluriannuels et veiller au suivi de leur mise en œuvre,

» Assurer l'évaluation systématique et continue des résultats obtenus, afin de permettre tout réajustement

des priorités s'avérant nécessaire,

» Promouvoir en général une coordination efficiente des actions nationales en R&D ainsi que la participation

luxembourgeoise aux programmes de coopération internationale en R&D,

» Présenter, de sa propre initiative, au ministre ayant dans ses attributions la recherche scientifique et

la recherche appliquée, toute proposition, suggestion et information relative à la mise en oeuvre de

la politique nationale de R&D.

Les bénéficiaires

» Les centres de recherche publics créés sur base de la loi du 9 mars 1987 ayant pour objet:

1. l’organisation de la recherche et du développement technologique dans le secteur public,

2. le transfert de technologie et la coopération scientifique et technique entre les entreprises et le

secteur public;

» l’université du Luxembourg;

» le Centre d’Etudes de Populations, de Pauvreté et de Politiques Socio-économiques créé par la loi

du 10 novembre 1989; ainsi que

» les organismes, services et établissements publics autorisés à entreprendre, dans les domaines qui

les concernent, des activités de recherche ainsi que de développement et de transfert technologiques

visant à promouvoir le progrès scientifique ou l’innovation technologique.

Les moyens mis en place

Dans le cadre de sa mission, le Fonds peut:

» organiser des activités visant la promotion de la culture scientifique,

» attribuer des bourses à des chercheurs et scientifiques,

» allouer des subsides à des particuliers ainsi qu’à des associations poursuivant des activités à caractère

scientifique, et

» faire participer ces bénéficiaires précités aux programmes organisés par la Communauté européenne

ou par des organisations internationales.

Missions et fonctionnement

15


FONCTIONNEMENT

Le Fonds National de la Recherche, établissement public jouissant de l’autonomie scientifique, financière

et administrative, est géré par un Conseil d'Administration, assisté d'un Conseil Scientifique et d’un

secrétariat.

Le Conseil d’Administration

» Le Conseil d’Administration est constitué de:

» un membre proposé par chacun des ministres concernés ayant dans leurs attributions la recherche

scientifique et la recherche appliquée, l’enseignement supérieur, la recherche-développement industrielle

et le transfert de technologies respectivement le budget,

» deux membres proposés par le Conseil de Gouvernement après consultation des autres ministres organisant

de la R&D,

» six membres proposés par le Gouvernement parmi des personnalités du secteur privé reconnues pour

leur compétence en matière de R&D.

Président

Vice-Président

Président

Vice-Président

Composition du Conseil d’Administration

Membres du Conseil d’Administration de 2000 à 2004

» Romain HENRION, Arcelor S.A.

» Roland JAEGER, SES Global

» Raymond BAUSCH, Ministère de la Culture, de l'Enseignement supérieur et de la Recherche

» Germain DONDELINGER, Ministère de la Culture, de l'Enseignement supérieur et de la Recherche

» Theo FAMULOK, GoodYear S.A. e.r.

» Jean-Marie HAENSEL, Inspection Générale des Finances

» Danielle HANSEN-KOENIG, Ministère de la Santé

» Romain KEISER, Galvalange s.à.r.l.

» Henri METZ, Section Médicale de l'Institut Grand-Ducal

» François MEYER, Gencell, France

» Pierre-Marie VALENNE, Banque Privée Edmond de Rothschild Europe

» Marco WALENTINY, Ministère de l'Economie

Membres du Conseil d’Administration de 2005 à 2009

» Romain HENRION, ARCELOR S.A.

» Pierre-Marie VALENNE, Banque Privée Edmond de Rothschild Europe

» Raymond BAUSCH, Ministère de la Culture, de l'Enseignement Supérieur et de la Recherche

» Jean BERGH, Goodyear S.A. Technical Center Luxembourg

» Germain DONDELINGER, Ministère de la Culture, de l'Enseignement Supérieur et de la Recherche

» Yves ELSEN, Hitec Luxembourg S.A.

» Jean-Marie HAENSEL, Inspection Générale des Finances

» Danielle HANSEN-KOENIG, Ministère de la Santé

» Romain KEISER, Galvalange s.à.r.l.

» Henri METZ, Section Médicale de l'Institut Grand-Ducal

» François MEYER, Gencell SAS, France

» Marco WALENTINY, Ministère de l'Economie

16

Missions et fonctionnement


Le Conseil Scientifique

Il assiste le Conseil d’Administration en tant qu’organe consultatif en matière scientifique.

Le conseil scientifique comprend:

» un représentant par centre de recherche public (CRP Henri Tudor, CRP Gabriel Lippmann, CRP Santé),

» un représentant du Centre d’Etudes de Populations, de Pauvreté et de Politiques Socio-Economiques

(CEPS/INSTEAD),

» deux représentants de l’Université du Luxembourg créée par la loi du 12 août 2003,

» des personnalités, luxembourgeoises ou étrangères, extérieures aux établissements visés ci-dessus, choisies

en raison de leur compétence. Leur nombre dépasse d’une unité le nombre des établissements précités.

Composition du Conseil Scientifique

Président

Membres du Conseil Scientifique de 2000 à 2004

» Jean-Frank WAGNER, Université de Trèves, Allemagne

» Jean DE LA HAMETTE, Centre de Recherche Public Henri Tudor

» Gusty FEYDER, DuPont Teijin Films Luxembourg S.A.

» Marc GENGLER, Ecole Supérieure d'Ingénieurs de Luminy/Marseille, France

» Joseph LAHR, Université du Luxembourg

» Fernand MULLER, Dometic s.à.r.l.

» Délia NILLES, Université de Lausanne, Ecole des HEC, Suisse

» Fernand REINIG, Centre de Recherche Public Gabriel Lippmann

» Gaston SCHABER, Centre d'Etudes de Populations, de Pauvreté et de Politiques Socio-Economiques

» François SCHNEIDER, Centre de Recherche Public Santé

» Susy SCHOLL, Institut Curie, Paris, France

» Norbert VON KUNITZKI, Université du Luxembourg

» Pierre WILTZIUS, Beckmann Institute, University of Illinois, USA

Président

Membres du Conseil Scientifique de 2005 à 2009

» Jean-Frank WAGNER, Université de Trèves, Allemagne

» Jean DE LA HAMETTE, Centre de Recherche Public Henri Tudor

» Adelheid EHMKE, Université du Luxembourg

» Gusty FEYDER, DuPont Teijin Films Luxembourg S.A.

» Marc GENGLER, Ecole Supérieure d'Ingénieurs de Luminy/Marseille, France

» Jean-Paul LEHNERS, Université du Luxembourg

» Fernand MULLER, Dometic s.à.r.l.

» Délia NILLES, Université de Lausanne, Ecole des HEC, Suisse

» Fernand REINIG, Centre de Recherche Public Gabriel Lippmann

» Gaston SCHABER, Centre d'Etudes de Populations, de Pauvreté et de Politiques Socio-Economiques

» Fernand WAGNER, Centre de Recherche Public Santé

» Pierre WILTZIUS, Beckman Institute, University of Illinois, USA

Le Secrétariat

Le secrétariat du Fonds comprend:

» Raymond BAUSCH, secrétaire général, raymond.bausch@fnr.lu

» Carlo DUPREL, superviseur de programmes, carlo.duprel@fnr.lu

» Frank GLOD, superviseur de programmes, frank.glod@fnr.lu

» Christiane KAELL, superviseur de programmes, christiane.kaell@fnr.lu

» Ulrike KOHL, superviseur de programmes, ulrike.kohl@fnr.lu

» Sylvie HEINISCH, assistante administrative, sylvie.heinisch@fnr.lu

» Jill MOUSEL, assistante du secrétaire général, jill.mousel@fnr.lu

» Susana Pinto, assistante administrative, susana.pinto@fnr.lu

» Garance Muraille, stagiaire du 1 er mars au 31 mai 2004

» Bob Mousel, du 12 juillet jusqu’au 31 août 2004 (occupation pendant les vacances scolaires)

Missions et fonctionnement

17


PROCEDURES GENERALES DE

SELECTION DE PROJETS DE RECHERCHE

Les procédures de sélection des projets de recherche sont basées sur la loi du 31 mai 1999 portant

création du Fonds National de la Recherche et le Règlement grand-ducal du 27 juillet 2000. Le Fonds

élabore des programmes pluriannuels d'activités et lance des appels à propositions de projets de recherche

dans le cadre de ces programmes.

Le Conseil Scientifique désigne un expert, dit rapporteur, qui a comme tâche de coordonner l’évaluation

de projets soumis et de présenter les résultats de l’évaluation auprès du Conseil d’Administration et du

Conseil Scientifique du Fonds. Le rapporteur nomme au moins 3 experts indépendant par projet de recherche.

Le Conseil d’Administration et le Conseil Scientifique ont le droit de nommer des experts supplémentaires

si nécessaire.

Critères retenus pour l'évaluation des projets

L’évaluation des propositions de projets, par les experts, se fait selon les critères suivants:

» qualité scientifique (créativité et innovation, cohérence, travail interdisciplinaire, niveau de compétence

reconnu au niveau international),

» intérêt socio-économique,

» rapport entre les dépenses de réalisation prévues et les résultats escomptés,

» concordance avec les objectifs et priorités des programmes d'activités en cours,

» caractère réaliste par rapport au contexte luxembourgeois,

» caractère mobilisateur sur le plan national,

» répartition des moyens budgétaires équilibrée: entre l'acquisition de compétences, l'aspect recherche,

diffusion et la valorisation des résultats de recherches.

Suivant les résultats d’évaluation, le rapporteur soumet au Conseil Scientifique une liste des propositions

à retenir pour une contribution financière. La décision finale est prise par le Conseil d’Administration

sur avis du Conseil Scientifique. Ainsi, une proposition de projet peut être:

» acceptée,

» rejetée, ou

» retournée pour modification.

Les proposants sont informés des résultats de l’évaluation de leur projet et une justification écrite est

donnée pour chaque projet rejeté. Lorsqu’un projet a été accepté, une convention entre le Fonds et

les contractants est négociée et signée.

Concernant les projets acceptés sous réserve de modifications, le rapporteur, en consultation avec des

experts éventuels, évalue les versions re-soumises et présente ses commentaires au Conseil Scientifique

et au Conseil d’Administration pour avis et décision finale.

18

Missions et fonctionnement


Modalités actuelles de mise en œuvre des projets FNR

Conseil d’Administration

4. Soumission des projets

pour décision

Conseil Scientifique

3. Soumission

des projets pour avis

3. Avis indépendants

4. Avis indépendants

Rapporteur et

Experts

Secrétariat du Fonds

5. Signature de contrats pour

projets acceptés

1. Appel à propositions de projet

dans le cadre d’un programme

pluriannuel

2. Proposition de projets

dans le cadre du programme

pluriannuel

Organismes de recherche publics

Procédures générales de sélection de programmes pluriannuels

En premier lieu, le Fonds a défini ses programmes d’activités pluriannuels basés sur des propositions

des acteurs nationaux en matière R&D:

Lors de l’élaboration de ses premiers programmes pluriannuels en 2000 et 2002, le Fonds a lancé deux

appels à propositions de programmes où les acteurs du domaine de la recherche du secteur public et

privé ainsi que des proposants individuels ou institutionnels ont pu soumettre leurs suggestions.

La sélection des propositions a été réalisée par une évaluation basée sur les critères suivants:

» qualité scientifique (créativité et innovation, cohérence, travail interdisciplinaire, niveau de compétence

reconnu au niveau international),

» intérêt socio-économique,

» caractère réaliste par rapport au contexte luxembourgeois,

» caractère mobilisateur sur le plan national,

» répartition des moyens budgétaires.

Le Conseil d’Administration du Fonds National de la Recherche a décidé des propositions à retenir sur

avis du Conseil Scientifique.

Un group d’experts a alors été formé pour définir le contenu spécifique des programmes. Après l’intégration

des modifications suggérées par le Conseil Scientifique et des experts internationaux, un texte

final et une proposition de budget ont pu être soumis pour adoption au Gouvernement par le Conseil

d’Administration.

Missions et fonctionnement

19


II. Les programmes

de recherche pluriannuels en cours

20

Les programmes de recherche pluriannuels en cours


»

PROGRAMME SECOM

Sécurité et efficacité des nouvelles pratiques du commerce

électronique pour tous les acteurs socio-économiques

Durée: 2000 – 2007

Budget total: 7.500.000 €

Appels en 2001 et 2004: 9 projets sélectionnés

Le programme SECOM a pour finalité la compétitivité de l’économie luxembourgeoise. Il vise à

soutenir le développement d’une demande éclairée et d’une offre performante appropriée à la nouvelle

économie. Ce développement requiert de maîtriser le contexte du commerce et de la coopération

électroniques, dans une approche globale de qualité qui doit intégrer solidairement la résolution de

deux problématiques nécessitant des efforts conjoints en R&D:

» les problèmes de sécurité, visant la confidentialité, la disponibilité et l’intégrité des systèmes

d’échanges électroniques;

» les problèmes de coopération, visant la spécification et la conception des règles juridiques,

organisationnelles et logicielles liées à la mise en place de plate-formes virtuelles regroupant

plusieurs acteurs économiques coopérant par des moyens électroniques.

En vue d’améliorer la maîtrise des nouveaux contextes de coopération électronique, le programme

SECOM développera une recherche intégrée sur la sécurité des échanges électroniques et sur l’efficacité

des nouveaux modèles organisationnels et logiciels de coopération électronique. L’application de ces

résultats de recherche sera particulièrement confrontée aux réalités des secteurs des services et des

PME qui constituent un fort potentiel de production de biens et de services au Luxembourg, sans

écarter, toutefois, les autres secteurs dont l’impact sur la société de l’information est démontré.

Secom

21


Afin de juger des états d’avancement des différents projets en cours ainsi que du programme SECOM

en général, un comité de pilotage composé d’experts internationaux s’est réuni le 16 janvier 2004 à

Luxembourg. Les membres du comité de pilotage ont donné un avis globalement positif concernant

la qualité et le contenu du programme et des projets en cours. De nouvelles compétences ont été créées

et les objectifs du programme ont été jugés globalement atteints. Pour encore mieux exploiter le

potentiel du programme SECOM les experts ont exprimé les recommandations suivantes:

» étendre le programme SECOM, afin d’assurer la pérennité des équipes de chercheurs et une qualité

durable des recherches;

» une coopération plus étendue avec des instituts de recherche nationaux ou internationaux;

» la publication d’articles dans des revues et des conférences reconnues pour valoriser les résultats

obtenus.

Dans le cadre du programme SECOM le Fonds National de la Recherche a lancé le 1 er avril 2004 un

deuxième appel à projets de recherche à la suite duquel quatre projets ont été retenus. L’évaluation a

été réalisée à l’aide d’un rapporteur désigné par le conseil scientifique et sur base d’avis rédigés par

des experts indépendants. Les projets démarreront début 2005.

Projets du programme SECOM:

Efficient Platform for

du Luxembourg

the e-Commerce of

Personalized Health Products

and Ad-hoc Networks,

du Luxembourg

TeSeGrAd

des nouvelles formes

Gabriel Lippmann

de coopération électronique

via des outils graphiques

permettant d'analyser

leur fonctionnement, SUGAR

22

Secom

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR/01/01/01 Sécurité juridique A. Prüm CRP 15.10.2002 36 mois 1.200.000 € 1.200.000 €

du commerce électronique

Gabriel Lippmann

FNR/01/01/05 Plate-forme d’Organisation F. Feltz CRP 01.11.2001 60 mois 1.499.957 € 999.855 €

Virtuelle (SICOV)

Gabriel Lippmann

FNR/01/01/06 Cryptology & Security J-C. Asselborn Université 01.10.2001 60 mois 800.000 € 699.529 €

Initiative (CSI)

du Luxembourg

FNR/01/01/07 EFFICIENT framework E. Dubois CRP Henri Tudor 01.11.2001 60 mois 1.499.978 € 998.864 €

FNR/01/01/09 Accès PME: Commerce B. di Renzo CRP Henri Tudor 01.01.2002 48 mois 1.000.000 € 1.000.000 €

Electronique sécurisé

FNR/04/01/02 e-Care - Towards a Secured, N. Guelfi Université 2005 30 mois 399.147 € 399.147 €

FNR/04/01/03 Security Identity E. Dubois CRP Henri Tudor 2005 12+18 mois décision décision

Management, SIM en cours en cours

FNR/04/01/05 Techniques for Secure Grid F. Leprévost Université 2005 30 mois 151.378 € 151.378 €

FNR/04/01/06 Suivi de l’efficacité B. Otjacques CRP 2005 24 mois 229.900 € 229.900 €

Total: Montant disponible 6.780.360 € 5.678.673 €

SECOM, selon Convention

avec l’Etat: 7.500.000 €


FNR

01/01/01

Sécurité juridique du commerce électronique

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: André Prüm, Laboratoire de Droit Economique, CRP Gabriel Lippmann

Adresse e-mail: prum@lippmann.lu

Site internet du projet: www.lippmann.lu/Ide

Durée: 15 octobre 2002 – 15 octobre 2005

Contribution FNR: 1.200.000 €

Publications scientifiques «référées»:

» Recueil annoté de Législation sur le «Commerce Electronique», édité avec le Service Central de Législation,

2004

» André Prüm, Vers un espace européen des paiements

- Revue de Droit bancaire et Financier, 2004, n° 3

- Revue de Droit bancaire et Financier, 2004, n° 5

» Vuitton Raphaël , «Démarchage financier: le cadre juridique des communications non sollicitées issu

de la directive 2002/65/CE», EUREDIA, n° 3-2003.

» Poullet Corentin, «Le droit de rétractation: une protection supplémentaire accordée au consommateur

de services financiers commercialisés à distance», EUREDIA, n° 3-2003.

Les recherches menées ont pour but essentiel d’examiner le cadre juridique dans lequel le commerce

électronique peut se déployer au et depuis le Grand-Duché de Luxembourg et de suggérer les

améliorations susceptibles de rendre cet environnement plus attractif pour les acteurs et plus sûr pour

les utilisateurs.

Les recherches sont menées à la fois sous un angle de vue aussi large que possible pour apprécier les

règles régissant le commerce électronique dans son ensemble et de manière plus focalisée sur certains

thèmes revêtant un intérêt spécifique pour le Luxembourg. Dans les deux cas, la démarche consiste à

s’intéresser non seulement au droit positif luxembourgeois, mais aussi aux législations étrangères et

au droit européen, qui tous ont connus des développements récents importants. Pour éviter un

examen trop superflu des mécanismes et techniques du commerce électronique, le projet intègre au

surplus les compétences d’un ingénieur informatique.

L’examen global du cadre juridique des échanges électroniques aborde des thèmes aussi variés que

» le statut des prestataires de la société de l’information,

» la libre circulation des services de la société de l’information,

» les signatures électroniques,

» les services de certification,

» la responsabilité des intermédiaires techniques,

» le processus contractuel des échanges,

» la protection des consommateurs,

» les paiements électroniques, ou

» la criminalité sur Internet.

Secom

23


Si la loi du 14 août 2000 sur le commerce électronique, préparée à l’époque par le Laboratoire de Droit

Economique, se trouve au centre de cette étude, le domaine d’investigation s’étend à une série d’autres

textes comme:

» la loi du 14 mai 2002, modifiant la loi sur le secteur financier et concernant les établissements de

monnaie électronique,

» la loi du 30 juillet 2002 sur les pratiques commerciales, la concurrence déloyale, la publicité

trompeuse et la publicité comparative,

» la loi du 2 août 2002 relative à la protection des personnes à l’égard du traitement des données à

caractère personnel,

» la loi du 16 avril 2003 concernant la protection des consommateurs en matière de contrats à

distance, et

» la loi du 1 er juillet 2003 sur la TVA et la facturation électronique.

Ces recherches sont sur le point d’être consacrées dans un ouvrage général sur le commerce

électronique au Luxembourg qui proposera une analyse extrêmement fouillée de l’ensemble de ces

dispositions tout en proposant une série de pistes de réflexions pour leur amélioration. Les résultats

seront également présentés lors d’un colloque que le LDE se propose d’organiser au deuxième semestre

de l’année 2005.

Au titre des études plus ciblées, peuvent être mentionnées, à titre d’illustration, les recherches

conduites sur:

» l’archivage électronique,

» les paiements en ligne,

» les services financiers à distance,

» les modes alternatifs de résolution de litiges en ligne, et

» la protection des données à caractère personnel.

Ces travaux ont été publiés ou présentés sous forme de rapports ou de suggestions législatives aux

acteurs concernés.

Un recueil annoté des textes en vigueur au Luxembourg a, par ailleurs, été publié avec le concours

du Service Central de Législation.

24

Secom


FNR

01/01/05

Création d’un Système basé sur les nouvelles technologies

de l’Information et de la Communication facilitant

les affaires électroniques d’Organisation Virtuelle (SICOV)

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Fernand Feltz, Cellule de Recherche, d’Etude et de Développement en Informatique

(CREDI), CRP Gabriel Lippmann

Adresse e-mail: feltz@lippmann.lu

Site internet du projet: www.sicov.lu

Partenaire(s): CEPS/INSTEAD

Durée: 1 er novembre 2001–31 octobre 2006

Contribution FNR: 1.499.957 €

Publications scientifiques «référées»:

» Feltz F., Simon G., Lambert C., Otjacques B. (2004)

Generic web-based platform for virtual organizations: the SICOV case dans: Yager R., Sgurev V.:

2nd International IEEE Conference on Intelligent Systems, pp. 399-404, Varna, Bulgarie.

» Leduc, K. & Poussing, N: The use of ICT and the joint activity of the enterprises acting in partnership:

Colloque EMISA-GI (Development Methods for Information Systems and their Application), 6-8 octobre

2004, Luxembourg

Le projet de recherche vise la facilitation du travail coopératif de plusieurs acteurs économiques par

la spécification, la conception, le développement et les essais au laboratoire d’une plate-forme

électronique. Cette plate-forme devrait permettre à des entreprises et des administrations publiques

de fonctionner en réseau et de représenter une organisation virtuelle vers le monde externe.

La base de la plate-forme sera un espace d’informations commun à tous les acteurs. Les outils du

type CSCW (Computer Supported Cooperative Work), utilisés jusqu’à présent pour l’assistance à la

coopération interne dans les entreprises, seront analysés en vue d’enrichir la plate-forme de

l’organisation virtuelle.

Afin de localiser un secteur luxembourgeois ayant un potentiel de développement pour le mode de

fonctionnement en organisation virtuelle, le CEPS/INSTEAD devra accompagner le projet par des

enquêtes sur le terrain. Les résultats des enquêtes devront fournir des informations sur les besoins des

entreprises et ainsi influencer la conception de la plate-forme.

Au cours de l’année 2004, la plate-forme collaborative a été finalisée sous forme d’un premier

prototype prêt à héberger le travail productif d’organisations virtuelles. Le prototype est composé de

plusieurs modules fonctionnels collaboratifs, présentés à l’utilisateur par l’intermédiaire d’une interface

unifiée. Des modules implémentés sont par exemple: gestion de ressources, gestion de documents,

communication synchrone, espaces de travail pour groupes et autres.

L’enquête menée par le CEPS/INSTEAD au cours du projet auprès de 3900 entreprises a permis

d’identifier 253 entreprises particulièrement susceptibles de fonctionner en tant qu’organisation

virtuelle, et qui ont accepté d’être contactées suite à l’enquête.

Secom

25


Comme prévu, des actions de sensibilisation auprès de ces entreprises se sont concrétisées sous

forme de deux conférences organisées respectivement le 8 et le 9 décembre 2004. Au cours de ces

conférences, une quinzaine d’entreprises ont été informées sur les avantages du travail en tant

qu’organisation virtuelle au sein de la plate-forme SICOV. Des contacts établis avec les entreprises

intéressées seront poursuivis au cours de l’année 2005.

Début 2005, le réseau d’excellence NANOBEAMS rejoindra la plate-forme SICOV sous forme

d’organisation virtuelle: ce réseau animé par le Laboratoire d’Analyse des Matériaux du CRP Gabriel

Lippmann coordonnera les activités de ses 13 partenaires en provenance de 5 pays d’Europe par

l’intermédiaire de la plate-forme SICOV.

01/01/06

FNR

Cryptology & Security Initiative-Organisation et mise en place d’une

plateforme interdisciplinaire de cryptologie et de sécurité informatique

Université du Luxembourg

Personne(s) de contact: Jean-Claude Asselborn, Faculté de Droit, d’Economie et de Finance, Université du

Luxembourg

Adresse e-mail: jean-claude.asselborn@uni.lu

Partenaire(s): CRP Gabriel Lippmann

Durée: 1 er octobre 2001 – 30 septembre 2006

Contribution FNR: 800.000 €

Le projet vise à donner au Luxembourg des compétences solides en matière de cryptologie et de sécurité

informatique en vue d’assurer la confidentialité et l’authenticité des échanges de messages électroniques,

ainsi que la disponibilité permanente des ressources informatiques des entreprises et des administrations.

Il atteint ce but en réalisant une veille scientifique dans le domaine, en mettant à la disposition

des chercheurs un centre de documentation et une base de connaissances électronique sur la sécurité

informatique. De plus il contribue à mettre sur pied une équipe de recherche et des structures

d’enseignement dans le domaine.

En 2004 la veille technologique a porté essentiellement sur la stéganographie, un ensemble de

techniques et de méthodes permettant d’assurer la discrétion de la transmission de messages en

les camouflant dans des données anodines. Un séminaire pour professionnels a eu lieu sur cette

thématique et une présentation de sensibilisation en a été faite à des élèves de lycée.

La mise en place d’une équipe de recherche en cryptologie et sécurité informatique à l’Université du

Luxembourg a pu progresser par le recrutement d’un nouvel enseignant-chercheur, M. Jean-Sébastien

Coron, un expert internationalement reconnu. Rappelons que l’année dernière l’Université avait déjà

26

Secom


ecruté un autre expert bien connu, le professeur Franck Leprévost. Comme cette équipe entame

progressivement ses propres travaux en cryptologie et en théorie des nombres, le présent projet a

changé d’orientation au cours de l’année 2004 et se concentre désormais sur les autres aspects de la

sécurité informatique.

Ainsi l’équipe projet a contribué à l’élaboration de l’option «sécurité informatique» du futur master

académique en informatique qui fonctionnera à partir d’automne 2005 et a participé à la définition

d’autres structures de formation à orientation plus professionnelle dans le domaine de la sécurité

informatique.

Les nouveaux thèmes de recherche retenus se rapportent tous à l’émergence du commerce électronique

et du e-government. Ainsi l’équipe se concentrera sur trois nouveaux thèmes: la gestion des

preuves électroniques; la mise en oeuvre d’une politique de sécurité; la mise en oeuvre de la certification

électronique. Chacun de ces thèmes a été suggéré par des entreprises ou des acteurs du secteur

public et aborde des problématiques encore mal connues, mais dont la maîtrise est indispensable

pour le succès des projets de commerce et d’administration électronique.

En 2004 l’équipe a aussi continué à étendre le centre de documentation, qui contient actuellement

environ 300 ouvrages spécialisés. La base de connaissances occupe à présent plus d’un GB et contient

plus de 8000 entrées.

Secom

27


01/01/07

FNR

EFFICIENT

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Eric Dubois, Centre d’Innovation par les Technologies de l‘Information (CITI),

CRP Henri Tudor

Adresse e-mail: eric.dubois@tudor.lu

Site internet du projet: http://efficient.citi.tudor.lu

Partenaire(s): Université du Luxembourg, CRP Gabriel Lippmann

Durée: 1 er novembre 2001 – 31 octobre 2006

Contribution FNR: (budget total) 1.499.978 €

Publications scientifiques «référées»:

» Rik Eshuis, Pierre Brimont, Eric Dubois, Bertrand Grégoire, Sophie Ramel (2003): EFFICIENT: A Tool Set for

Supporting the Modelling and Validation of ebXML Transactions. In P. Inverardi, editor, Proc. of the joint

9th European Software Engineering Conference (ESEC) & 11th SIGSOFT Symposium on the Foundations

of Software Engineering (FSE-11), pages 359-362, ACM Press, 2003. (c) ACM. Poster.

» Rik Eshuis, Pierre Brimont, Eric Dubois, Bertrand Grégoire, Sophie Ramel (2003): Animating

ebXML Transactions with a Workflow Engine, In Robert Meersman, Zahir Tari, Douglas Schmidt et

al., editors, Proc. CoopIS 2003, volume 2888 of Lecture Notes in Computer Science, Springer, 2003. (c)

Springer

L'objectif du projet est d'étudier et de faciliter l'identification et le développement des transactions

e-business ayant une forte valeur ajoutée pour les acteurs économiques concernés: entreprises,

administrations, PME et individus. EFFICIENT permet à ses utilisateurs de pouvoir valider tant au

niveau business qu’en termes de faisabilité organisationnelle les nouvelles transactions B2B et B2C

conçues. La validation se façonnera d’une manière interactive, sur base d’un environnement de

simulation workflow, qui offre aux utilisateurs finaux une maquette du futur système leur donnant la

possibilité de visualiser, valider et s’approprier la transaction avant de donner le feu vert à une éventuelle

implémentation et a un déploiement. Cette approche a pour objectif la réduction du temps (et

donc des coûts) de développement de nouvelles transactions B2B et aidera donc à augmenter l’efficacité

des nouvelles pratiques du commerce électronique pour tous les acteurs socio-économiques.

Les activités de recherche au cours de l’année 2004 avaient pour objectif d’intégrer l’ensemble des outils

développés afin de les confronter à des cas réels avec des exigences métier fondés sur la pratique

pour étudier leur aptitude à répondre aux besoins du marché et évaluer leur maturité. Une première

release du logiciel a été finalisée en fin d’année et sera transférable au début de l’année 2005. La

release englobe un module de modélisation de transactions électroniques enrichi par l’ajout de

fonctionnalités d’annotation de contraintes en tant que règles métier d’une part et de vérification

formelle des modèles produits d’autre part. De plus, elle contient un outil de validation de modèles

par simulation interactive (animateur Efficient).

Plusieurs études de cas ont été menées. Elles nous ont permis de tester notre solution et d’améliorer

la qualité des outils développés:

» EA2 – appropriation des standards de l’échange de données informatisées au contexte socioéconomique

d’un pays de l’Asie, dans le cadre du programme ASIA@TIC de la CE.

» CusLink – une étude menée dans le cadre d’un stage au sein du DESS Informatique & Innovation

nous a confirmé l’intérêt et l’utilité d’un tel outil pour la construction de transactions dans

le secteur bancaire.

28

Secom


FNR

01/01/09

Dans un autre axe, le cadre légal a été étudié et ont été proposés un ensemble de schémas d’actions

juridiques qui marquent le cadre légal de transactions du commerce électronique et complètent les

précédentes études de cas.

Un effort de recherche substantiel en 2004 a été consacré au développement de la couche business

d’une transaction. Sur base des études empiriques et en tenant compte des approches théoriques du

domaine, une ontologie de concepts pour la modélisation business a pu être développée. Elle offre

aux utilisateurs la possibilité de développer, d’étudier et d’évaluer la faisabilité d’une transaction et

ainsi de justifier sa pertinence et sa valeur économique avant d’élaborer son contenu.

ACCES-PME

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Bernard Di Renzo, Centre d’Innovation par les Technologies de l‘Information (CITI),

CRP Henri Tudor

Adresse e-mail: bernard.direnzo@tudor.lu

Partenaire(s): Université du Luxembourg

Durée: 1 er janvier 2002 – 31 décembre 2005

Contribution FNR: (budget total) 1.000.000 €

Le projet ACCES-PME (Adoption de Compétences interdisciplinaires pour l’E-Commerce Sécurisé des

PME) vise à l’élaboration d’une méthode intégrée d’aide à la sécurisation des solutions e-business, tant

en conception qu’en exploitation, qui soit adaptée aux particularités des PME, entre autres en ce qui

concerne leurs objectifs business et les limites de leur capacité opérationnelle. Les aspects de sécurité

doivent être traduits en opportunités d’affaires et être traités au même niveau que les autres aspects

opérationnels des PME. Ce challenge nous a obligé d’élaborer des solutions à partir des résultats

scientifiques innovants.

Une méthode de conception d’applications logicielles e-business intégrant les aspects de sécurité

depuis l’analyse des besoins en termes «business» jusqu’à l’architecture sur base d'une intégration de

techniques innovantes d’ingénierie des exigences, d'analyse de risques, de conception architecturale

et de composants existants. Cette méthode part de modèles du business, ensuite en dérive des

exigences de sécurité motivées par le business et produit automatiquement le type d’architecture et

les composants de type logiciel libre ou propriétaires satisfaisants toutes les exigences. Le déroulement

de cette méthode est centré sur une analyse de risques incrémentale permettant de se focaliser sur les

opportunités business potentiellement les plus prometteuses.

Secom

29


04/01/02

FNR

Des expérimentations d’applicabilité sont en cours.

» En ce qui concerne la méthode de gestion des risques proposée, elle est utilisée dans un autre projet,

et elle s’avère adéquate dans le domaine d’application des institutions financières et adaptée à leur

problématique actuelle car elle intègre les aspects réglementaires des accords de Bâle II qui seront

imposés dès 2006 aux institutions financières.

» En ce qui concerne la méthode de conception architecturale assistée par un modèle décisionnel, elle

est augmentée d’un modèle des problèmes de sécurité typiques aux PME luxembourgeoises ainsi

que de la description extensive de composants de type logiciel libre concernant l’e-business. Des

architectures qui correspondent aux exigences de sécurité sont automatiquement générées, et

donnent un aperçu rapide du contenu des réponses à un appel d’offre. Toute incompatibilité avec

les attentes de la PME implique une modification des exigences et une génération d’architectures

plus adéquates. Une analyse détaillée de certaines architectures est en cours (p.ex. basées sur Corba3,

ou basées sur des systèmes multi-agents, concernant le contrôle des services web, …).

» En ce qui concerne les composants, des applications utilisant le composant de type logiciel libre

OpenSST, créé en 2002 dans le cadre de ce projet, ont été conçues et testées, entre autres dans le

domaine du clearing et de la gestion des contrats électroniques.

L’approche proposée par ce projet permettra donc aux PME luxembourgeoises de saisir les opportunités

e-business tout en profitant, d’une part, de la maîtrise de la gestion de la sécurité même si elle est

sous-traitée et, d’autre part, des ouvertures favorisées par cette méthode vers bien d’autres résultats

de recherche scientifique.

Towards a Secured, Efficient Platform

for the e-Commerce of Personalized Health Products

Université du Luxembourg

30

Secom

Personne(s) de contact: Nicolas Guelfi, Faculté des Sciences, de la Technologie et de la Communication

(FSTC), Université du Luxembourg

Adresse e-mail: nicolas.guelfi@uni.lu

Site internet du projet: http://se2c.uni.lu/projects/ecare

Partenaire(s): CRP Henri Tudor

Durée: 30 mois

Contribution FNR: 399.147 €

L’amélioration de la qualité de vie et le confort des citoyens, notamment par l’amélioration des services

médicaux, constitue une priorité pour le Luxembourg et l’Europe. Cette priorité se reflète notamment

au sein du programme e-Health de la commission européenne, défini dans le cadre de FP5 et FP6.

De nombreux projets ont actuellement lieu dans ces cadres. Toutefois, étant donné la complexité du

problème et la jeunesse de ces travaux, les solutions proposées ne fournissent pas encore de support

satisfaisant, en particulier pour le développement de services personnalisés, sécurisés et fiables.

L'objectif du projet e-Care est de contribuer à palier à ce problème, en identifiant, caractérisant et

prototypant les éléments fondamentaux constitutifs d’une plate-forme facilitant l’ingénierie efficace et

sécurisée de systèmes informatiques sécurisés et fiables, qui offrent des fonctions personnalisées dédiées

à l’information, au suivi et au traitement médical à distance des citoyens, notamment Luxembourgeois.


FNR

04/01/03

Secure Identity Management (SIM)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Eric Dubois, Centre d'Innovation par les Technologies de l'Information (CITI),

CRP Henri Tudor

Adresse e-mail: eric.dubois@tudor.lu

Site internet du projet: http://se2c.uni.lu/projects/ecare

Partenaire(s): Université du Luxembourg

Durée: 30 mois

Le projet consiste au développement, par prototypes successifs, d’une solution innovante d’identity

management. Cette solution doit permettre de déployer des droits utilisateurs au niveau réseau, OS et

applications dans un environnement distribué (voire également mobile) à partir de ‘jobs descriptions’

et de profils. Ces profils sont transformés en droits techniques et propagés grâce à un système d’agents.

L’application est également capable d’auditer la sécurité, en récupérant les droits physiques et en les

comparant aux droits ‘théoriques’. Ces droits théoriques sont représentes formellement sous la forme

de modèles à partir desquels le code associé à la solution est généré automatiquement.

FNR

04/01/05

TeSeGrAd: Techniques for Secure Grid and Ad-hoc Networks

Université du Luxembourg

Personne(s) de contact: Franck Leprévost, Faculté de Droit, d’Économie et de Finance,

Université du Luxembourg

Adresse e-mail: Franck.Leprevost@uni.lu

Durée: 30 mois

Contribution FNR: 151.378 €

Ces dernières années ont révolutionné la manière de percevoir les télécommunications. Que ce soit par

l’apparition des grilles de calcul ou par la généralisation des réseaux sans fils/Adhocs (GSM, Wi-Fi,

Bluetooth, etc).

Il est ainsi primordial de sécuriser ces réseaux et les technologies classiques s’avèrent peu adaptées.

Les recherches proposées dans le cadre du projet TeSeGrAd (Techniques for Secure and Ad-hoc

networks) s’inscrivent dans ce cadre là. Le projet est bipolaire: premièrement, l’équipe développe une

méthode d’anonymisation de communications interactives nécessitant une faible latence, et contrant

des attaques du type analyse de trafic. Deuxièmement, elle participe au développement d’une nouvelle

génération d’outils destinés à la cryptographie à clé publique et secrète. Cette nouvelle génération,

plus légère, facilitera la mise en place de solutions embarquées (ad-hoc/ambiant computing).

Secom

31


04/01/06

FNR

Suivi de l’efficacité des nouvelles formes de coopération électronique

via des outils graphiques permettant d’analyser leur fonctionnement

(SUGAR)

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Benoît Otjacques, Cellule de Recherche, d’Étude et de Développement en Informatique

(CREDI), CRP Gabriel Lippmann

Adresse e-mail: otjacque@lippmann.lu

Durée: 24 mois

Contribution FNR: 229.900 €

Le projet SUGAR s’inscrit dans l’étude des nouvelles formes de coopération électronique, avec un accent

particulier sur les entreprises virtuelles et en réseau. Le projet a pour but de concevoir et de développer

des outils graphiques, comparables à des tableaux de bord, destinés à l’analyse du fonctionnement

de plates-formes virtuelles de coopération. Ces outils sont destinés d’une part aux personnes

en charge du pilotage des opérations conduites sur la plate-forme et d’autre part aux personnes

responsables des aspects stratégiques de l’entreprise virtuelle. La démarche de conception des outils

sera générique à la fois vis-à-vis des différentes plates-formes de coopération présentes sur le marché

et vis-à-vis des secteurs d’application possibles.

32

Secom


»

PROGRAMME NANO

Matériaux innovateurs et nanotechnologie

Durée: 2000 – 2008

Budget total: 6.700.000 €

1 er appel en 2001: 3 projets sélectionnés (6.000.000 €)

2 e appel prévu: 2005 (disponible: 700.000 €)

Le programme vise à créer un Centre Européen spécialisé dans la caractérisation des matériaux à

l’échelle du nanomètre. La caractérisation d’un matériau (plastique, métal, verre ainsi que tissus

biologiques) peut être analytique, morphologique ou fonctionnelle. Afin d’atteindre la résolution du

nanomètre nécessaire au développement ou à l’étude de ces nouveaux matériaux, il est nécessaire de:

» disposer d’une série d’appareils scientifiques développés très récemment par un petit nombre de

fabricants (appareils SIMS, appareils d’analyse des propriétés nanomécaniques des surfaces,

méthodes compatibles avec des mesures sur cellules individuelles comme la bio impédance, etc);

» optimiser / modifier ces appareils en fonction des domaines d’application et des matériaux à

analyser;

» développer de nouvelles techniques d’analyse.

Ces techniques sont encore très récentes et largement issues de la recherche fondamentale européenne.

De nombreux industriels et scientifiques ont annoncé leur grand intérêt à pouvoir appliquer ces

nouvelles techniques d’analyse à leurs produits.

Afin de juger des états d’avancement des différents projets en cours ainsi que du programme NANO en

général, un comité de pilotage composé d’experts internationaux s’est réuni le 15 janvier 2004 à Luxembourg.

Les experts ont retenu que les résultats obtenus jusqu’à présent sont remarquables, mais qu’il faudra

dans le futur faire des efforts dans le domaine des publications scientifiques de qualité et des brevets.

Le budget de 700.000 € prévu pour le 2 e appel à propositions de projets de recherche sera

attribué sur recommandation des experts et utilisé pour promouvoir des post-docs et des chercheurs

confirmés dans ce domaine.

Dans le cadre du présent programme, le Fonds lancera le 2 e appel à propositions de projets au cours

du premier trimestre 2005. Le dossier de soumission sera publié sur le site Internet du Fonds et le

dossier pourra également être téléchargé (www.fnr.lu).

Nano

33


Projets du programme NANO:

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR/01/02/01a Analyse de tissus C. Muller Laboratoire National 01.01.2003 51+24 mois 1.139.069 € 731.774 €

biologiques par Nano/SIMS

de Santé

FNR/01/02/01b Analyse d’échantillons H.-N. Migeon CRP Gabriel 01.04.2002 36+24 mois 860.931 € 462.397 €

environnementaux à l’échelle L. Hoffmann Lippmann

du nanomètre

FNR/01/02/02 Centre Européen spécialisé H.-N. Migeon CRP Gabriel 16.07.2001 48+24 mois 4.000.000 € 3.572.802 €

dans la caractérisation

Lippmann

des matériaux à l’échelle

du nanomètre

34

Nano

Total: Montant disponible NANO, 6.000.000 € 4.766.973 €

selon Convention

avec l’Etat: 6.700.000 €


FNR

01/02/01a

Analyse de tissues biologiques par NanoSIMS – BIONANO

Centre de Recherche Public Santé

Personne(s) de contact: Claude Muller, Institut d’Immunologie, Laboratoire National de Santé,

CRP Santé

Adresse e-mail: claude.muller@lns.etat.lu

Partenaire(s): Laboratoire d’Analyse des Materiaux (LAM), CRP Gabriel Lippmann

Durée: 1 er janvier 2003 – 31 septembre 2007

Contribution FNR: 731.774 €

Prolongation éventuelle: 24 mois, contribution maximale FNR de 407.297 €

Le présent projet tente d’explorer le potentiel de la spectrométrie de masse d’ions secondaires (SIMS)

en science du vivant. Le NanoSIMS situé au Laboratoire d’Analyse des Matériaux permet des

acquisitions à haute résolution latérale et une séparation de masse supérieure par rapport aux

précédents SIMS, ce qui le rend particulièrement intéressant pour l’étude de cartes de distributions

d’espèces ioniques au niveau sub-cellulaire. La première étape du projet est d’optimiser la préparation

d’échantillons aux contraintes du SIMS (chambre en ultra-haut vide, déshydratation, échantillons non

conducteurs) en adaptant des protocoles de microscopie électronique à transmission. Différentes

techniques de fixation (chimique, cryo) ont été appliquées à une variété d’échantillons tels que des

bactéries, des cellules et des tissus d’origine animale.

Le marquage de molécules organiques dans des échantillons biologiques en vue de tracer le

cheminement et ainsi de comprendre des voies métaboliques complexes est responsable de l’essor des

sciences biomédicales au cours des 20 dernières années. Développer une palette de marqueurs

compatibles SIMS permettant l’étude de processus pharmacologiques est une priorité du projet. Pour

ce faire, de premières expériences de marquage de l’ADN au 5-bromo-2-deoxyuridine (BrdU) sur

NanoSIMS ont été réalisées sur des cellules souches humaines de monocytes (THP-1).

«L’équipe de recherche de

l’Institut d’Immunologie.»

Nano

35


01/02/01b

FNR

Analyse d'échantillons environnementaux à l'échelle du nanomètre

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Henri-Noël Migeon, Laboratoire d’Analyse des Matériaux (LAM), CRP Gabriel Lippmann,

Lucien Hoffmann, Cellule de Recherche en Environnement et Biotechnologies (CREBS), CRP Gabriel Lippmann

Adresse e-mail: migeon@lippmann.lu

Durée: 1 er avril 2002 – 31 mars 2005

Contribution FNR: 462.397 €

Prolongation éventuelle: 24 mois, contribution maximale FNR de 398.534 €

Publications scientifiques «référées»:

» M. Botreau, C. Guignard, L. Hoffmann, H.-N. Migeon.

ToF-SIMS as an alternative tool for the qualitative and quantitative analysis of polar herbicides

Applied Surface Science 231-232, p 533-537 (2004)

» P. Hallégot, J.-N. Audinot, F. Leroy and H.-N. Migeon.

Advanced Local Isotopic Measurement from Hair Section: a NanoSIMS Study.

IFSCC 04, The Int. Fed. of Soc. of Cosmetic Chem., Orlando (2004).

» J.-N. Audinot , S. Schneider, M. Yegles, P. Hallegot, R Wennig and H.-N. Migeon.

Imaging of arsenic traces in human hair by NanoSIMS 50

Applied Surf. Sci. Vol. 2, 231-232, p 490-496 (2004).

Imagerie ionique de 16 O, 12 C 2

, 12 C 14 N et 35 Cl

dans les mousses aquatiques Fontinalis antipyretica.

Dans le cadre de ce projet, l’année 2004 s’est poursuivie par l’étude de polluants par Tof SIMS

(Time-of-Flight, SIMS statique) et imagerie NanoSIMS 50 (SIMS dynamique). Le SIMS statique permet

d'obtenir une information organique sur les premières couches atomiques d'un échantillon, avec une

grande sensibilité. L’imagerie SIMS, et plus particulièrement celle réalisée avec le NanoSIMS50, est

utilisée pour imager la répartition élémentaire à l’échelle cellulaire avec une très grande sensibilité.

Le premier volet du projet a été consacré à l'analyse de pesticides polaires (deux herbicides acides

Glyphosate et 2,4,5-T) en ToF-SIMS dont l’analyse est habituellement incompatible avec les techniques

analytiques classiques. Après la mise au point du protocole de préparation des échantillons, des

solutions méthanoliques de chaque pesticide ont été analysées. Ceci a permis d'évaluer la sensibilité

et la linéarité du SIMS statique pour ce type de molécules. L'effet du pH sur la signature spectrale des

deux molécules a ensuite été étudié, en mode positif et négatif. A titre de comparaison, les protocoles

d'analyse de ces pesticides par les techniques classiques (GC-MS après dérivation) ont été développés.

Le deuxième volet du projet porte sur l'utilisation du NanoSIMS 50 en imagerie ionique pour la localisation

de micropolluants dans des échantillons biologiques et environnementaux et la compréhension

des écosystèmes. La première phase a consisté à mettre au point le protocole de préparation

des tissus végétaux pour les analyses sous ultra-vide (inclusion en résine, découpe ultramicrotome).

Ce protocole a ensuite été appliqué pour l'analyse de mousses aquatiques (Fontinalis antipyretica)

préalablement mises au contact de polluants organiques et minéraux.

36

Nano


FNR

01/02/02

Parallèlement à ces travaux, des analyses NanoSIMS 50 ont été effectuées sur des diatomées (algues

microscopiques). Les premiers essais ont montré que les performances du NanoSIMS 50 (résolution

spatiale et résolution en masse) pouvaient avantageusement être utilisées pour localiser différents

éléments (métaux) ou isotopes ( 29 Si) dans le frustule de diatomées.

En collaboration avec l’Institut National de Recherche Agronomique de Nancy, l’échange entre des cellules

fongiques et le milieu dans lequel elles poussent et plus particulièrement avec l’azote, nutriment

essentiel des végétaux a été étudié. La localisation des isotopes de l’azote ainsi que la mesure du rapport

isotopique 15 N/ 14 N ont permis de mettre en évidence des mobilités différentes pour les isotopes de l’azote

au cours de son absorption.

Imagerie ionique de 16 O et des isotopes du silicium

( 28 Si, 29 Si et 30 Si) dans des diatomées après croissance

dans un milieu enrichi en 29 Si.

Centre Européen spécialisé dans la caractérisation

des matériaux à l’échelle du nanomètre

Centre de Recherche Public Gabriel Lippmann

Personne de contact: Henri-Noël Migeon, Laboratoire d’Analyse des Matériaux (LAM),

CRP Gabriel Lippmann

Adresse e-mail: migeon@lippmann.lu

Durée: 16 juillet 2001- 15 juillet 2005

Contribution FNR: 3.572.802 €

Prolongation éventuelle: 24 mois, contribution maximale FNR de 427.198 €

Publications scientifiques «référées»:

L. Kailas, J. -N. Audinot, H. N. Migeon and P. Bertrand.

Tof-Sims molecular characterization and NanoSIMS imaging of submicron domain formation at the surface

of PS/PMMA blend and copolymer thin films.

Applied Surf. Sci. Vol. 2, 231-232, p289-295, 2004.

Au cours de l’année 2004, ce projet s’est poursuivi sur: l’activité de recherche dans le domaine

des matériaux en collaboration avec les industries luxembourgeoises et les universités (Nancy, Namur,

Louvain la Neuve) en utilisant le potentiel analytique du Laboratoire d’Analyse des Matériaux (LAM)

sur le SIMS dynamique et statique et l’Auger et, le développement d’une source d’ions Cs + à ionisation

de surface et à brillance élevée.

Les études réalisées pour Péchiney-Eurofoil se sont consacrées à la caractérisation des couches d’oxyde

formées à la surface des feuilles d’aluminium ainsi qu’à la corrélation entre leur épaisseur et la présence

de certains contaminants.

Nano

37


Photographie de la modification de l’appareil CMS en vue du développement de la nouvelle source césium

La collaboration avec Goodyear a porté sur des échantillons métalliques recouverts de différentes

surfaces organiques intervenant dans l’élaboration des gommes. Les images NanoSIMS 50 ont révélé

la répartition des charges présentes dans les gommes pneumatiques ainsi que l’état de surface des

échantillons après différents traitements.

Les matériaux céramiques de Cératizit ont fait l’objet de nombreuses études SIMS et Auger pour

la caractérisation de revêtements multicouches de TiC x N 1-x et notamment la mise en évidence de

couches nanométriques d’AlON. Le potentiel analytique a été également mis à contribution dans le

développement d’une nouvelle classe de matériaux composites pour des applications d’usure et de coupe.

En collaboration avec l’Institut de Recherche Sidérurgique, des dosages de carbone dans les aciers ont

été réalisés par NanoSIMS 50. Ces résultats permettront à terme de mieux comprendre les mécanismes

de transformation de phases dans les aciers.

L’étude de mélange de polymères a été suivie dans le but de corréler la répartition des polymères

(imagerie 3D NanoSIMS 50) aux propriétés physiques du matériau.

Les sources qui équipent actuellement les SIMS permettent d’obtenir des faisceaux de 50 nm de

diamètre (résolution latérale du NanoSIMS 50). Dans le cadre de ce projet, ce type de source a fait

l’objet d’une étude physique et théorique sur un banc test spécialement conçu à cet effet. Des calculs

théoriques associés à des mesures expérimentales réalisées sur la machine Cation Mass Spectrometer

(CMS) ont montré la possibilité de concevoir une nouvelle source Cs + dont les performances seront

testées en 2005 sur le NanoSIMS 50.

La fin de l’année a été marquée par l’arrivée d’un Microscope à Force Atomique (AFM) qui permettra

d’étudier la topographie des échantillons en complément des mesures Auger et SIMS.

38

Nano


»

PROGRAMME EAU

Gestion durable des ressources hydriques

Durée: 2000 - 2007

Budget total: 5.000.000 €

1 er appel en 2001: 8 projets sélectionnés (4.804.630 €)

Pas de 2 e appel prévu

Ressource naturelle indispensable à la vie, l’eau est devenue un bien économique convoité dont la

gestion constitue un problème planétaire majeur. Les technologies de l’eau sont ainsi un marché

porteur d’activité économique et d’emploi.

L’objectif général de ce programme est de constituer au Luxembourg un pôle d’excellence dans le

domaine de l’eau capable d’appréhender les mécanismes complexes du cycle naturel de l’eau, d’évaluer

les moyens de sauvegarder les ressources et d’en protéger la qualité, de développer des technologies

de contrôle et d’épuration innovantes, appropriées et les moins onéreuses et de lutter contre les

gaspillages.

Ce programme de recherche, de développement et d’innovation s’oriente suivant cinq axes prioritaires:

» Qualité des eaux de surface et des écosystèmes aquatiques;

» Fonctionnement hydrologique des cours d’eau;

» Protection des eaux souterraines;

» Technologies avancées pour la gestion de l’eau;

» Aspects socio-économiques de la gestion des ressources hydriques dans la perspective de leur

développement durable.

Afin de juger des états d’avancement des différents projets en cours ainsi que du programme EAU en

général, un comité de pilotage composé d’experts internationaux s’est réuni le 15 janvier 2004 à Luxembourg.

Les experts ont soulevé l’importance d’une plus profonde interaction entre les projets et d’un renforcement

de la coopération avec les équipes nationales et internationales de la grande région. Ainsi

de futures activités pourraient être réalisées ensemble avec les pays avoisinants, car les problèmes de

l’eau ne connaissent pas de frontières (bassins versants, friches industrielles, etc.).

Il a été noté que la mise à disposition des informations étudiées aux acteurs du domaine devrait être

poursuivie. En plus, les résultats pourraient être présentés lors d’une journée destinée au grand public

pour clôturer le programme.

Eau

39


Projets du programme EAU:

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR/01/03/01 Diagnostic de l’Etat des I.Thys CRP Gabriel 01.01.2002 42 mois 809.971 € 809.971 €

Ecosystèmes Lacustres -

Lippmann

DIADECOL

FNR/01/03/02 Etude des composantes L. Pfister CRP Gabriel 01.01.2002 36 mois 750.000 € 750.000 €

des cycles de l’eau dans le

Lippmann

bassin de l’Attert - CYCLEAU

FNR/01/03/03 Impact de substances A . Dohet CRP Gabriel 01.04.2002 36 mois 800.000 € 800.000 €

polluantes et toxiques

Lippmann

sur les communautés

aquatiques - MODELECOTOX

FNR/01/03/04 Caractérisation hydro R. Maquil Service Géologique; 01.08.2002 19 mois 57.760 € 57.760 €

chimique détaillée des eaux

Administration des

souterraines du

Ponts et Chaussées

Luxembourg - GEAUSOUT

FNR/01/03/05 Nouveaux concepts et P. Schosseler CRP Henri Tudor 01.03.2002 42 mois 386.899 € 386.899 €

technologies innovantes

pour une gestion durable

du cycle de l’eau urbain -

CONCEPT

FNR/01/03/06 Suivi scientifique de la M. Plattes CRP Henri Tudor 01.01.2002 48 mois 579.765 € 579.765 €

mise en oeuvre d’une nouvelle

technique de traitement des

eaux usées au Luxembourg -

LITFLUID

FNR/01/03/07 Modélisation d’un réseau E. Henry CRP Henri Tudor 01.01.2002 66 mois 920.235 € 920.235 €

d’assainissement: la réserve

d’eau potable de la

Haute Sûre - RESEAUSURE

FNR/01/03/08 Flux de matières dans J. Welfring CRP Henri Tudor 01.02.2002 60 mois 500.000 € 500.000 €

le bassin versant

de l’Alzette - FLUXALZETTE

40

Eau

Total: Montant disponible EAU, 4.804.630 € 4.804.630 €

selon Convention avec l’Etat:

5.000.000 €


FNR

01/03/01

Diagnostic de l’Etat des écosystèmes lacustres par l’analyse de la biodiversité

et du fonctionnement de la boucle microbienne (DIADECOL)

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Isabelle Thys, Henry-Michel Cauchie, Lucien Hoffmann, Cellule de Recherche

en Environnement et Biotechnologies (CREBS), CRP Gabriel Lippmann

Adresse e-mail: thys@lippmann.lu

Durée: 1 er janvier 2002 – 30 juin 2005

Contribution FNR: 809.971 €

Le projet a pour but d’établir les bases théoriques d’une méthode de diagnostic de l’état des

écosystèmes lacustres reposant sur l’analyse des caractéristiques taxonomiques et écologiques de la

boucle microbienne (biodiversité, métabolisme, structure et interactions entre les composantes de la

boucle microbienne).

Le projet s’attache de manière plus spécifique à décrire les réponses des communautés microbiennes

au phénomène d’eutrophisation.

L’année 2004 a été consacrée à deux tâches essentielles:

» Des expériences de prédation ont été menées in situ et en laboratoire afin de décrire les relations

complexes existant au sein de la boucle microbienne dans quatre réservoirs caractérisés par des

niveaux d’eutrophisation croissants (oligo-, méso-, eutro- et hypereutrophe);

» Certains résultats obtenus en 2003 ont été approfondis.

En effet, le suivi des variables bactériennes dans les différents réservoirs avait mis en évidence une

réponse nette de l’activité métabolique bactérienne en fonction du niveau d’enrichissement des eaux.

La sensibilité de ces variables a été testée le long d’un gradient d’eutrophisation allant de l’ultraoligotrophie

à l’hyper-eutrophie (23 lacs et réservoirs situés dans la Grande Région).

Les résultats sont les suivants:

» Les expériences in situ mettent en évidence différentes réponses bactériennes à la présence de

prédateurs. La densité des bactéries se révèle peu sensible à la prédation. Inversement, le biovolume

des cellules bactériennes montre une très nette augmentation en présence de prédateurs, plus

particulièrement les protozoaires flagellés. Dans certaines conditions (milieu oligotrophe et hypereutrophe),

l’activité métabolique des bactéries réagit à la présence d’organismes planctoniques mais

le sens de la réponse (positive ou négative selon les cas) est variable. La composition taxonomique

des communautés microbiennes évolue également très rapidement dès que les conditions de

prédation sont modifiées. Le contrôle des protozoaires ciliés par le métazooplancton a également

pu être mis en évidence;

Eau

41


Prise d’échantillons

» La pertinence des variables métaboliques (assimilation de monosaccharides et production

bactérienne) comme outil de diagnostic du niveau d’eutrophisation a été confirmée lors du suivi des

lacs de la Grande Région. L’assimilation du glucose varie de manière logarithmique en fonction de

la transparence de l’eau (r 2 = 0.84) qui est elle-même un paramètre indicateur d’eutrophisation. Une

relation similaire a été observée pour d’autres monosaccharides comme la N-acétylglucosamine ainsi

que pour la production bactérienne. Le métabolisme bactérien se révèle donc un indicateur fiable

du niveau d’enrichissement des eaux. Ces résultats soulignent l’importance de considérer non

seulement la biomasse mais aussi le métabolisme microbien pour l’étude de la qualité écologique

des écosystèmes aquatiques.

01/03/02

FNR

Etude des composantes du cycle de l’eau

dans le bassin de l’Attert (CYCLEAU)

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Laurent Pfister Cellule de Recherche en Environnement et Biotechnologies (CREBS),

CRP Gabriel Lippmann

Adresse e-mail: pfister@lippmann.lu

Partenaire(s): Université du Luxembourg

Durée: 1 er janvier 2002 – 31 décembre 2004

Contribution FNR: 750.000 €

Publications scientifiques «référées»:

Kies A., Hofmann H., Tosheva Z., Hoffmann L. and Pfister L., 2004. Using 222Rn for hydrograph separation

in a micro basin (Luxembourg), accepted for publication in Annals of Geophysics.

Le fonctionnement hydro-climatologique de plusieurs micro-bassins expérimentaux emboîtés dans des

sous-bassins d’affluents majeurs de l’Attert est étudié en vue de comprendre la genèse des crues et

inondations. A cette fin, un réseau d’observation très dense de limni- et piézographes, d’échantillonneurs

automatiques, de détecteurs de radon et de stations météorologiques a été mis en place

dès 2001, afin de suivre sur plusieurs années l’origine spatiale et temporelle des écoulements. Les

micro-bassins expérimentaux ont été choisis sur base de critères de représentativité des caractéristiques

géologiques et d’occupation du sol, propres au Gutland et à l’Oesling.

42

Eau


Grâce à l’équipement de mesure d’une haute densité spatio-temporelle, il a été possible d’étudier en

détail la genèse des écoulements dans des bassins-versants aux caractéristiques physiographiques très

contrastées. Diverses méthodes de séparation des écoulements de crue ont été appliquées aux données

acquises par les instruments de mesure. L’utilisation de traceurs isotopiques et chimiques a ainsi permis

d’étudier l’origine spatio-temporelle des écoulements. Certains micro-bassins font preuve d’une grande

complexité qui se traduit par une forte variabilité spatio-temporelle des processus hydrologiques d’une

part et de leurs poids respectifs d’autre part.

Le rôle de l’interception des précipitations par la canopée forestière est également étudié au sein d’une

placette expérimentale. La plupart du temps, l’interception n’est prise que très grossièrement en

compte dans les calculs de bilans hydrologiques et les modélisations hydrologiques. La capacité de

saturation de la canopée, ainsi que sa variabilité au fil des saisons, sont étudiés afin de déterminer le

poids de ce processus dans le cycle de l’eau.

Les informations recueillies sur le fonctionnement des hydrosystèmes sont intégrées dans des

procédures de calibration et de validation de modèles hydrologiques. Grâce aux informations recueillies

sur la nature des processus générateurs des écoulements, des calages basés sur de multiples critères,

représentatifs des divers processus en jeu peuvent être utilisés. Cette approche permet ainsi de juger

de la validité des concepts retenus pour réaliser les modèles, au-delà de leur simple aptitude à restituer

les débits bruts.

«Equipements de mesure installés pour la séparation des écoulements sur le bassin de la Weierbach (Attert).»

Eau

43


01/03/03

FNR

Développement d’un modèle de prédiction de la faune et de la flore

pour évaluer la qualité écologique des cours d’eau du Luxembourg.

(MODELECOTOX)

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Alain Dohet, Cellule de Recherche en Environnement et Biotechnologies (CREBS),

CRP Gabriel Lippmann

Adresse e-mail: dohet@lippmann.lu

Durée: 1 er avril 2002 – 31 mars 2005

Contribution FNR: 800.000 €

Publications scientifiques «référées»:

» Ferréol M., Dohet A., Cauchie H.M. & L. Hoffmann. A top down approach for the development of a stream

typology based on abiotic variables. Hydrobiologia (accepted).

» Gevrey M., Rimet F., Park Y.-S., Giraudel J.-L., Ector L. & S. Lek, 2004. Water quality assessment using

diatom assemblages and advanced modelling techniques. Freshwater Biology 49: 208-220.

» Monnier O., Lange-Bertalot H., Rimet F., Hoffmann L. & L. Ector, 2004. Achnanthidium atomoides sp. nov.,

a new diatom from the Grand-Duchy of Luxembourg. Vie et Milieu 54: 127-136.

» Rimet F., Ector L., Dohet A. & H.M. Cauchie, 2004. Impact of fluoranthene on diatom assemblages and

frustule morphology in indoor microcosms. Vie et Milieu 54: 145-156.

» Rimet F., Hoffmann L., Cauchie H.M. & L. Ector, 2004. Regional distribution of diatom assemblages in the

headwater streams of Luxembourg. Hydrobiologia 520: 105-117.

» Rimet F., Cauchie H.M., Hoffmann L. & L. Ector. Response of diatom indices to simulated water quality

improvements in a river. Journal of Applied Phycology (accepted).

Le principal objectif du projet consiste à développer un modèle de prédiction qui, sur base de variables

physiques et chimiques clés de l’habitat, permet de prédire la faune (macroinvertébrés) et la flore

(diatomées) aquatiques attendues au niveau de sites d’eau courante de référence.

Parallèlement, un volet expérimental est destiné à étudier, par des techniques moléculaires et

morphologiques de pointe, la taxinomie des algues benthiques, importantes pour la bioindication mais

présentant des difficultés d’identification.

«Diatomée (Staurosira venter)

au microscope électronique

à balayage»

En 2004, les séquences génétiques de plus de 85 taxons de diatomées

ont été précisées. En terme d’avancées scientifiques, ce sont les résultats

qui concernent le genre Nitzschia qui sont les plus

intéressants. Le complexe Nitzschia palea, dont les différents taxons

montrent des différences au niveau morphologique, apparaît très

homogène au point de vue génétique. Ces résultats entraînent des

implications importantes en terme de bioindication. Par contre, les

Nitzschia de la section des Lanceolatae ne constituent pas un groupe

homogène d’après l’analyse de l’ADN 18S. La révision de la taxinomie

des diatomées épilithiques des rivières du Luxembourg est

en cours d'achèvement, ainsi que la rédaction de la monographie

«Diatoms of Europe. The epilithic flora of Luxembourg watercourses.

Taxonomy and ecology». Les principales diatomées du Luxembourg

y sont décrites et 150 d’entre elles sont illustrées en microscopie

optique et en microscopie électronique à balayage.

44

Eau


FNR

01/03/04

Après la vérification préalable de la correspondance existant entre la typologie des cours d’eau basée

sur des données environnementales et les communautés d’organismes aquatiques ainsi que la

validation sur le terrain d’une présélection de sites pouvant être considérés comme «sites de référence»,

l’élaboration du modèle de prédiction a pu être entreprise. Le principe du modèle consiste à estimer

les probabilités d’occurrence des taxons pour un site donné en l’absence de stress anthropique

significatif. L’écart entre les conditions observées et attendues (conditions de référence) permet

d’étalonner une valeur indicielle pour estimer la qualité du cours d’eau étudié.

Différentes combinaisons (saisons, niveau taxinomique) du modèle sont actuellement testées. La

vraisemblance des résultats obtenus conforte la pertinence du modèle comme outil d’analyse de la

qualité des cours d’eau. Les modèles à l’échelle des familles ont logiquement un nombre plus restreint

d’unités taxinomiques, ce qui réduit d’autant l’incertitude du modèle.

Au cours du dernier trimestre du projet, ces modèles seront affinés et une interface utilisateurs sera

mise en place.

Caractérisation hydrochimique détaillée des eaux souterraines

du Luxembourg (GEAUSOUT)

Service Géologique, Administration des Ponts-et-Chaussées

Personne(s) de contact: Robert Maquil, Service Géologique, Ponts et Chaussées

Adresse e-mail: robert.maquil@pch.etat.lu

Durée: 1 er août 2002 – 29 février 2004 (projet terminé)

Contribution FNR: 57.760 €

Le projet GEAUSOUT a permis de préciser la composition, au niveau chimique, isotopique et radiologique,

des eaux souterraines du Luxembourg, tant dans des aquifères économiquement exploitables

comme eaux potables ou industrielles, que dans des roches contenant des nappes d’eaux souterraines

de moindre importance.

Une grande variabilité chimique a été documentée entre les différentes unités hydrogéologiques ainsi

qu’au sein des unités mêmes, que ce soit des eaux émergeant librement du milieu souterrain ou puisées

par des ouvrages de captages dans les nappes d’eau souterraines.

Trois grands groupes hydrochimiques correspondent aux unités stratigraphiques retenues. Ils se

distinguent sur la base de la nature pétrographique et des réactions géochimiques; dissolutions et

oxydoréduction, actifs dans les roches. Le carbonate, calcite (CaCO 3 ) ou dolomie (CaMg(CO 3 ) 2 ), donne

par dissolution des eaux respectivement calciques ou caractérisées par la présence de calcium et

magnésium. Au cas où la dissolution du carbonate est le seul processus en jeu, le rapport CaMg est

constant et stœchiométrique. Il varie dans une certaine mesure avec la précipitation de la calcite, seul

le carbonate cristallise facilement dans le milieu superficiel. Le rapport CaMg varie également avec la

dissolution ou la précipitation du gypse, libérant ou fixant des ions Ca, le gypse pouvant être primaire

dans le Trias, ou secondaire dans le Jurassique (engendré par l’oxydation de la pyrite).

Eau

45


Le graphique NaSO 4 montre bien les différences marquées entre les unités hydrogéologiques retenues,

tout comme la variabilité au sein d’une même unité hydrogéologique. Il est admis que le sodium et le

sulfate peuvent être (et le sont localement) d’origine anthropique. Le mélange des eaux des nappes

d’eaux souterraines pourrait expliquer les tendances et la grande amplitude de variations.

Evolution du rapport sodium/sulfates dans les eaux du Jurassique et du Trias.

Il est rappelé que le projet GEAUSOUT a considéré seulement deux analyses pour une centaine de sites

de prélèvement, les données complémentaires traitées à titre de comparaison sont des données

d’archives et / ou mis à disposition par les différents concernés. Des évolutions temporelles des nappes

suite aux sollicitations naturelles ou anthropiques seront à documenter par d’autres observations.

Les résultats sont présentés en tableaux, sur des graphiques et sur des cartes à l’aide du Système

d’Information Géographique (SIG). Une banque de données avec situations topographiques, cartes

géologiques, photos de site, croquis techniques des ouvrages et d’autres informations utiles sur

l’exploitation éventuelle a servi de base pour la réalisation du projet.

46

Eau


FNR

01/03/05

Nouveaux concepts et technologies innovantes

pour une gestion durable du cycle de l'eau urbain (CONCEPT)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Paul Schosseler, Torben Lohmann, Centre de Ressources des Technologies pour

l’Environnement (CRTE), CRP Henri Tudor

Adresse e-mail: paul.schosseler@tudor.lu, torben.lohmann@tudor.lu

Site internet du projet: www.crte.lu (Rubrique EAU)

Durée: 1 er mars 2002 – 31 août 2005

Contribution FNR: 386.899 €

Le présent projet vise la mise en œuvre de nouveaux concepts sanitaires au Luxembourg, motivée par

le fait que les technologies et concepts appliqués actuellement pour l'évacuation et le traitement des

eaux usées présentent des déficits inhérents importants. Ainsi les impacts sur l’environnement sont

multiples et néfastes (pollution des cours d’eau et des nappes phréatiques, consommation d’eau et

d’énergie élevée, etc.) et les coûts considérables. Les activités du projet en 2004 sont présentées sous

trois grands axes qui s’articulent autour de l’information: acquisition, traitement et diffusion.

Le concept de plate-forme d’information développée dans le cadre du projet qui sert à alimenter les

différentes étapes de diffusion et d’exploitation de l’information a été formalisé en processus de veille

modulaire. L’outil a été présenté au Congrès annuel de la veille stratégique scientifique et technique

à Toulouse (VSST’04). Le système proposé est modulable, permet de répondre rapidement aux

questions de l’expert, utilise la complémentarité de différents types d’analyse, et apporte des résultats

en adéquation avec les besoins informationnels des chercheurs.

Le travail sur les projets pilotes a été poursuivi par le biais d’une étude sur les grandes installations

de récupération des eaux de pluie et l’élaboration de recommandations pour réduire les impacts

environnementaux de telles installations, appliquées par la suite à une école modèle pour 350 élèves

(voir illustration), dans le cadre du projet d’urbanisation «Nonnewisen» à Esch-sur-Alzette. Les résultats

de cette étude ont été présentés aux responsables politiques et techniques de la ville lors de deux

workshops en février et octobre 2004.

Différents moyens de diffusion de l’information ont également été mis en œuvre. Une conférence sur

les techniques innovantes disponibles dans le domaine sanitaire a été organisée dans les locaux de la

chambre des métiers en juin 2004, en collaboration avec la Fédération Luxembourgeoise des Artisans.

La documentation a été diffusée sous forme électronique (CD-Rom). Une description détaillée des

résultats du projet a été mise en ligne sur les pages Internet complètement retravaillées du CRTE.

Les résultats finaux du sondage sur l’utilisation de l’eau au Luxembourg, lancé une année auparavant

et finalisé en printemps 2004 en collaboration avec la ville d’Esch-sur-Alzette, furent présentés à

l’Oekofoire 2004. Fin 2004 a vu l’envoi de la 1 ère édition de la newsletter EcoSanLux qui est alimentée

par le processus de veille et informe les acteurs luxembourgeois sur les activités et résultats du projet.

«Illustration de la consommation en énergie liée à différents

scénarios d’approvisionnement en eau des installations

sanitaires dans une école modèle de 350 élèves. La

récupération de l’eau de pluie pour les chasses d’eau des

toilettes et des urinoirs augmente la demande en énergie

pour le pompage (scénario EPL) par rapport au scénario

avec des installations à basse consommation en eau

(scénario ECO). La combinaison d’une telle installation

avec des urinoirs sans eau permet cependant d’améliorer

le bilan énergétique (scénario EPLU) comme la pression

d’eau nécessaire peut être réduite. (source: Marc Jacoby,

2004).»

Eau

47


01/03/06

FNR

Application des outils de modélisation/simulation et d’analyse des flux à la

technologie des lits fluidisés: suivi scientifique de la mise en œuvre d’une

nouvelle technique de traitement des eaux usées au Luxembourg (LITFLUID)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Mario Plattes, Centre de Ressources des Technologies pour l’Environnement (CRTE),

CRP Henri Tudor

Adresse e-mail: mario.plattes@tudor.lu

Site internet du projet: www.crte.lu (Rubrique EAU)

Partenaire(s): Cellule de recherche en Environnement et Biotechnologies (CREBS), CRP Gabriel Lippmann

Durée: 1 er janvier 2002 – 30 juin 2006

Contribution FNR: 579.765 €

«La station pilote pompe les boues en excès dans le bassin d’aération de la station d’épuration de Hesperange.»

Le projet a comme objectif l’étude d’une nouvelle technologie de traitement des eaux usées au

Luxembourg, la technologie des lits fluidisés. Des lits fluidisés seront installés à la station d’épuration

de Hesperange dans le cadre d’un projet de modernisation. La technologie des lits fluidisés est étudiée

sur une station pilote installée sur le site de la station d’épuration de Hesperange. Le projet de

modernisation et le projet de recherche ont été présentés au centre culturel Nicolas Braun à Hesperange

le 30 juin 2004.

Suite à l’installation de la station pilote en 2003 les procédés à lits fluidisés ont été étudiés en 2004.

La station pilote a d’abord fonctionné en mode «nitrification seule». Du 3 au 6 août 2004, une

campagne d’échantillonnage a été réalisée. Les résultats de cette campagne ont permis d’évaluer le

rendement épuratoire de la station pilote: Une élimination de 90 % de la DBO5 et un taux de nitrification

de 87 % ont été observés. D’ailleurs une partie importante (31 %) de l’azote total de l’influent

a été éliminée/dénitrifiée dans cette configuration. Un modèle de la station pilote a été élaboré et calé

à l’aide de tests de respirométrie. La station pilote fonctionne en mode «dénitrification» depuis

septembre 2004. Une campagne diagnostique réalisée le 9 novembre 2004 a confirmé que la station

élimine 61% de l’azote total présent dans l’influent. Ce taux d’élimination correspond à la valeur

théorique déterminée par le dimensionnement de la station.

En ce qui concerne les analyses microbiologiques, les travaux se sont tout d’abord portés sur la

validation de marqueurs internes permettant la comparaison, entre gels différents, des patterns de

bandes obtenus par DGGE. Ensuite, les phases d’extraction et d’amplification par PCR ont été

optimisées pour des échantillons de biomasse provenant du prototype. Des tests ont été réalisés pour

définir les conditions optimales de récupération du bio-film se développant sur les supports en

polyéthylène, en vue de leur analyse par DGGE ou TSA-FISH. Un protocole d’extraction de l’ADN des

bio-films se développant sur les supports a également été mis au point. Les densités de bactéries, leurs

biovolumes et leurs vitesses d’assimilation ont été déterminés dans la phase particulaire en suspension

ainsi que dans le bio-film. La diversité bactérienne a également été étudiée par DGGE. Les résultats

montrent que l’activité nitrifiante est essentiellement localisée sur les supports. Les bactéries

rencontrées sont des bactéries typiques des milieux fécaux.

48

Eau


FNR

01/03/07

Modélisation d’un réseau d’assainissement: contribution

à la gestion des risques de pollution de la réserve d’eau potable

de la Haute-Sûre. (RESEAUSURE)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Emmanuel Henry, Centre de Ressources des Technologies pour l’Environnement

(CRTE), CRP Henri Tudor

Adresse e-mail: emmanuel.henry@tudor.lu

Site internet du projet: www.crte.lu (Rubrique EAU)

Durée: 1 er janvier 2002 – 30 juin 2007

Contribution FNR: 920.235 €

«Sonde Doppler de débit, pluviomètre et sonde qualitative multi-paramètres équipant le site pilote à Eschdorf.»

Ce projet a pour objet majeur la modélisation mathématique du réseau d'assainissement des eaux usées

des localités situées autour du lac de la Haute-Sûre. Le modèle permettra au gestionnaire du réseau,

le Syndicat Intercommunal de Dépollution des Eaux résiduaires du Nord (SIDEN), de réaliser une

gestion en temps réel des ouvrages d'assainissement (vannes, bassins d'orage, déversoirs, stations

d'épuration, organes de contrôle, etc.). Le but est de limiter, d'une part, les déversements intempestifs

d'eaux usées dans le lac et de préserver ainsi la qualité de la réserve d'eau potable de la Haute-Sûre

et, d'autre part, d'optimiser le fonctionnement et le rendement de la future station d'épuration à

Heiderscheidergrund en fonction de la qualité et de la quantité des eaux usées collectées.

Depuis le vote en août 2003 de la loi autorisant l'Etat à participer au financement des travaux

nécessaires à l'évacuation et à l'épuration des eaux usées générées par les localités regroupées autour

du lac de la Haute-Sûre, les bureaux d'études impliqués dans le projet d'assainissement ont délivré les

plans des premiers collecteurs qui seront raccordés à la future station d'épuration d'Heiderscheidergrund.

Ces plans ont été intégrés dans le logiciel de modélisation InfoWorks‘ CS et des simulations du

comportement des ouvrages ont été réalisées en «batch» au CRTE. En outre, les mesures de routine

concernant les stations météorologiques de la région du lac de la Haute-Sûre ainsi que les données

provenant de la télégestion des stations de traitement d'eaux usées gérées par le SIDEN ont été

recueillies. Le traitement des données pluviométriques issues des stations météorologiques installées

dans le cadre du projet par le SIDEN confirme une pluviométrie annuelle moyenne élevée approchant

les 900 mm, par comparaison aux relevés pluriannuels de stations situées dans la région de la vallée

de la Moselle plus proches de 750 mm. Puisque la pluie influence fortement les débits d'eaux usées

collectées, les données des stations pluviométriques du SIDEN sont intégrées dans le logiciel de

modélisation pour tenir compte de la spécificité de la région. Par ailleurs, le site de démonstration à

Eschdorf a été équipé de capteurs mobiles (débitmètre, pluviomètre, capteurs de qualité des eaux

usées) où les données sont recueillies afin de déterminer les charges hydrauliques polluantes provenant

de la localité, d'établir des corrélations de pluie-débit et de caler le modèle mathématique d'Eschdorf.

Eau

49


01/03/08

FNR

Flux de matières dans le bassin versant de l'Alzette:

impacts de micro/macro-polluants et de nutriments

sur la qualité des ressources hydriques (FLUXALZETTE)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Joëlle Welfring, Tom Gallé, Centre de Ressources des Technologies pour l’Environnement

(CRTE), CRP Henri Tudor

Adresses e-mail: joelle.welfring@tudor.lu, tom.galle@tudor.lu

Site internet du projet: www.crte.lu (Rubrique EAU)

Durée: 1 er février 2002 – 31 janvier 2007

Contribution FNR: 500.000 €

Le but du projet FluxAlzette est d’élaborer les bases pour une gestion durable du bassin versant de l’Alzette,

qui concentre sur son territoire la majorité de la population et des activités industrielles au Luxembourg.

La caractérisation et la modélisation des flux de polluants (nutriments, métaux lourds, pesticides, etc.)

générés par les activités humaines permettront la simulation de différents scénarios de gestion dans le

bassin versant. Les scénarios ainsi simulés pourront tenir compte de changements tels que l’accroissement

de la population ou l’amélioration des performances des stations d’épuration et permettront

ainsi de prédire leurs effets sur ces flux de matières. Au cours de l’année 2004, l’équipe de projet a

continué à réaliser des analyses sur toute la longueur de la rivière, dont les résultats permettent l’établissement

de bilans et le calcul de flux de matières, ainsi qu’une localisation des principales sources de polluants.

Ainsi, les campagnes d’échantillonnages hebdomadaires effectuées sur 6 sites différents le long de l’Alzette

fournissent les données nécessaires à l’établissement d’une relation fiable entre les charges hydrauliques

et les concentrations des différents polluants analysés. Par ailleurs, des campagnes d’analyses ciblant

spécifiquement des ondes de crues ont été menées afin d’obtenir des précisions sur les dynamiques

de transport de matières qui surviennent suite à des évènements de pluie.

Dans le but de caractériser les charges de polluants déversés directement dans l’Alzette à partir des déversoirs

d’orage, l’équipe de projet a utilisé un débitmètre à cinémométrie d’aire, qui permet de déclencher

la prise d’échantillons à l’aide d’un échantillonneur automatique dans le réseau d’assainissement en

amont du déversoir d’orage de Bonnevoie. Les informations ainsi obtenues serviront de base pour estimer

les charges de polluants provenant de surfaces urbaines du bassin versant de l’Alzette.

De manière parallèle aux activités d’échantillonnage, un premier modèle mathématique a été établi en

collaboration avec les chercheurs du groupe S&E (Stoffhaushalt und Entsorgungstechnik) de l’EAWAG

(Eidgenössische Anstalt für Wasserversorgung, Abwasserreinigung und Gewässerschutz, Suisse). Ce

modèle, représentant un sous-système du bassin versant de l’Alzette (bassin versant technique relié à

la station d’épuration de Bettembourg) est actuellement en cours de validation et, une fois calibré, il

constituera la base pour les simulations dynamiques de différents scénarios d’amélioration.

«Dispositif d’échantillonnage

installé en amont du déversoir

d’orage à Bonnevoie.»

50

Eau


»

PROGRAMME BIOSAN

Santé et Biotechnologie

Durée: 2002 – 2008

Budget total: 6.000.000 €

1er appel en 2001: 7 projets sélectionnés (6.000.000 €)

Les causes de décès les plus fréquentes dans les pays développés découlent des maladies cardio- et cérébrovasculaires

et du cancer. Des études statistiques, conduites par la Direction de la Santé sur les causes

primaires de la mortalité au Luxembourg, confirment ces observations internationales. Ainsi une proportion

très importante de la population la plus active est touchée par ces maladies, et cette morbidité,

voire cette mortalité prématurée, entraîne des répercussions importantes sur le plan socio-économique.

Pour la santé publique, la recherche biomédicale visant l’amélioration de la prévention, du diagnostic

et de la thérapie de ces maladies reste de ce fait une priorité absolue.

Le «Programme de Recherche Biotechnologie et Santé» s’articule autour de trois axes principaux: le

cancer, les maladies cardio- et cérébro-vasculaires et l’intervention immunologique. Son but est de

contribuer à l’amélioration qualitative de la prévention, de la détection et du traitement du cancer et

des maladies du cœur et des vaisseaux ainsi qu’au développement de nouvelles stratégies pour la modulation

spécifique du système immunitaire.

La mobilisation et la compétitivité de la recherche biomédicale luxembourgeoise tant sur le plan

fondamental et clinique que sur le plan des biotechnologies nouvelles au service de la santé s’en

trouveront renforcées.

LE PROGRAMME S’ORIENTE SUIVANT SIX AXES PRIORITAIRES:

» Cancer;

» Maladies cardio- et cérébro-vasculaires;

» Nouvelles stratégies d’intervention immunologique;

» Développement de librairies d’expression pour le ciblage fonctionnel et topographique

de systèmes biologiques complexes;

» Épidémiologie;

» Environnements informatiques intelligents dans le domaine de la santé.

Biosan

51


En 2004 des comités de pilotage ont eu lieu en vue d’évaluer les programmes pluriannuels en cours.

Les experts du comité de pilotage du programme BIOSAN ont souligné que les projets BIOSAN en cours

s’avèrent compétitifs au niveau international. En effet, certains des projets sont d’une qualité qui laisse

songer à la création d’un pôle de compétence dans le domaine du cancer. Dans ce cadre,

les experts ont relevé l’importance d’une collaboration renforcée au niveau national pour créer une dynamique

locale et une masse critique sur place. Ainsi on pourrait prévoir d’associer des scientifiques

expérimentés aux cliniciens, pour étoffer les compétences de la recherche clinique au niveau de la

recherche plus fondamentale.

D’autres suggestions visent à introduire dans le programme une dimension de partenariat industriel et

de développer une cellule de valorisation des résultats de recherche en vue de la commercialisation

éventuelle de produits et de résultats de recherche.

Le point faible identifié par les experts est le manque de visibilité du programme, qui pourrait être adressé

en augmentant le nombre de publications scientifiques et la participations à des congrès internationaux.

Projets du programme BIOSAN:

par des cellules dendritiques

CRP Santé

pulsées à l’aide de cellules

mammaires apoptotiques

de symptômes respiratoires,

CRP Santé

de l’hyperréactivité

et de l’atopie

modifiés dans un but

CRP Santé

d’immunothérapie. Façonnage

et analyse fonctionnelle

à l’aide d’un système in vitro

Project: Monitorage

CRP Santé

de patients atteints

de défaillances cardiaques

sévères

antigènes de faible poids

de la Santé

moléculaire, nouvelles

stratégies et applications

52

Biosan

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR/01/04/01 Vaccination antitumorale G. Berchem Centre Hospitalier/ 01.03.03 30+30 mois 558.570 € 291.285 €

FNR/01/04/03 Etude sur la prévalence R. Nati Centre Hospitalier/ 01.04.02 18 mois 184.927 € 184.927 €

FNR/01/04/04 Allergènes recombinants F. Hentges Centre Hospitalier/ 01.07.02 42 mois 490.000 € 490.000 €

FNR/01/04/06 Application de la technique N. Kieffer CRP Santé 01.11.02 30+30 mois 1.100.000 € 628.906 €

de microdissection par laser

à l’analyse génotypique

des cellules tumorales

invasives du cancer

de la prostate

FNR/01/04/08 Luxembourg Heart Failure D. Wagner Centre Hospitalier/ 31.03.05 33+30 mois 720.000 € 660.041 €

FNR/01/04/09 Création d’une nouvelle E. Friederich CRP Santé 01.02.02 30+30 mois 1.400.000 € 823.922 €

compétence en bio-informatique

et d’une plateforme technologique

d’analyse génique à

grande échelle (puces à ADN)

FNR/01/04/11 Vaccins contre des C. Muller Laboratoire National 01.06.02 43+30 mois 1.546.503 € 773.509 €

Subtotal: Montant disponible BIOSAN, 6.000.000 € 3.852.590 €

selon Convention avec l’Etat:

6.000.000 €


FNR

01/04/01

Vaccination antitumorale par des cellules présentatrices d’antigènes

pulsées à l’aide de cellules tumorales apoptotiques: Etude comparative

de l’effet immunogène de différentes méthodes d’induction d’apoptose

Centre de Recherche Public Santé

Personne(s) de contact: Guy Berchem, Hématologie, Centre Hospitalier de Luxembourg

Adresse e-mail: berchem.guy@chl.lu

Durée: 1 er mars 2003 – 31 août 2005

Contribution FNR: 291.285 €

Prolongation éventuelle: 30 mois avec contribution max. 267.285 €

Par une approche immunothérapeutique à l’aide d’anticorps monoclonaux, des résultats intéressants

dans le traitement de la Leucémie Lymphoïde Chronique ont pu être observés et ont permis le développement

d’une immunothérapie ciblée. Des transplantations autologues ou allogéniques de cellules

présentatrices d’antigènes (APC) sont actuellement en étude car elles présenteraient un potentiel curatif.

Dans le cadre de ce projet de vaccination antitumorale, notre laboratoire met en place une nouvelle

stratégie de vaccination faisant intervenir des lymphocytes B extraits du sang périphérique de patients

comme APC. Ces cellules, réintroduites chez le patient après avoir été activées in vitro par des

cellules B apoptotiques, devraient permettre une réponse cytotoxique spécifiquement dirigée contre

les cellules tumorales. Au cours de l’année 2004, diverses méthodes de différenciation des lymphocytes

B en APC ont été testées, et les marqueurs cellulaires CD 54, 80 et 86 et HLA-DR ont été évalués

par cytométrie de flux au cours de la différenciation. Celle-ci est actuellement induite par activation

à l’aide d’une lignée de fibroblastes de souris transfectées sur-exprimant le ligand CD40. D’autre part,

les cellules de plusieurs patients leucémiques ont été traitées par divers agents (Irradiation UV, velcade,

Fludarabine…) et l’apoptose a été recherchée à l’aide de plusieurs méthodologies (viabilité cellulaire,

fragmentation de l’ADN, cytométrie de flux, marquage in situ par technique TUNEL, annexine V).

La phagocytose de cellules induites en apoptose par les lymphocytes B différenciés en APC a été mise

en évidence par microscopie confocale.

Cellules Apoptotiques

Induction

Mise en contact

Phagocytose

Lymphocytes B

de patient CLL

Differenciation

Cellules présentatrices

d’Ag (CPA)

Mise en évidence par microscopie confocale de la phagocytose de cellules

apoptotiques par des cellules présentatrices d’antigènes.

CPA Activées

Marquages membranaires PKH26 rouge PKH67 vert

Biosan

53


01/04/03

FNR

Etude sur la prévalence de symptômes respiratoires, de l’hyperréactivité

bronchique et de l’atopie parmi les adultes au Luxembourg

Centre de Recherche Public Santé

Personne(s) de contact: Romain Nati, Service de Pneumologie, Centre Hospitalier de Luxembourg

Adresse e-mail: nati.romain@chl.lu

Durée: 1 er avril 2002 – 15 juillet 2004 (projet terminé)

Contribution FNR: 184.927 €

Cette étude s’est déroulée sur deux ans et demi avec un double but:

» d’une part fournir des données épidémiologiques sur les indicateurs majeurs de l’asthme et des allergies

respiratoires dans la population luxembourgeoise. Il faut noter que contrairement aux autres pays

de la Communauté Européenne, le Luxembourg n’a jusque maintenant pas disposé de telles données

pouvant entrer dans des analyses internationales comparatives;

» d’autre part rechercher des différences de prévalence de ces indicateurs entre la population résidente

luxembourgeoise et la population portugaise immigrée: en effet, plusieurs études ont suggéré dans

le passé une influence de la migration sur la symptomatologie, le profil allergique et l’accès aux

soins dans la maladie asthmatique. L’existence d’une immigration récente et importante du Portugal

vers le Luxembourg se prête particulièrement bien à l’étude de l’effet de la migration sur l’asthme.

L’étude est activement soutenue par la Division de la Médecine Préventive et Sociale et le Service des

Statistiques de la Direction de la Santé.

Une première phase du projet s’est déroulée de mars à juin 2002 et a comporté l’envoi d’un court

questionnaire portant sur la présence de symptômes respiratoires à un échantillon randomisé de 7876

personnes habitant les cantons de Luxembourg et d’Esch/Alzette. Il a été possible d’obtenir un taux

de réponse de 82,1%, qui est donc supérieur au taux médian (78%) obtenu par 48 centres dans

22 pays utilisant la même méthodologie au début des années 90.

La deuxième phase s’est déroulée de mars 2003 à juillet 2004. Elle s’est caractérisée par le remplissage

d’un questionnaire structuré, la réalisation d’examens de la fonction respiratoire et la détermination

du profil allergologique sur un échantillon des participants à la première phase.

La mesure du NO exhalé, un marqueur prometteur de l’inflammation dans l’asthme, a été intégrée

dans le but d’examiner son utilité potentielle dans des études d’épidémiologie respiratoire. 712 personnes

ont pu être examinées lors de cette 2 e phase.

L’expérience obtenue avec la méthodologie appliquée sera utile dans l’élaboration du design d’études

futures sur l’état de la santé de la population au Luxembourg, notamment dans la perspective d’une

démarche communautaire commune dans l’élaboration d’un système d’information et de connaissance

dans le domaine de la Santé dans l’Union européenne (EUHIKS).

L’évaluation des résultats continue à se faire actuellement conjointement avec le SETT (Service d’Epidémiologie

et Transfert des Technologies) du CRP Santé. Les premiers résultats mettent notamment

en évidence des différences significatives dans la prévalence de symptômes respiratoires entre la population

luxembourgeoise et la population migrante portugaise.

54

Biosan


Pourcentages standardisés des prévalences de réponses positives en

fonction de la nationalité et du pays de naissance (en comparaison aux

résultats ECRHS)

Percent prevalence LL PP PL Antwerp- Coimbra † ECRHS

City † median †

Q1 wheeze 18,3 18,1 21,7 20,6 19 20,7

Q2 woken up with chest tigthness 12,5 17,3***

20,7 10,3 18,8 13,5

Q3 woken by breathlessness 5,1 10,2***

11,5 6,9 10,6 7,3

Q4 woken by attack of coughing 23,3 28,7***

28,6 27,2 25,2 27,9

Q5 self-reported attack of asthma 4,3 4,2 6,3 2,6 4,3 3,1

Q6 treatment for asthma 5,3 4,7 5,7 3,4 4,9 3,5

Q7 nasal allergies/hayfever 24,1 16,3***

21,7 25,1 16,7 20,9

LL : Luxembourg nationality, born in Luxembourg ; PP : Portuguese nationality, born in Portugal ; PL: Portuguese nationality, born in Luxembourg

† ECRHS, Eur Respir J, 1996,687-695

chi-squared test for difference among LL and PP; ***p


01/04/04

FNR

Allergènes recombinants modifiés dans un but d’immunothérapie.

Façonnage et analyse fonctionnelle à l’aide d’un système in vitro.

Centre de Recherche Public Santé

Personne(s) de contact: François Hentges, Laboratoire d’immunogénétique et d’allergologie, CRP Santé

Adresse e-mail: Hentges.francois@chl.lu

Partenaire(s): Centre Hospitalier de Luxembourg, Laboratoire National de Santé

Durée: 1 er janvier 2003 – 31 décembre 2005

Contribution FNR: 490.000 €

Les allergènes majeurs du chat sont une utéroglobine (Feld1) et l’albumine sérique (CSA). Le but de

notre projet est d’identifier les épitopes T (les régions reconnues par les cellules lymphocytaires T) sur

la CSA, ainsi que sur Feld1. La construction d’allergènes recombinants modifiés, ainsi que leur expérimentation

dans des systèmes de cultures de cellules dendritiques (DC) humaines et murines, menées

en parallèle à des tests in vivo chez les souris, permettront d’étudier leur utilisation en immunothérapie.

Dans le courant de la première année, l’accent avait particulièrement été mis sur l’analyse de la réponse

immunitaire humaine à des fragments recombinants de la CSA, en fonction des déterminants

HLA (intervenant dans la réponse immune).

En 2004, des avancées majeures ont été réalisées dans l’analyse de la réponse de souris BALB/c aux

allergènes CSA et Feld1. L’utilisation de cette lignée consanguine permet de simplifier l’analyse des

résultats quant à la restriction immune des épitopes. Des modifications ont été apportées au système

de culture des DC, pour l’adapter aux souris. Les cellules dendritiques myéloïdes matures obtenues ont

été utilisées in vitro pour présenter les déterminants antigéniques à des lymphocytes T de souris

naïves ou sensibilisées. L’effet de cellules T régulatrices CD4 + CD25 + sur la prolifération de cellules

répondantes CD4 + CD25 - a été étudié.

Afin de situer les épitopes T et les épitopes B (les régions reconnues par les anticorps), 12 fragments

recombinants recouvrant l’albumine sérique et 17 peptides synthétiques recouvrant l’entièreté des 2

chaînes de l’hétérodimère Feld1 et ont été utilisés. La réponse lymphocytaire primaire contre la CSA (à

80% identique à l’albumine de souris) est principalement induite par les fragments IIr, Vr, VIIr, IXr, Xr,

XIIr. Les lymphocytes de souris sensibilisées ont donné en plus une réponse faible envers d’autres fragments.

Les domaines reconnus par les anticorps diffèrent très sensiblement des régions reconnues par

les lymphocytes T. En ce qui concerne l’allergène Feld1, la souris BALB/c reconnaît principalement le

peptide F1.4. Ceci est observé aussi bien pour les lymphocytes naïfs que pour les lymphocytes sensibilisés.

Dans le cadre de l’étude des mécanismes tolérogènes, les lymphocytes régulateurs naturels

CD4 + CD25 + étaient capables d’inhiber complètement la réponse de lymphocytes CD4 + CD25 - envers

différents épitopes T de la CSA et de Feld1. Ces résultats ont été obtenus pour des cellules régulatrices

provenant de souris naïves ou sensibilisées, en réponse immunitaire primaire comme secondaire.

L’inhibition était dose dépendante et était complète pour des ratios d’une cellule régulatrice pour trois

cellules répondantes.

56

Biosan


albumine entière

vue du dessus

albumine entière

vue de face

KCASLQKFGERAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKEC

hélice HHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHH

tournant

TT

enroulement

CCC

Représentation spatiale du fragment CSA V (épitope majeur) de l’albumine du chat par projection sur la molécule cristallisée

de l’albumine humaine. La séquence du fragment est détaillée, ainsi que sa structure tertiaire prédite par GOR

(H: structure en hélice; T: structure en tournant et C: enroulement).

Biosan

57


01/04/06

FNR

Application de la technique de microdissection par laser à l’analyse

génotypique des cellules tumorales invasives du cancer de la prostate

Centre de Recherche Public Santé

Personnes de contact: Nelly Kieffer, Université du Luxembourg

Durée : 1 er novembre 2001 – 30 novembre 2007

Contribution FNR: 1.100.000 €

Publications scientifiques «référées»:

N. Kieffer, M. Schmitz, S. Plançon, C. Margue, F. Huselstein, G. Grignard, W. Dippel, M. Nathan, S. Giacchi,

and R. Scheiden. ILK as a potential marker gene to ascertain specific adenocarcinoma cell mRNA isolation

from frozen prostate biopsy tissue sections. Int. J. Oncology (sous press).

L’objectif initial de ce projet a été la mise en place d’un laboratoire de pathologie moléculaire (LPM)

à l’interface entre chercheurs scientifiques, cliniciens et médecins pathologistes afin de développer des

compétences nouvelles en biologie moléculaire applicables à l’analyse d’échantillons anatomopathologiques

en vue de réaliser des études de recherche sur le cancer, avec comme première cible le cancer de la

prostate.

La première phase du projet couvrant les années 2002 – 2003 a permis de valider la plateforme technologique

(isolement de cellules cancéreuses de coupes tissulaires par dissection microscopique à l’aide

de rayon laser, extraction d’ADN et d’ARN des fragments tissulaires disséqués, analyse quantitative par

PCR en temps réel de l’expression de gènes dans les cellules tumorales isolées, séquençage de gènes

potentiellement mutés, identification de cellules cancéreuses circulant dans le sang) et d’établir une

large collection d’échantillons biologiques provenant de patients atteints du cancer de la prostate.

Grâce à cette plateforme technologique, plusieurs études scientifiques ont pu été initiées concernant

l’analyse de l’expression de certains gènes qui pourraient être dérégulés au cours du processus de cancérisation

des cellules prostatiques. En particulier, des résultats très intéressants ont été obtenus sur

l’expression de la protéine kinase ILK, qui s’avère être un marqueur très spécifique des cellules

adénocarcinomateuses de la prostate et qui servira dans l’avenir de marqueur de qualité dans des

études comparant le profil génotypique des cellules prostatiques cancéreuses par rapport aux cellules

prostatiques normales.

Une deuxième étude en cours concerne le rôle de la phosphatase PTEN dans la signalisation intracellulaire

initiée par les facteurs de croissance dans les cellules épithéliales prostatiques et les dérégulations de

cette signalisation dans les adénocarcinomes prostatiques.

En dernier lieu, une analyse génétique sur le polymorphisme Arg462Gln du gène RNASEL a été initiée

chez des individus normaux et des individus atteints d’un cancer de la prostate afin de déterminer une

association potentielle entre ce polymorphisme et un risque accru de développer un cancer de la

prostate.

58

Biosan


FNR

01/04/08

Luxembourg Heart Failure Project

Centre de Recherche Public Santé

Personne(s) de contact: Daniel Wagner, Cardiologie, Centre Hospitalier de Luxembourg

Partenaire(s): Centre de ressources SANTEC, CRP Henri Tudor

Durée: 1 er janvier 2002 – 30 juin 2005

Contribution FNR: 660.041 €

Prolongation éventuelle: 30 mois, contribution maximale FNR de 59.959 €

L’objectif de ce projet est la création d’une plate-forme de telemonitoring destinée à suivre des patients

atteints d’insuffisance cardiaque. Moins de trois ans après le démarrage du projet, la plate-forme

est bien en place et fonctionnelle. Cette plate-forme de monitoring cardio-vasculaire est capable de

mesurer tension artérielle, fréquence cardiaque, saturation en oxygène, vitesse de l’onde de pouls ainsi

que le poids du patient. Ces variables physiologiques semblent être critiques pour suivre les patients

atteints d’insuffisance cardiaque. La reproductibilité de ces variables mesurées à l’aide de la plate-forme

la été confirmée par de multiples mesures répétées au cours du temps chez des sujets sains et chez

des patients atteints d’insuffisance cardiaque sévère. Les variables physiologiques obtenues avec la

plate-forme de home monitoring ont été étudiées dans les différentes phases de la maladie de l’insuffisance

cardiaque et 23 patients ont été suivis pendant 6 mois. Il semble que le rapport entre la vitesse de

l’onde de pouls et la tension artérielle (PTT/BPs) varie selon la sévérité de la maladie cardiaque (Fig.2).

Ce paramètre pourrait être utilisé comme marqueur précoce d’une éventuelle rechute de la maladie.

En parallèle, a été mise au point la transmission sécurisée des données via le réseau HealthNet et une

demande de brevet de notre plate-forme de home monitoring a été lancée. Dans la dernière phase du

projet une étude clinique multicentrique va être faite.

Biosan

59


01/04/09

FNR

Création d’une nouvelle compétence en bioinformatique et

d’une plate-forme d’analyse génique à grande échelle (puces à ADN).

Centre de Recherche Public Santé

Personne(s) de contact: Evelyne Friederich, CRP Santé et CNRS

Adresse e-mail: evelyne.friederich@crp-sante.healthnet.lu

Site internet du projet: www.microarray.lu

Partenaire(s): Centre de ressources SANTEC, CRP Henri Tudor, Laboratoire national de la Santé

Durée: 1 er février 2002 – 31 juillet 2004

Contribution FNR: 823.922 €

Prolongation éventuelle: 30 mois (acceptée); contribution max. FNR de 576.078 €

Prix: Evelyne Friederich a reçu le second prix d’honneur de la Fondation Internationale pour la Substitution

de l’Expérimentation Animale (FISEA).

La plate-forme nationale d’analyse génomique a pour vocation de faciliter l’accès des laboratoires de

recherche, publics ou privés, à l’utilisation des puces à ADN et aux différentes étapes de leur analyse.

Elle regroupe trois pôles d’activité: un groupe d’ingénierie des bio-puces qui conçoit et fabrique les

microarrays, réalise les expériences d’analyse transcriptomique et en analyse les résultats avec le soutien,

d’une part, d’une équipe d’imagerie compétente dans l’analyse et la qualité optique des bio-puces, et

d’autre part, d’un groupe de bioinformatique et de biostatistique.

L’année 2004 aura vu l’achèvement de la première phase du projet et la concrétisation de ses objectifs

avec la mise en place des différentes équipes, du matériel et de méthodologies validées en interne. La

plate-forme aborde aujourd’hui la seconde phase du projet qui consiste à valider ses compétences en

se fondant sur une application en cancérologie focalisée sur l’étude de la transition épithélium mésenchyme

(EMT), une étape-clef de la formation des tumeurs invasives.

Un des principaux points de l’activité de la plate-forme en 2004 aura été la validation de ses compétences

en matière de conception de microarrays «à façon». Ainsi, un premier prototype d’une bio-puce dédiée à

l’étude de l’expression des gènes impliqués dans le cytosquelette d’actine (ACTIchip) a été réalisé à

l’aide d’oligonucléotides longs désignés en utilisant un programme informatique développé en interne.

La bio-puce a été validée en comparant ses performances avec celles de microarrays commerciaux à

cDNA ou à oligonucléotides courts. Les tests, réalisés sur des échantillons biologiques standardisés,

ont montré des niveaux comparables de spécificité et de sensibilité entre les différentes bio- puces.

Sur la base de ces bons résultats, le second prototype d’ACTIchip a été mis en œuvre, qui inclue près

de 2000 spots correspondant à 364 gènes reliés au cytosquelette, ainsi que 60 contrôles de qualité. Cette

bio-puce sera mise à profit pour l’étude de tumeurs invasives.

Les autres activités de la plate-forme ont été principalement centrées sur la mise au point de procédures

permettant l’analyse et la validation statistique des données de microarrays, leur archivage, ainsi que

leur exploitation bioinformatique à l’aide des bases de données biologiques et des logiciels installés

localement. Une suite de logiciels d’analyse d’image a été finalisée qui est dotée d’un nouvel algorithme

permettant une meilleure détection automatique des spots présents sur les microarrays et une évaluation

de leur qualité optique. Enfin, les trois pôles de la plate-forme ont poursuivi leurs efforts en

matière de veille technologique, d’assistance et de formation auprès des utilisateurs, de diffusion et

de valorisation de l’information scientifique et technique auprès du grand public, et de mise en place

de collaborations au plan national et international.

La plate-forme est aujourd’hui impliquée dans plusieurs projets de recherche, fondamentale et appliquée,

dans des domaines très variés allant de la détection d’organismes pathogènes et d’allergènes, à l’étude

de pathologies complexes, telle que la maladie d’Alzheimer.

60

Biosan


FNR

01/04/11

Sans expression de Snail

F-ACTINE

Sans expression de Snail

E-CADHERINE

L’expression de Snail

F-ACTINE

Sans expression de Snail

F-ACTINE

Un modèle cellulaire pour étudier la progression tumorale: L’une des étapes-clefs de la progression des tumeurs d’origine épithéliale

est la transition épithélium mésenchyme (EMT). Cette transition est caractérisée par une modification radicale de la morphologie et

du comportement des cellules qui deviennent invasives et capables de se disséminer dans l’organisme. Afin d’étudier ce mécanisme

sur le plan transcriptomique, une lignée cellulaire stable a été établie par la plate-forme d’analyse génomique à partir de cellules d’adénocarcinome

de glande mammaire (tumeur du sein) en implantant un gène codant pour un facteur de transcription, Snail, dont

l’expression peut être initiée à volonté et provoque une EMT. Les clichés de microscopie d’épi fluorescence montrent la localisation de

deux marqueurs cellulaires importants, l’actine filamenteuse et la E-cadhérine, dans des cellules de cette lignée avant et après l’induction

de l’expression de Snail qui provoque d’évidentes modifications morphologiques. Une analyse transcriptomique approfondie

des modifications induites par Snail est actuellement en cours. Elle met à profit une bio-puce dédié à l’étude du cytosquelette,

ACTIchip, qui a été mise au point par la plat-forme.

Vaccines against low molecular antigens:

novel strategies and application (TOBAVAC)

Laboratoire National de Santé

Personne(s) de contact: Claude Muller, Institut d’Immunologie, LNS

Adresse e-mail: claude.muller@lns.etat.lu

Site internet du projet: www.etat.lu/LNS

Partenaire(s): Département des Sciences, Université du Luxembourg

Département de Psychologie, Université du Luxembourg

Durée: 1 er juin 2002 – 30 mars 2006

Contribution FNR: 773.509 €

Prolongation éventuelle: 30 mois, contribution maximale FNR de 772.994 €

Publications scientifiques «référées»:

» S. De Buck, Patrick Augustijns and Claude Muller. Specific antibody modulates absorptive transport

and metabolic activation of benzo[a]pyrene across Caco-2 monolayers*. Journal of Pharmacology and

Experimental Therapeutics 2005.

» S. de Buck, C. Ensch, W. Ammerlaan, A. Brandenburger, C. Muller. The molecular and cellular mechanism

of an immunoprophylactic intervention against benzo(a)pyrene. Carcinogenesis 2005.

» S. de Buck. C. Muller. Immunoprophylactic approaches against chemical carcinogenesis. Vaccine special

issue 2005.

La combustion incomplète de matière organique fossile ainsi que la cigarette peuvent conduire à une

exposition considérable de la population aux hydrocarbures aromatiques polycycliques. C’est notamment

le cas du benzo[a]pyrène, carcinogène connu de la fumée de cigarette, qui serait susceptible

d’augmenter le risque de cancer.

L’objectif de ce présent projet est de développer une stratégie immuno- prophylactique fondée sur

l’utilisation de vaccins conjugués afin de protéger l’organisme contre ces xénobiotiques carcinogènes.

Les anticorps monoclonaux ont été produits par immunisation du benzo[a]pyrène conjugué à un carrier.

Biosan

61


Les études menées in vitro ont à présent démontré que des anticorps monoclonaux administrés au niveau

des muqueuses ou au niveau systémique protégeraient l’organisme contre le B[a]P à faible dose,

du moins quand la stochiométrie entre le composé et son anticorps est respectée. L’utilisation d’un modèle

à deux compartiments de cellules intestinales polarisées (Caco2) a permis de démontrer pour la première

fois que les anticorps présents au niveau du sérum et de l’intestin pourraient réduire l’absorption et

le transfert du composé carcinogène au travers de l’épithelium intestinal, évitant ainsi une forte

concentration locale en B[a]P susceptible de surcharger les mécanismes de réparation de l’ADN.

Il a été montré que des anticorps systémiques seraient capables de changer la cinétique de distribution

du Benzo[a]pyrène et de ses métabolites dans deux lignées cellulaires HepG2 et PBL humaine. Ainsi,

dans ces cellules, la redistribution induite par les anticorps systémiques réduirait l’immunotoxicité habituelle

du B[a]P et éviterait d’atteindre les niveaux seuils en xénobiotique nécessaires au déclenchement de

l’induction des cytochromes P 450. De plus, les résultats suggèrent que les anticorps pourraient interrompre

la voie d’activation métabolique du B[a]P.

La redistribution induite par les anticorps pourrait donc résulter en une concentration plus faible de

métabolites réactifs susceptibles de former des adduits à la surface des muqueuses ou des cellules

sensibles.

62

Biosan


»

EXTENSION PROVIE

(du programme BIOSAN)

Maladies liées aux processus de vieillissement

Durée: 2004 – 2008

Budget: 2.500.000 €

1 er appel en 2003: 4 projets sélectionnés (2.170.000 €)

dont 3 en cours

Le 10 avril 2003, le Fonds National de la Recherche a lancé un appel à propositions de projets au sein

d’une extension du programme «Biotechnologie et Santé» concernant les 'Maladies liées aux Processus

de vieillissement (PROVIE)'. Lors du 1 er appel, quatre propositions ont été acceptées sous réserve

de modifications et sous réserve d’un avis favorable du Comité national d’éthique de recherche. Trois

projets ont déjà démarré en 2004 et le quatrième sera lancé en 2005.

L’extension PROVIE vise à recenser les aspects médico-épidémiologiques, psychosociaux et biologiques

des maladies neuro-dégénératives liées aux processus de vieillissement au Luxembourg et de les situer

dans un cadre plus large à l'échelle européenne. La pathophysiologie est abordée de façon horizontale,

intégrant des approches de recherche fondamentale et clinique. La priorité sera donnée aux projets

pluridisciplinaires et interactifs entre des acteurs de différentes formations.

OBJECTIFS:

» L'augmentation des compétences de la communauté biomédicale au Luxembourg et du transfert

des connaissances dans le domaine des maladies liées au vieillissement cérébral;

» L'amélioration de la prévention des accidents vasculaires cérébraux;

» L'acquisition de techniques de dépistage novatrices en ce qui concerne les maladies neuro-dégénératives,

la dépression, les troubles du sommeil ainsi que la douleur chronique chez les personnes âgées;

» De nouvelles stratégies de traitement spécifiques pour ces mêmes pathologies;

» L'amélioration de la prise en charge des patients et de leurs familles;

» Le développement de nouvelles thérapies.

A travers ces objectifs, il s'agit de se placer à un niveau de compétence médical et scientifique reconnu

au niveau international ainsi que d'établir des convergences avec d'autres projets nationaux et internationaux.

Provie

63


Projets du programme PROVIE:

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR/03/04/02 Évaluation prospective M. Perquin CRP Santé 2005 12+24 mois 350.000 €

des caractéristiques neuro-

(1 ère phase)

psychologiques, biologiques et 900.000 €

sub-cliniques du stade MCI

(2 e phase)

(altérations cognitives modérées)

FNR/03/04/04 Interactions entre P. Heuschling Université du 01.11.04 12+24 mois 188.000 € 188.000 €

Microglia et beta-amyloid Luxembourg (1 ère phase)

342.000 €

(2 e phase)

FNR/03/04/06 Non-répondeur à l’aspirine dans R. Metz Centre Hospitalier 01.12.04 12+(24) mois 75.000 € 75.000 €

la population âgée à haut risque CRP Santé (pour une

vasculaire du Luxembourg

pré étude)

FNR/03/04/07 Neuropsychologie cognitive C. Pull Centre Hospitalier 01.10.04 36 mois 315.000 € 315.000 €

du vieillissement

CRP Santé

dans la schizophrénie

Subtotal Montant disponible PROVIE, 2.170.000 € 928.000 €

selon Convention

avec l’Etat: 2.500.000 €

64

Provie


FNR

03/04/02

Évaluation prospective des caractéristiques neuropsychologiques,

biologiques et sub-cliniques du stade MCI

(altérations cognitives modérées)

Centre de Recherche Public Santé

Personne(s) de contact: Magali Perquin, CRP Santé

Adresse e-mail: magali.perquin@crp-sante.healthnet.lu

Durée: 12 mois

Contribution FNR: 350.000 €

Prolongation éventuelle: 24 mois, contribution maximale FNR de 900.000 €

L’objectif principal du projet PROVIE-MCI consiste à mener une étude de faisabilité pour l’évaluation

prospective des conditions médicales et génétiques associées à l’apparition et l’évolution des troubles

cognitifs modérés (Mild Cognitive Impairment, MCI) vers la maladie d’Alzheimer. Cette étude sera

conduite sur une cohorte de personnes de plus de 65 ans.

Les conditions médicales explorées sont:

» l'existence de dysfonctionnements sub-cliniques des fonctions cardiaques et respiratoires,

» la présence d'un désordre métabolique,

» la prise au long cours de médicaments pouvant avoir un impact (positif ou négatif) sur la cognition, et

» la qualité de vie.

Les facteurs biologiques examinés incluent l'étude:

» de polymorphismes génétiques,

» des profils de protéines sanguines, et

» de composants lipidiques sanguins sélectionnés.

L'approfondissement des connaissances du stade préclinique de la maladie d’Alzheimer est une réelle

nécessité et représente un véritable challenge en matière de santé publique, portant l'espoir de concevoir

et mener des approches thérapeutiques préventives à même de retarder, voire d'empêcher, l’apparition

d'altérations cognitives graves chez les personnes âgées. Le projet commencera en 2005.

Provie

65


03/04/04

FNR

Microglial activation and differentiation:

Balance between proinflammatory secretions and beta-amyloid clearance

Université du Luxembourg

Personne(s) de contact: Paul Heuschling, FSTC

Adresse e-mail: paul.heuschling@uni.lu

Partenaire(s): CRP Santé, Laboratoire National de la Santé, CRP Gabriel Lippmann

Durée: 1 er novembre 2004 – 31 octobre 2005 (1 ère phase)

Prolongation éventuelle: 24 mois

Contribution FNR: 531.208 € / Contribution max: 342.000 € (2 ème phase)

L’hypothèse de la cascade de l’amyloïde-beta (Aß) est celle qui est actuellement la plus largement reconnue

comme expliquant la pathogenèse de la maladie d’Alzheimer (MA). La mise au point d’une stratégie

thérapeutique contre cette maladie passera par l’acquisition de plus amples connaissances sur les

mécanismes conduisant vers une clairance efficace de l’Aß par la microglie ainsi que par le développement

des outils nécessaires pour minimiser la réaction inflammatoire concomitante. Le projet propose le

développement d’un modèle in vitro de l’interaction de la microglie avec l’Aß, basé sur l’expression de

certains gènes par les microgliocytes in vivo. Ce modèle in vitro permettra d’étudier la différenciation

de la microglie au niveau de la transcription. Les données obtenues par cette approche de type transcriptome

seront confrontées aux résultats d’une approche protéomique comprenant des analyses sur

gel d’électrophorèse 2D et des études MALDI-TOF, résultats mettant en évidence les modifications

post-traductionnelles. Le projet porte un intérêt particulier sur l’implication des récepteurs et sur la

communication intracellulaire durant l’interaction entre la microglie et le Aß fibrillaire.

Le modèle in vitro servira à étudier les outils moléculaires capables de moduler le processus de différenciation/activation

des cellules de même que le ratio entre réaction inflammatoire et clairance de

l’Aß. Le rôle joué par la famille de récepteurs Notch sera examiné. Le projet prévoit la synthèse de

courts peptides capables d’interférer avec ces récepteurs. Dans ce contexte, il s’agira d’analyser les effets

d’une série de molécules protégées par un brevet qui est une co-propriété entre l’Université du Luxembourg,

le Centre National de Recherche Scientifique et l’Université Louis Pasteur de Strasbourg. Il a déjà été

montré que ces molécules agissent sur l’activation microgliale. Le but du projet sera de pouvoir définir

des stratégies thérapeutiques visant à moduler la cascade de l’Aß de même que d’indiquer certaines

protéines pouvant servir comme marqueur potentiel pour la maladie.

66

Provie


FNR

03/04/06

Non-répondeur à l’aspirine dans la population âgée

à haut risque vasculaire du Luxembourg

Centre de Recherche Public Santé

Personne(s) de contact: René Metz, Service de neurologie, Centre Hospitalier de Luxembourg

Adresse e-mail: metz.rene@chl.lu

Partenaire(s): Guy Berchem, CRP Santé

Durée: 1 er décembre 2004 - 31 novembre 2005

Contribution FNR: 75.000 €

Prolongation éventuelle: 24 mois

Le but de l’étude est d’analyser la fonction plaquettaire et la résistance à l’aspirine dans une population

âgée à haut risque vasculaire issue des consultations de neurologie et de cardiologie. Cette étude est

une pré-étude en vue de préparer l’étude principale plus large.

Deux approches sont utilisées pour définir la résistance à l’aspirine: la première est le «Platelet function

analyser (PFA-100)» et la deuxième consiste en la mesure du 11-dehydrothromboxane B2, un métabolite

stable de la thromboxane A2. Cent patients seront testés sous aspirine 100mg, aspirine 300mg, clopidogrel

et clopidogrel plus aspirine 100mg.

En utilisant ces données, la prévalence de la résistance à l’aspirine sera définie dans cette population et

il sera essayé d’élaborer un arbre décisionnel pour optimiser le traitement anti-plaquettaire individuel

en prenant en considération l’influence du vieillissement sur la fonction plaquettaire.

Provie

67


03/04/07

FNR

Neuropsychologie Cognitive du Vieillissement dans la Schizophrénie

Centre de Recherche Public Santé

Personne(s) de contact: Anne-Marie Schuller, Neuropsychologue, Charles Pull,

Centre Hospitalier Luxembourg

Adresse e-mail: Anne-marie.Schuller@crp-sante.healthnet.lu; Pull.Charles@chl.lu

Partenaire(s): Centre Hospitalier de Luxembourg

Durée: 1 er octobre 2004 – 1 er octobre 2007

Contribution FNR: 315.000 €

68

Provie

La schizophrénie est la plus courante des maladies mentales sévères, touchant environ 1% de la population,

et des conséquences sont lourdes pour les individus et leurs familles. Malgré le vieillissement actuel de

la population générale, l’exploration du vieillissement dans la schizophrénie est un champ de recherche très

peu développé. Ainsi, bien que différents travaux aient permis de spécifier les troubles cognitifs dans la

schizophrénie, la question de leur évolution avec l’âge reste à analyser. Quelques études préliminaires laissent

penser que certains patients schizophrènes développent un affaiblissement cognitif très marqué lors

du vieillissement. Dans ce contexte, une question essentielle concerne l’existence d’une démence associée

chez les patients schizophrènes âgés: Peut-on, chez ces patients, distinguer un vieillissement normal d’un

vieillissement pathologique? Si tel est le cas, quelles sont les caractéristiques cognitives de ce vieillissement

pathologique?

Par ailleurs, la prise en charge de ces patients schizophrènes représente un enjeu médical et économique

considérable. Une prise en charge dans des structures médico-sociales adaptées pourrait retarder le moment

de l’institutionnalisation, en permettant aux patients de mener le plus longtemps possible une existence

autonome. A cet égard, l’évaluation des fonctions cognitives constitue un atout majeur permettant de mieux

prédire les capacités des patients dans leur vie quotidienne. Il faut donc déterminer l’impact des troubles

cognitifs sur la vie quotidienne des patients schizophrènes, l’objectif étant à terme de disposer d’indicateurs

cognitifs permettant d’orienter ces patients vers tel ou tel type de prise en charge et de suivi.

Par différentes méthodes d’imagerie cérébrale (IRM, SPECT), les caractéristiques neurobiologiques du

vieillissement dans la schizophrénie vont aussi être explorées. A l‘aide de ces méthodes, les corrélats

anatomo-fonctionnels des dysfonctionnements cognitifs observés dans le vieillissement normal et pathologique

chez les patients schizophrènes seront précisés.


»

PROGRAMME VIVRE

Vivre demain au Luxembourg

Durée: 2002 – 2009

Budget total: 12.000.000 €

1 er appel en 2002: 14 projets sélectionnés (4.814.882 €)

2 e appel prévu: Fin 2005

Prévu en 2005, 2006 et 2007: Participation du programme VIVRE au ESF – EUROCORES

(European Collaborative Research Projects in the Social Sciences)

Le présent programme définit en sciences sociales, économiques et humaines des axes prioritaires de

recherche afin de mieux appréhender les défis auxquels notre pays et notre société auront à faire face:

Axe 1: L’évolution de la population au Luxembourg, sous des aspects démographiques, sociaux,

culturels et historiques;

Axe 2: Le développement du capital humain, le système de l’éducation et de la formation;

Axe 3: L’ère de l’information et de la communication et ses conséquences pour la société;

Axe 4: La place d’un pays de petite dimension dans la Grande Région, dans l’Union européenne et

dans un monde globalisé, notamment les perspectives pour sa place financière;

Axe 5: L’organisation de l’espace et l’aménagement du territoire;

Axe 6: Les mesures d’accompagnement (organisation de conférences et mesures pour améliorer l’accès

aux informations et aux données).

Le programme «VIVRE» tentera d’analyser les particularités luxembourgeoises de ces différentes

thématiques et, en complément d’une analyse des réalités passées et actuelles qui est bien évidemment

nécessaire, mettra aussi l’accent sur la recherche d’options et de stratégies pour le futur.

Les 27 et 28 septembre 2004 a eu lieu la première réunion du comité de pilotage VIVRE à laquelle ont

participé sept experts indépendants de différentes disciplines des sciences humaines et sciences sociales

pour aider le Fonds à formuler des recommandations au niveau des projets en cours et au niveau des

activités prévues, notamment en vue du nouvel appel général à propositions prévu pour fin 2005.

La plupart des projets VIVRE avaient commencé leurs travaux en 2003 ou 2004 et il a été considéré

comme prématuré d’évaluer les résultats. Cependant, comme les projets d’étude et de production de

données sont plus nombreux que de véritables recherches fondamentales sur la société luxembourgeoise,

les experts ont proposé de donner une priorité aux projets d’analyses plus fondamentales lors du prochain

appel. Dans le domaine des sciences sociales, l’absence d’une université au Luxembourg a pendant

Vivre

69


longtemps freiné le développement de compétences. Le comité de pilotage a donc souligné le rôle du

programme VIVRE pour promouvoir les sciences humaines et sociales et développer les recherches sur

certaines thématiques-clés de la société luxembourgeoise. Lors du deuxième appel, le comité a proposé

d’ajouter des critères spécifiques qui visent la création de nouvelles compétences au Luxembourg,

aussi bien à travers l’engagement de jeunes chercheurs que de chercheurs déjà avancés.

Projets du programme VIVRE:

Code Projet Titre Personne Organisme Date de Durées Budget

de contact coordonnateur démarrage prévu

FNR/02/05/01 European Social U. Warner CEPS/INSTEAD 01.01.2003 27 mois 440.000 €

Survey (ESS): Enquête

au Luxembourg

FNR/02/05/04 Histoire, mémoire M. Margue Université du 01.03.2003 58 mois 316.472 €

et identités

Luxembourg

FNR/02/05/06 Compétences linguistiques F. Fehlen Université du 01.11.2003 18 mois 100.000 €

des enfants jusqu’à 9 ans

Luxembourg

FNR/02/05/07 Etude de la dimension C. Houssemand Université 01.01.2004 36 mois 310.000 €

psychosociale sur

du Luxembourg

l’insertion professionnelle

FNR/02/05/09 La place de l’école R. Martin Université 01.01.2004 36 mois 500.000 €

dans la société

du Luxembourg

luxembourgeoise

de demain

FNR/02/05/12 Le plurilinguisme D. Portante Université 01.05.2003 36 mois 260.000 €

auprès des enfants

du Luxembourg

jusqu’à 9 ans

FNR/02/05/14 Application de l’art L. Schiltz CRP Santé 01.09.2004 12+36 mois 210.000 €

thérapie à quelques

problèmes cruciaux

de la société

luxembourgeoise

FNR/02/05/19 Vivre dans la F. Fehlen Université 01.04.2003 18 mois 120.000 €

Grande Région

du Luxembourg

FNR/02/05/20 L’avenir de A. Prüm CRP 01.12.2003 37 mois 998.486 €

la place financière

Gabriel Lippmann

du Luxembourg

FNR/02/05/22 Analyse et modélisation G. Colling Musée national 01.09.2003 36 mois 250.000 €

des zones noyaux

d’histoire naturelle

pour la biodiversité

FNR/02/05/24 Espace et F. Le Brun Musée national 01.04.2003 60 mois 390.000 €

patrimoine culturel

d’histoire et d’art

FNR/02/05/25 CLIMAT Changements L.Pfister CRP 01.10.2003 33 mois 449.924 €

climatiques et d’occupation

Gabriel Lippmann

du sol: défis pour

l’aménagement du territoire

dans les zones inondables

FNR/02/05/26 Socio-economic P. Hausman CEPS/INSTEAD 01.03.2003 30 mois 250.000 €

database online (SEDO)

FNR/02/05/27 Analyse de l’expression G. Goetzinger Centre National 01.10.2003 24 mois 220.000 €

littéraire de la société

de Littérature,

luxembourgeoise par la

Université du

production d’une base de

Luxembourg

données bio-bibliographiques

des auteurs luxembourgeois

Total: Montant disponible VIVRE 4.814.882 €

selon Convention avec l’Etat

12.000.000 €

70

Vivre


FNR

02/05/01

European Social Survey

CEPS / INSTEAD

Personne(s) de contact: Monique Borsenberger, CEPS/INSTEAD

Adresse e-mail: monique.borsenberger@ceps.lu

Site Internet du projet: www.ceps.lu/ess/presentation.cfm; www.europeansocialsurvey.org

Durée: 1 er janvier 2003 - 30 septembre 2005

Contribution FNR: 440.000 €

L´enquête European Social Survey (ESS) a pour objectif l´analyse comparative des attitudes et des

comportements sociopolitiques dans plus de vingt pays européens participant a l´enquête. La

participation luxembourgeoise est assurée par le CEPS/INSTEAD avec le soutien financier du programme

VIVRE pour les années 2003 et 2004. L´enquête ESS est réalisée tous les deux ans et comporte

un questionnaire de deux modules. Le premier, répété tous les deux ans, est constitué d´une douzaine

de thèmes. Le second est composé de modules thématiques modifiés a chaque enquête. Les données

et informations des pays participants sont disponibles librement aux chercheurs européens à travers le

site du ESS www.europeansocialsurvey.org.

En 2004, deux objectifs ont été poursuivis dans le cadre du projet «European Social Survey»: d’une

part, valoriser les résultats de la première enquête de 2003 en les mettant à disposition du public via

Internet et, d’autre part, préparer et réaliser la deuxième enquête au second semestre 2004. En 2004,

une page Internet ESS (http://www.ceps.lu/ess/) a été créée sur le site du CEPS/INTEAD qui présente

les résultats de l’enquête luxembourgeoise 2003. Elle a reçu un large écho dans la presse nationale

qui a publié pas moins d’une vingtaine d’articles à partir de ces résultats. Un certain nombre d’articles

ont également été publiés par le CEPS/INSTEAD et repris dans la presse (voir la rubrique «Revue de

presse» sur le site). A la même période ont débuté les premiers travaux pour réaliser l’enquête 2004

(2 e objectif), relatifs notamment au tirage de l’échantillon. La version finale des questionnaires de

l’enquête a été reçue du groupe central de coordination de l’ESS en juillet. Elle comporte cinq

questionnaires: un questionnaire principal, trois questionnaires supplémentaires et un questionnaire

destiné aux enquêteurs. Le corps du questionnaire principal est constitué de quatre parties récurrentes,

relatives aux médias, à la vie politique, au bien-être subjectif et au profil sociodémographique. Les

modules spécifiques à l’enquête 2004 concernent la santé et sa préservation; la moralité économique;

la famille, le travail et le bien-être.

Les questionnaires ont été traduits en quatre langues, soit en luxembourgeois, français, portugais

et allemand. Au cours du mois de septembre, 57 enquêteurs assermentés ont suivi une formation

spécifique pour l’enquête ESS, qui a démarré le 15 septembre 2004 pour se terminer vers le 20 janvier

2005. Durant cet intervalle, le programme d’encodage a été élaboré, ce qui a permis de démarrer

l’encodage dès la mi-décembre. Les résultats de l’enquête luxembourgeoise seront accessibles sur la

page Internet ESS (http://www.ceps.lu/ess/). Les informations et données des autres pays sont accessibles

à travers le site www.europeansocialsurvey.org .

En complément à la collecte de données, des rapports hebdomadaires permettent de documenter

le contexte général en matière d’événements nationaux et internationaux dans lequel s’est déroulé

l’enquête, événements qui ont pu influencer les réponses des personnes interrogées

(http://www.scp.nl/users/stoop/ess-eventsr2/events_overview_round2.htm). Un rapport contextuel

sur la période d’août 2003 à août 2004 est également disponible.

Vivre

71


02/05/04

FNR

Histoire, mémoire et identités.

Etude du rôle des lieux de mémoire

dans la constitution des identités collectives

Université du Luxembourg

Personne de contact: Michel Margue, Département d’Histoire, Université du Luxembourg

michel.margue@education.lu

Site internet du projet: www.cu.lu/ldm

Durée: 1 er janvier 2003 – 31 octobre 2007

Contribution FNR: 316.472 €

L’identité collective est aujourd’hui perçue par les scientifiques comme un processus qui se construit

en interaction à partir d’une dynamique relationnelle et plurielle. Elle est la résultante d’identifications

à des valeurs et à des normes portées par des vecteurs divers: la symbolique, le discours politique et

religieux, le récit historiographique, les rites, les actions commémoratives entre autres. Le présent

projet propose l’étude de ces vecteurs et des «lieux de mémoire» qu’ils produisent, ces points d’ancrage

d’ordre historique, matériels, factuels ou idéels, où la mémoire d’un groupe se fixe pour contribuer à

la construction des identités collectives.

Le projet de recherche progresse le long de quatre axes parallèles. D’une part, les études d’ordre

théorique, conceptuel, épistémologique et méthodologique: les notions d’«identité», de «mémoire»

et d’«histoire» ont été soumises à un questionnement approfondi. A cet effet, une approche interdisciplinaire

a prévalu, réunissant des anthropologues, sociologues, linguistes, psychanalystes,

neuropsychologues, et chercheurs en littérature et arts.

Par ailleurs, le modèle d’étude des «lieux de mémoire», développé en France dans les années ’80 et

repris dans d’autres pays et régions, a été analysé de manière comparative. Cette approche a permis de

détecter les points faibles et les lacunes de cette démarche de recherche, ses avancées aussi, et de

proposer une grille d’analyse évitant le discours essentialiste et dominant.

L’opposition des lieux entrés dans la mémoire et des lieux oubliés, refoulés ou disparus, ainsi que

l’attention portée aux lieux de mémoire des minorités, constitueront en ce sens l’originalité du projet.

L’étude même des lieux de mémoire, cas concrets analysés d’après le schéma histoire - symbolique -

vecteurs – initiative – réception, constitue évidemment le coeur du projet. A côté de nos propres

recherches, il a paru intéressant d’associer le grand public par un appel à contribution au niveau des

vecteurs, ainsi que des historiens experts ne faisant pas partie intégrante du projet.

Enfin, la visualisation des résultats de la recherche. Quatre voies ont été adoptées: les publications,

scientifiques et grand public; le site internet qui donnera accès à une banque de données; la réalisation

d’un film pour 2007 et la conception du Musée Fort Thüngen sur les identités luxembourgeoises.

Sur tous ces points, la confrontation des idées est nécessaire, tant sur le plan national par la collaboration

avec les instituts de recherche et culturels, que sur le plan international par la coopération

avec les universités (Nancy, Giessen, ULB/Bruxelles, Laval/Québec, York/Toronto) et lors des colloques

internationaux (European Science Foundation, cf. supra).

72

Vivre


1839 – 1939 : la construction du lieu de mémoire de l’indépendance retrouvée

FNR

02/05/12

Le plurilinguisme auprès des enfants jusqu'à 9 ans: Diversité linguistique,

apprentissage du luxembourgeois et entrée dans la littératie

Université du Luxembourg

Personne(s) de contact: Dominique Portante, Patrick Sunnen

Adresse e-mail: dominique.portante@uni.lu; patrick.sunnen@uni.lu

Site internet du projet: http://www.lcmi.lu

Durée: 1 er mai 2003 – 30 avril 2006

Contribution FNR: 260.000 €

Prolongation éventuelle: 1 er mai 2006 – 31 décembre 2006

Publications scientifiques «référées»:

Portante, D. (2004). Developing initial multilingual literacy in a complex setting: Some principles suggested

to build a cross-National Research Agenda. Reading Online, International Reading Association:

http://www.readingonline.org/international/edinburgh

L'objectif principal de la recherche est de comprendre de quelle façon les institutions d'accueil

préscolaires et scolaires tirent parti de la diversité du capital linguistique et culturel des enfants pour

développer leurs pratiques dans les trois langues du pays et pour favoriser l'émergence et le développement

d'une littératie plurilingue dans laquelle l'écrit allemand et français constitue un enjeu

fondamental pour le développement de la scolarité ultérieure. Pour cela, le projet se propose de brosser

un tableau général des emplois langagiers d’enfants de 3 à 9 ans sur le plan national et sur le plan

de contextes locaux choisis. L’accent est mis cependant sur la réalisation d’études de cas à partir

d’observations vidéo d’interactions dans des classes.

Vivre

73


Pendant la première moitié de l’année 2004, le travail s’est focalisé sur les observations vidéo dans des

classes d’éducation précoce, d’éducation préscolaire et de deuxième année d’études primaires dans

cinq écoles différentes avec un début d’exploitation en vue des études de cas. La deuxième moitié de

l’année 2004 a été consacrée à l’affinement du cadre d’interprétation des observations ainsi qu’à

l’élaboration d’un système de base de données destiné à recueillir les informations et à faciliter les

échanges entre les chercheurs du projet. Ce système pourra être utilisé pour des recherches ultérieures

et également dans la formation des enseignants. D’autre part, les derniers mois de l’année 2004 ont

été dédiés à la préparation de la poursuite des observations des enfants-cas qui se retrouvent dans

des classes subséquentes dans les écoles choisies.

Parallèlement aux travaux autour des observations, des entretiens ont été réalisés avec l’ensemble des

parents des classes concernées sur les emplois langagiers extrascolaires des enfants ainsi qu’avec les

enseignant(e)s sur leur perception du contexte et sur leurs pratiques pédagogiques. Un questionnaire

a été développé afin de recueillir des données sur les emplois langagiers des enfants par le moyen d’une

enquête nationale à réaliser en coopération avec le projet VIVRE FNR/02/05/06 (Compétences

linguistiques).

Les premiers constats suivants se dégagent à partir d’une première exploitation sommaire des observations

d’interactions dans les classes retenues et des entretiens avec les parents et les enseignants:

Le contexte langagier de tous les enfants est complexe. La diversité linguistique et culturelle est une

ressource pour l’apprentissage, mais cette ressource n’est pas perceptible d’emblée. Une organisation

des apprentissages pour tirer parti de la diversité est possible. L’observation vidéo et l’exploration du

contexte extrascolaire des enfants constituent, au-delà des objectifs de recherche proprement dits du

projet, des outils pour la réflexion des enseignants sur leurs pratiques.

Un enfant d'une classe de l'éducation préscolaire donne le dessin qu’il a signé au chercheur présent dans sa classe et dit:

«Dat bass du. Ech hunn däin Hiem gekuckt an deng Schong. An dunn hunn ech dech gemoolt.» L'activité du chercheur devient ainsi

le thème d'un événement littéraire («literacy event») initié par l'enfant.

74

Vivre


FNR

02/05/06

Compétences linguistiques

Université du Luxembourg

Personne(s) de contact: Fernand Fehlen, Unité de Recherche Interdisciplinaire sur le Luxembourg,

Université du Luxembourg

Adresse e-mail: fernand.fehlen@uni.lu

Durée: 30 avril 2004 – 31 décembre 2005

Contribution FNR: 100.000 €

Une étude sociolinguistique pour décrire la situation multilingue du Luxembourg et pour appréhender

les évolutions que celle-ci a connues depuis l’enquête BALEINE. Cette étude n’apportera pas

seulement la description du contexte de diversité linguistique dans laquelle l’école luxembourgeoise

est immergée, mais elle insistera aussi sur les stratégies d’apprentissage des langues et de la littératie

en se concentrant sur sur les jeunes enfants de moins de dix ans.

La structure du questionnaire de l’enquête:

Volet sociolinguistique:

» auto-évaluation des compétences langagières (comprendre, lire, écrire)

» langues utilisées dans le contexte familial

– avant l'âge de 4 ans

– à la maison entre 10 et 15 ans

– avec votre partenaire

– avec vos enfants

» langues utilisées (parler, écrire) dans certaines situations

– profession

– achats, restaurants

– administration

» médias

– quotidiens et / ou des journaux

– livres

– radio

– télévision

– ordinateur

– jeux vidéos sur ordinateur ou console de jeux

– vidéos ou DVD

» mode d’apprentissage des langues utilisées

– comment

– désir d’améliorer les connaissances

– motivations

– obstacles

» Le rôle du luxembourgeois comme facteur intégrateur de la société

» Les variations géographiques du luxembourgeois

Vivre

75


«Moien, schwätz du lëtzebuergesch?»

Apprentissage des langues par les enfants âgés entre 3 et 9 ans

Ensemble de questions adaptées à la situation de l’enfant (p. ex. sa langue maternelle)

– scolarisation (pour les enfants concernés: trajectoire migratoire)

– langues apprises, modes d’apprentissage

– évaluation de la compétence des enfants dans différentes langues par les parents

– utilisation des langues dans différentes situations (média)

Mémoire collective

Lieux de mémoire.

La méthode utilisée est celle d’une enquête par questionnaire auprès d’un échantillon de 1800

personnes avec surreprésentation des parents ayant des enfants de 3 à 9 ans.

L’échantillon est représentatif de la population résidente avec stratification a posteriori selon les

variables âge, sexe, nationalité, activité professionnelle.

Pendant l’année 2004 le questionnaire a été élaboré et l’enquête proprement dite a été réalisée par

l’ILReS. Le travail de terrain sera terminé le 9 janvier 2005 et l’analyse des réponses obtenues sera

réalisée en 2005.

76 Vivre


FNR

02/05/07

Etude de la dimension psychologique sur l’insertion professionnelle

et ses interactions avec les sphères sociales et économiques

Université du Luxembourg

Personne(s) de contact: Claude Houssemand, Faculté des Lettres, des Sciences Humaines,

des Arts et des Sciences de l’Education, Université du Luxembourg

Adresse e-mail: claude.houssemand@uni.lu

Site internet du projet: http://www.cu.lu/psychologie/houssemand/chomage/fnr.htm

Durée: 1 er janvier 2004 – 31 décembre 2006

Contribution FNR: 310.000 €

Le projet étudie la dimension psychologique du chômage et son impact sur la réinsertion professionnelle.

Les facettes sociale et économique sont également prises en considération. Une cohorte de

personnes s'inscrivant pour la première fois dans les services de l'ADEM sera suivie pendant deux ans.

Différentes caractéristiques psychologiques et socioprofessionnelles seront mesurées, puis analysées.

L'objectif est double: dégager les variables prédisant la durée du chômage et étudier l'impact de cette

durée sur l'état psychologique des chômeurs. Les résultats attendus sont un modèle explicatif de

l'employabilité des chômeurs et de profilage des personnes susceptibles de devenir chômeurs de longue

durée.

L’objectif des six premiers mois consistait à réaliser une revue de la littérature couvrant le problème

du chômage de longue durée dans les domaines économique, psychologique et sociologique pour

relever les variables les plus pertinentes. Cette revue a donné lieu à un premier document de travail

présentant une large synthèse bibliographique (Working paper n°1: «Discussion des variables pouvant

intervenir dans le chômage de longue durée au Luxembourg», disponible sur le site Internet du projet).

Le semestre suivant a été consacré à l’établissement d’un questionnaire et à la mise au point de la

méthodologie la plus adaptée pour son utilisation. Les questionnaires, tests et plans d'interviews qui

ont déjà été publiés dans la littérature ont été exploités et un deuxième Working paper reprenant

l'ensemble des items choisis a été finalisé.

Le questionnaire prendra la forme de «bilans de compétences» informatisés. Une collaboration avec le

CRP Henri Tudor est en cours pour la réalisation de l'informatisation du questionnaire destiné aux

chômeurs. Celle-ci se fera sur la plate-forme TAO (Testing Assisté par Ordinateur) élaborée dans le

cadre du projet R&D «Outils d’évaluation délivrés par Internet» par le CRP Henri Tudor et l’Université

du Luxembourg.

Des contacts réguliers ont eu lieu, aussi bien avec le Ministère du Travail et de l’Emploi qu'avec l'ADEM,

afin de formaliser l'accord de coopération. Une réunion de concertation avec le Ministre du Travail

et de l'Emploi, M. Biltgen, aura lieu en janvier 2005 afin de présenter le travail des chercheurs et de

préparer la prise de données dans les locaux de l'ADEM. Un pré-test avec un petit échantillon de

demandeurs d'emploi sera réalisé début de l'année 2005. Ensuite, l'outil sera traduit en allemand et

en luxembourgeois et mis en oeuvre à grande échelle.

Vivre

77


02/05/09

FNR

La place de l'école dans la société luxembourgeoise de demain

Université du Luxembourg

78

Vivre

Personne(s) de contact: Romain Martin, FLSHASE – groupe de recherche EMACS, Université du Luxembourg

Adresse e-mail: romain.martin@uni.lu

Durée: 1 er janvier 2004 – 31 décembre 2006

Contribution FNR: 500.000 €

Prolongation éventuelle: 1 er mars 2007

Les études PISA menées par l’OCDE en 2000 et en 2003, ainsi que d’autres études et indicateurs

relatifs à l’efficacité et à l’équité du système scolaire luxembourgeois amènent à la conclusion que le

Luxembourg ne semble pas très bien préparé à l’entrée dans une société de la connaissance et de

l’apprentissage dont le succès sera intimement lié à la qualité des ressources humaines dont elle

disposera. Dans ce contexte, le présent projet se propose d’élaborer des scénarios de développement

de l’école luxembourgeoise qui soient scientifiquement fondés et pour lesquels on dispose d’une base

empirique qui permette de prévoir les difficultés et les obstacles de leur réalisation. Les travaux

réalisés au courant de l’année 2004 ont notamment permis de dresser le cadre théorique du projet et

de procéder à des premières collectes de données.

Le cadre théorique a été élaboré en adoptant une perspective d’éducation comparée et en exploitant

la littérature scientifique dans une perspective multidisciplinaire. Il a également été essayé d’intégrer

le cadre conceptuel du programme «Schooling for Tomorrow» de l’OCDE qui propose une taxonomie

pour les scénarios de développement des systèmes éducatifs. En vue d’approfondir l’analyse du fonctionnement

actuel du système scolaire luxembourgeois, un certain nombre de banques de données

existantes ont été rassemblées et des plans d’analyse sont actuellement en cours d’élaboration.

Une pierre angulaire dans l’élaboration de scénarios adaptés à la situation spécifique du Luxembourg

sera la consultation des acteurs nationaux concernés par l’éducation qui sont considérés comme une

instance médiatrice importante entre le fonctionnement actuel du système scolaire d’un côté et la réalisation

de changements structurels majeurs de l’autre côté. Le projet prévoit ainsi de consulter les

principaux acteurs concernés par le sujet (élèves, parents, enseignants, directions d'école, intervenants

scolaires, syndicats, partis politiques, etc.). C’est dans ce contexte que le projet a profité de la période

préélectorale en vue de dresser un tableau d'ensemble des positions de la classe politique luxembourgeoise

sur les questions d’éducation et d’enseignement. Cette analyse s’est appuyée d’une part sur les

programmes électoraux des différents partis politiques et d’autre part sur des entretiens semi-directifs

qui ont été réalisés avec des représentants des partis. Ces entretiens ont été transcrits et se trouvent

en cours d’exploitation. Dans ce même volet de travail, une méthodologie de consultation par focusgroups

a été élaborée en collaboration avec des experts internationaux et sera mise en œuvre au cours

de l’année 2005 en vue de la consultation des autres acteurs nationaux concernés par l’éducation.


«Le projet cherche à proposer des scénarios de développement pour l’école luxembourgeoise en tenant compte du contexte

spécifique du Luxembourg, mais en tirant profit des expériences qui ont pu être réalisées dans d’autres pays en termes de réformes

structurelles des systèmes éducatifs.»

Vivre

79


02/05/14

FNR

Application de l'art thérapie à quelques problèmes cruciaux de la société

luxembourgeoise. Approche clinique et expérimentale.

Centre de Recherche Public Santé

Personne(s) de contact: Lony Schiltz, Département des Neurosciences,

Laboratoire de Psychologie Clinique et de la Santé, CRP Santé, Luxembourg

Adresse e-mail: Lony.schiltz@education.lu

Durée: 1 er septembre 2004 – 31 août 2005 (phase préparatoire)

1 er septembre 2005 – 31 août 2008 (phase principale)

Contribution FNR: 30.000 € (phase préparatoire)

180.000 € (phase principale)

Prolongation éventuelle: 3 ans (recherche-action et étude d’évaluation)

80

Vivre

Publications scientifiques «référées»:

» Schiltz L. (2004) Le blocage cognitif, émotionnel et motivationnel des élèves surdoués en situation

d'échec scolaire grave. Résultats d'études.cliniques et expérimentales sur la résignation apprise.

La Revue française de Psychiatrie et de Psychologie médicale .VII, 79, 39-44.

» Schiltz L. (2005) Dysfonctionnements cognitifs liés aux pathologies limites à l'adolescence. Etude comparée

de quelques tests projectifs. Neuropsychiatrie de l’Enfance et de l’Adolescence. (article accepté sous

presse)

» Schiltz L. (2004). Musicothérapie et quête de sens à l’âge adulte avancé. Approche clinique et expérimentale

comparée. In: Sudres J.L. Roux G. et al. (dir) La Personne Âgée en Art thérapie. De l’expression

au lien social. Paris: L’Harmattan. p. 221- 226.

» Schiltz L. (2004) Diagnostik und Therapie hochbegabter Schulversager. Reader Internationale Woche,

2004. Universität Bremen, Fachbereich 12, Erziehungs- und Bildungswissenschaften. p. 9-19.

Objectifs du projet:

1. Développement d'une méthodologie qualitative et quantitative intégrée (grilles d'analyse de

contenu des épreuves d'expression libre, étude des bases mathématiques des épreuves statistiques

non paramétriques disponibles pour les plans expérimentaux complexes (type factoriel)

2. Etude théorique des domaines concernés avec dégagement des variables structurales, cognitives

et comportementales susceptibles d'être incluses dans un plan prétest-posttest.

3. Domaines étudiés en vue de la recherche-action:

Domaine scolaire: élèves surdoués en situation d’échec scolaire grave

Domaine social: qualité de vie des personnes âgées

Domaine santé: réhabilitation des psychotiques chroniques, états névrotiques invalidants.

Etat des travaux:

Sur base de la littérature récente ainsi que sur base des projets de recherche antérieurs les dimensions

psychologiques fondamentales servant à la construction des hypothèses de travail dans le domaine des

élèves surdoués en situation d’échec scolaire grave et dans le domaine des personnes âgées valides ont

été dégagés en début de projet.

La même analyse sera réalisée dans le domaine des personnes âgées souffrant de démence ou affectées

d’un handicap, ainsi que pour les patients psychiatriques adultes. A partir de ces dimensions fondamentales,

les variables opérationnelles susceptibles d’entrer dans un plan prétest-posttest seront dégagées.

Un aperçu sur les bases mathématiques des procédures statistiques disponibles pour données de niveau

ordinal et nominal, ainsi que pour groupes restreints, a été présenté en septembre 2004. L’analyse des

modèles CFA a été entreprise. Elle sera suivie d’une application exploratoire de différents logiciels sur

un fichier contenant des données de niveau mixte, afin de contrôler différents types de modélisations

au contact des problèmes de terrain.

«Instruments d’origine ethnique

particulièrement indiqués pour

un travail au niveau des capacités

d’expression et de communication»


FNR

02/05/19

Vivre dans la Grande Région

Université du Luxembourg

Personne(s) de contact: Fernand Fehlen, Unité de Recherche Interdisciplinaire sur le Luxembourg,

Université du Luxembourg

Adresse e-mail: fernand.fehlen@uni.lu

Partenaire(s): Fondation Forum Europa (représentée par Claude Gengler, initiateur et co-porteur du projet).

Durée: 1 er avril 2003 – 1 er septembre 2005

Contribution FNR: 120.000 €

A un moment où les responsables politiques de la Grande Région sont à la recherche d'idées porteuses

nouvelles et où le Luxembourg tente de se (re)positionner sur l'échiquier que constitue l'Europe des

Régions, ce projet a pour objet de consulter les premiers concernés, c'est-à-dire les habitants:

» Que savent-ils des régions qui les entourent et, surtout, de leurs voisins?

» Quelles sont leurs habitudes en matière de franchissement des frontières?

» Quel est l’état de leurs connaissances / compétences linguistiques?

» Quelles sont leurs habitudes de consommation et leurs pratiques d’achat au sein de la Grande Région?

» Quelles relations ont-ils avec leurs voisins des régions frontalières?

» Que pensent-ils de la Grande Région et de la manière dont se fait la coopération transfrontalière?

» Comment voient-ils leurs chances personnelles de réussir dans cette Grande Région respectivement

le positionnement de la Grande Région au niveau européen?

Cette étude permettra de «prendre la température au niveau local», de déterminer la quantité et la qualité

des relations transfrontalières, de saisir les barrières, les préjugés et les clichés qui subsistent dans la

tête des gens et d'élaborer un ensemble de propositions et de mesures à l'attention des décideurs politiques

et économiques. Elle permettra aussi de (re)définir la place du Luxembourg dans cette Grande Région.

Au courant de l’année 2004, une enquête par questionnaire a été réalisée auprès de 2.500 habitants des

espaces frontaliers intérieurs de la Grande Région SaarLorLux/Rhénanie-Palatinat/Wallonie. Une première

analyse a été effectuée et le rapport de recherche rédigé en français est en voie de traduction vers l’allemand.

Une deuxième étude qualitative se fera en février-mars 2005. Il s’agira de confronter 20 à 30 experts

de la coopération transfrontalière et des «professionnels» de la Grande Région (acteurs politiques, fonctionnaires,

chefs d’entreprise, chercheurs, forces vives : patronat, syndicats, société civile) avec l’opinion

des habitants telle qu’elle se manifeste à travers l’étude de terrain.

Vivre

81


02/05/20 FNR

L’avenir de la Place Financière du Luxembourg

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: André Prüm, Professeur agrégé des Facultés de droit,

Laboratoire de Droit Economique, CRP Gabriel Lippmann

Adresse e-mail: prum@lippmann.lu

Site internet du projet: www.crpgl.lu/lde

Durée: 1 er décembre 2003 – 31 décembre 2006

Contribution FNR: 998.486 €

Publications scientifiques «référées»:

» Trust et Fiducie, éditions Montchrestien (sous presse), sous la direction d’André Prüm et de Claude Witz

» Le crédit et ses garanties, sous la dir. de Ph. Simler, éd. Jurisclasseur, Juriscompact, (chapitres sur les garanties

autonomes, l’escompte, le cautionnement d’un compte courant et les cartes bancaires ), 2004

» André Prüm, Une fiducie pour les banques? Revue de Droit bancaire et Financier, 2004, n° 1, p. 3

» André Prüm, Vers un espace européen des paiements. Revue de Droit bancaire et Financier, 2004, n° 3

» André Prüm, Poursuite des procédures d’interdiction des déficits publics excessifs enregistrés par l’Allemagne

et la France. Revue de Droit bancaire et Financier, 2004, n° 5

Le projet a pour objet une recherche multidisciplinaire sur les perspectives d'avenir de la place financière

de Luxembourg. Il consiste d'abord à examiner les atouts et les faiblesses de l'environnement juridique,

économique, financier dans lequel opère l'industrie financière luxembourgeoise, sans négliger les exigences

d'ordre éthique et politique, sur un plan aussi bien européen qu'international. Sur le fond de cette

étude, le projet se propose d'explorer les voies et moyens pour consolider et renforcer les attraits de

cet environnement dans le but d'assurer un essor durable à la place financière de Luxembourg en stimulant

sa compétitivité et sa capacité d'innovation.

Hormis un important colloque international organisé le 10 décembre 2003 sur le thème «Trust et Fiducie»,

le projet de recherche n’a véritablement commencé, conformément au planning prévu, qu’au cours de

l’année 2004.

Cette première année a servi d’abord à constituer l’équipe locale de recherche et de fédérer les équipes

de recherches étrangères associées au projet au sein d’un réseau performant. L’équipe locale réunit

aujourd’hui plusieurs juristes de haut niveau et doit accueillir dans les premières semaines de l’année

2005 également des économistes afin de compléter l’équipe. Un mode efficace de collaboration a été

trouvé avec le Centre de droit bancaire et financier de l’Université de Genève, le Centre de droit financier

de l’Université de Paris 1 - Panthéon Sorbonne, le Centre du droit de l'entreprise de l’Université Robert

Schuman Strasbourg 3, le Financial Law Institute de l’Université de Gand et l’Institut de Sciences politiques

de Strasbourg.

Le réseau constitué entre ces différents centres de recherches s’est attaché, en premier lieu, à dégager

une stratégie pour accomplir les recherches et à définir la méthodologie à suivre. Cette démarche a

conduit à une évaluation de certaines tensions auxquelles se prête le cadre réglementaire dans lequel

opère la place financière à travers une étude aussi complète que possible du contentieux porté devant

les juridictions luxembourgeoises. Elle doit aboutir au cours du projet à apprécier, aussi précisément

que possible, les contraintes tant internes qu’extérieures qui déterminent l’infrastructure économicojuridique

de la pace financière. Parmi les paramètres analysés figureront notamment la marge de manœuvre

que laisse une réglementation européenne de plus en plus contraignante, l’appréciation des sources

de revenus de la place financière en vue de mesurer la rentabilité des différents métiers et des créneaux

82

Vivre


à haute valeur ajoutée, l’impact des restructurations des groupes bancaires, financiers et d’assurance

sur les acteurs installés au Luxembourg et la stratégie qu’ils peuvent développer, une analyse coût /

bénéfice des évolutions prévisibles en matière de fiscalité de l’épargne et des nouvelles contraintes

inhérentes à la lutte contre le blanchiment et le terrorisme, l’évaluation des principaux foyers de contentieux.

Afin d’éviter une analyse abstraite de la situation, les travaux sont menés en étroite collaboration avec

les acteurs de la place et les autorités en charge de celle-ci. Un dialogue constructif qui doit se prolonger

tout au long du projet a été engagé à cette fin au cours de l’année 2004. Cette collaboration

doit permettre, par ailleurs, d’identifier les thèmes sur lesquels une recherche plus ciblée paraît utile.

Plusieurs sujets ont ainsi dès à présent été abordés – tels la dématérialisation des valeurs mobilières,

la certification de titres, le régime des sanctions internationales ... – qui appellent des travaux législatifs

qui ont été entamés à côté des recherches à portée plus générale.

L’année 2004 a servi, au surplus, à accomplir deux projets scientifiques: la préparation d’un ouvrage

sur le «Trust et la Fiducie» dans le prolongement du colloque tenu en 2003 ainsi que l’organisation

d’un nouveau colloque international sur «La titrisation». Le premier est actuellement sous presse et le

colloque fût un grand succès rassemblant plus de 200 spécialistes de différents pays.

FNR

02/05/22

Analyse et modélisation des espaces-clés pour la biodiversité

Musée National d’Histoire Naturelle

Personne(s) de contact: Guy Colling, MNHN

Adresse e-mail: gcolling@mnhn.lu

Durée: 1 er septembre 2003 – 28 février 2007

Contribution FNR: 250.000 €

Les objectifs du projet sont:

1. L’analyse des changements de paysage pendant les 30 dernières années au Luxembourg,

2. L’analyse de la fragmentation des paysages au Luxembourg et de la connectivité des habitats dans

la grande région,

3. La définition des hot spots de la biodiversité au Luxembourg,

4. La modélisation des impacts sur la biodiversité,

5. La création d’un outil de prise de décision dans les secteurs de l’aménagement du territoire et de

la conservation de la nature.

Travaux réalisés en 2004:

1. Les travaux de littérature ont permis de revoir la faisabilité des buts du projet et de préciser les futures

démarches et travaux.

2. Des images satellites Landsat des années 77, 88 et 2000 ont été acquises, géo-référencées et

classifiées pour pouvoir réaliser des analyses historiques des changements d’occupation du sol.

Des problèmes de distinction entre surfaces bâties et champs arables n’ont pas encore pu être

complètement résolus.

3. L’analyse de la fragmentation actuelle des paysages au Luxembourg a quasiment été terminée en

Vivre

83


2004. Les travaux comprenaient l’acquisition, l’actualisation et la préparation des données numériques,

le choix des méthodes SIG ainsi que la réalisation de cartes et leur interprétation. Les cartes

produites sont d’une complexité croissante prenant en considération de plus en plus de structures

à effet de fragmentation (voir exemples). Ces cartes montrent par exemple où se trouvent les

plus grandes parties du territoire national non fragmentées. Dans la suite seront encore pris en

considération la densité du trafique routier et aussi des aspects historiques.

4. Pour définir les espaces-clés de la biodiversité au Luxembourg, les données existantes de distribution

des espèces ont tout d’abord été analysées. Ces travaux menaient à la réalisation de cartes

thématiques montrant notamment la distribution par carré Gauss Luxembourg des nombres d’observations

d’espèces, des nombres de taxons observés, des nombres d’espèces par observation et

leurs changements historiques ainsi que des nombres d’espèces de différents groupes d’espèces

(amphibiens, orthoptères, chiroptères, plantes; voir exemple).

84

Vivre


FNR

02/05/24

Espace et Patrimoine Culturel

Musée National d'Histoire et d'Art

Personne(s) de contact: Foni Le Brun-Ricalens, Section Préhistoire, MNHA

Susanne Rick, Section Préhistoire, MNHA

Adresse e-mail: foni.le-brun@mnha.etat.lu; Susanne.Rick@mnha.etat.lu

Durée: 1 er avril 2003 – 30 mars 2008

Contribution FNR: 390.000 €

Le projet «Espace et Patrimoine Culturel» a pour objectif d’élaborer, de développer et de mettre en œuvre

un Système d’Information Géographique (SIG) pour la gestion, la sauvegarde et la promotion du Patrimoine

archéologique et culturel luxembourgeois.

Suite au cahier des charges élaboré en 2003, les travaux menés en 2004 ont permis de lancer la seconde

phase du projet avec le développement d'un prototype informatique de «modèle de données» (dataset)

adapté, d’une part, aux problématiques et questionnements spécifiques au Patrimoine national et,

d’autre part, aux particularités géo-administratives luxembourgeoises. Le modèle en développement

s’articule sur deux axes: l’élaboration d’une méta-base de données patrimoniales géo-référencées et

la réalisation d’un serveur de cartes.

La méta-base de données est actuellement en cours de validation avec la mise en place d’une structuration

relationnelle entre base de données / systèmes d’information et de navigation, en allant du général au

particulier (hiérarchisation des informations administratives et patrimoniales, thésaurus…). Cette structuration

consiste à mettre en relation des données issues de sources disparates, indépendantes les unes

des autres, au sein d’une même structure cohérente, sans impliquer l’importation massive desdites données.

Le «serveur de cartes» réalisé par l’équipe EPC permet un accès (interne) aux «cartes couches thématiques»

fournies par les administrations nationales partenaires ou élaborées par les services du MNHA au travers

d’un simple navigateur internet (web Browser). Le serveur de carte EPC (Map server - Carte interactive

du Patrimoine luxembourgeois) utilise des solutions logicielles opensource, afin de garantir tant l’interopérabilité

des systèmes qu’un accès et une utilisation libre de droits.

L'interopérabilité entre la méta-base de données et le serveur de cartes permettra à l'utilisateur de visualiser

et d'interroger en 4 langues (L, F, D, GB) les données des lieux culturels nationaux incluant l’accès aux

divers documents (textes, plans, photos, etc.) avec un niveau de détail variable en fonction des droits

d'accès au système. Ces deux développements sont menés conjointement afin d’être progressivement

intégrés. Dans cette perspective, les bases de données géo-administratives et thématiques concernées

sont «liées» au fur et à mesure via la méta-base de données en construction. Cette démarche parallèle

a pour objectif d’interroger in fine les modules «cartes» et «bases de données» dans un même processus.

Les résultats déjà acquis vont prochainement permettre d'aborder la phase suivante du projet, à savoir

l’encodage et la saisie des données patrimoniales sur les zones pilotes présélectionnées.

Vivre

85


Exemples d’application du système d’information

géographique en cours de développement

02/05/25

FNR

Publications scientifiques «référées»:

» Drogue G., Hoffmann L., Iffly J.F. & Pfister L., 2005. - Recent warming in a small region with semi-oceanic

climate, 1949-1998: what is the ground truth? Theoretical and Applied Climatology, sous presse.

» Pfister L., Drogue G., El Idrissi A., Iffly J.-F., Poirier C. & Hoffmann L. 2004. - Spatial variability of trends in

the rainfall-runoff relationship: a mesoscale study in the Mosel basin. Climatic Change 66: 67-87.

Changements climatiques et d'occupation du sol au Grand-duché de

Luxembourg: défis pour l'aménagement du territoire dans les zones

inondables

Centre de Recherche Public Gabriel Lippmann

Personne(s) de contact: Laurent Pfister, CRP Gabriel Lippmann

Adresse e-mail: pfister@lippmann.lu

Partenaire(s): Université du Luxembourg

Durée: 1 er octobre 2003 – 30 juin 2006

Contribution FNR: 450.000 €

Le projet CLIMAT s’est attaché à développer une base de données géographiques et hydro-

86

Vivre

climatologiques permettant de documenter:

» L’évolution de l’occupation des sols au cours des 250 dernières années au Grand-duché de Luxembourg.

» La variabilité basse fréquence du climat luxembourgeois au cours des 200 dernières années.

» La variabilité haute fréquence du climat de la Grande Région au cours des 50 dernières années.

» L’évolution de l’aléa hydrologique depuis 150 ans.

Les archives climatiques quantitatives recueillies à Luxembourg-Ville depuis le début du XIX e siècle

nous indiquent que le climat luxembourgeois a subi plusieurs oscillations, tantôt douces et humides,

tantôt plus fraîches et plus sèches.


FNR

02/05/25

Mais le fait marquant réside dans l’accélération de l’élévation des températures au cours des 30 dernières

années et, au cours de la même période, dans un changement de régime pluviométrique hivernal se

traduisant par des hivers plus humides associés à une augmentation de la fréquence et de la persistance

du flux zonal perturbé d’ouest en hiver.

La comparaison des tendances pluviométriques avec les tendances hydrologiques observées sur les plus

forts débits de crue des principales rivières de la Grande Région, a permis de conforter l’hypothèse d’un

accroissement généralisé de la magnitude des débits maximums hivernaux depuis le milieu des années

1970.

Au niveau des zones inondables étudiées dans le bassin de la Sûre au Luxembourg, la modélisation

pluie débit n’a pas permis de mettre en évidence un changement prononcé de la fréquence d’occurrence des

hautes eaux maximales au cours des cinq dernières décennies par rapport à une période équivalente

située à la fin du XIXe siècle sur la Sûre.

Les scénarios climatiques intégrant les émissions de gaz à effet de serre du GIEC (Groupe d'Experts

Intergouvernemental sur l'Evolution du Climat) prévoient, d’ici la fin du XXI e siècle, un changement

radical du climat luxembourgeois: une convergence qualitative entre les différentes scénarisations annonce

en effet une océanisation de la période hivernale (plus douce et plus humide que l’actuelle) ainsi qu’une

dégradation xérothermique de la période estivale (fortes températures et précipitations très déficitaires

par rapport à l’actuelle).

Steinheim sur la Sûre: carte du risque hydrologique obtenue pour l’épisode de crue de janvier 2003

Vivre

87


02/05/26

FNR

Socio-Economic Databases Online (SEDO)

CEPS/INSTEAD

Personne(s) de contact: Uwe Warner, CEPS/INSTEAD

Adresse e-mail: uwe.warner@ceps.lu

Partenaire(s): Cellule CREDI, CRP Gabriel Lippmann,

Durée: 1 er mars 2003 – 1 er septembre 2005

Contribution FNR: 250.000 €

Publications scientifiques «référées»:

Article exposant le projet SEDO et décrivant le navigateur accepté par le comité éditorial du Codata-DATA

Science Journal; accessible par le site internet de l'organisation CODATA: www.codata.org.

Le thème du projet SEDO est la mise à disposition, via Internet, d'informations socio-économiques

longitudinales volumineuses. L'objectif premier est l'élaboration d'un site présentant les résultats collectés

par le CEPS/INSTEAD lors de l'enquête longitudinale annuelle PSELL 2, couvrant 7 années (de 1995

à 2001). Ce site permettra une navigation selon plusieurs niveaux d'expertise: le grand public accèdera

directement à des indicateurs rapides, précis et ergonomiques, tandis que les utilisateurs les plus avancés

disposeront de moyens d'interroger les banques de données longitudinales complexes et pourront appliquer

diverses fonctions d'analyse statistique.

Activités au CEPS/INSTEAD

L’année 2004 a commencé par la réalisation de 3 réunions avec des utilisateurs potentiels internes et

externes au CEPS/INSTEAD afin de leur soumettre une première version du prototype et de tenir

compte de leurs remarques pour la suite. Les enseignements dégagés à partir de ces réunions ont permis

d’apporter une série de modifications au prototype. Entre autres, le classement des variables au sein

du thésaurus a été revu, la base de données simplifiée du PSELL2 a encore été améliorée et la structure

du prototype a été modifiée.

Une fois ces modifications réalisées, le prototype a été testé au CEPS/INSTEAD pendant une période

de plusieurs mois. Cette période d’essai a suscité des remarques et des propositions. Suite à ces nouvelles

propositions, on a pu procéder à diverses modifications de la page Web SEDO.

88

Vivre


Activités au CRP Gabriel Lippmann

A la suite de la livraison au CEPS/INSTEAD en avril 2004 du prototype de navigateur de la banque de

donnés SEDO, la cellule CREDI du CRP Gabriel Lippmann a reporté l'essentiel de ses ressources

restantes à la troisième phase qui commencera début 2005. Cette réorganisation vise, d'une part, à

ménager une période de tests et d'intégration de contenu documentaire et, d'autre part, à renforcer

l'interaction entre les deux organismes durant la mise en production du navigateur SEDO. Pour le second

semestre 2004, les deux tâches de CREDI ont été les suivantes: premièrement, dans le cadre de la

coopération régulière avec le CEPS/INSTEAD, le suivi des travaux et la préparation de la présentation

au comité de pilotage du programme FNR VIVRE en septembre 2004; deuxièmement, la participation

à la conférence internationale CODATA 2004 à Berlin.

FNR

02/05/27

Analyse de l'expression littéraire de la société luxembourgeoise par la

production d'une base de données biobibliographiques des auteurs

luxembourgeois

Centre national de littérature

Personne(s) de contact: Germaine Goetzinger

Adresse e-mail: germaine.goetzinger@cnl.etat.lu

Site internet du projet: http://www.cnl.public.lu/

Partenaire(s): Université de Luxembourg

Durée: 1 er novembre 2003 – 31 octobre 2005

Contribution FNR: 220.000 €

Publications scientifiques «référées»:

» Gätje Hermann; Goetzinger, Germaine; Mannes, Gast; Scholdt, Günter (Hg.): Mit Lust gelebt. Roman

meines Lebens. Kommentierte, illustrierte und wesentlich erweiterte Neuausgabe. St. Ingbert, Röhrig

Universitäts Verlag, 2004.

» Goetzinger, Germaine: Die Referenz auf das Fremde. Ein ambivalentes Begründungsmoment im Entstehungsprozess

der luxemburgischen Nationalliteratur. In: Honnef-Becker, Irmgard, Kühn, Peter (Hg.)

Über Grenzen. Literaturen in Luxemburg. Esch, Phi, 2004, S. 15-26.

» Goetzinger, Germaine: Malpaartes – ein unbekannter Exilverlag aus Luxemburg. In: Bücher, Verlage,

Medien. (Exilforschung, ein internationales Jahrbuch Bd. 22). München, edition text + kritik, 2004,

S. 84-99.

» Mannes, Gast: Pol Michels: Choix de textes. 1917 – 1922. Textes présentés, annotés et commentés par

Gast Mannes. Mersch, Centre national de littérature, 2004.

» Marson, Pierre: Raymond Mehlen. Stationen eines Werdegangs. In: Les Cahiers luxembourgeois 51 (2004),

N° 1, p. 9-40.

» Marson, Pierre: Migration, Identität und Literatur in Jean Portantes Roman Mrs Haroy ou la mémoire de

la baleine. In: Honnef-Becker, Irmgard, Kühn, Peter (Hg.) Über Grenzen. Literaturen in Luxemburg. Esch,

Phi, 2004, S. 65-86.

Le projet entame l'analyse de l'expression littéraire de la société luxembourgeoise par le biais de la production

d'une base de données biobibliographiques des auteurs luxembourgeois. À cet effet est établi

un répertoire des auteurs à traiter et une grille permettant de recueillir de façon comparable et standardisée

les informations collectées au cours des recherches biographiques, archivistiques, bibliographiques

et iconographiques à mener. En plus, il s'agit de mettre au point une démarche d'analyse cumulative

éclairant différents aspects caractéristiques du patrimoine et de la vie littéraire nationale : le multilinguisme,

Vivre

89


les trajectoires typiques d'auteurs, l'initiation à la création littéraire dans une petite société en marge

des métropoles et des centres de production culturelle, la professionnalisation tardive de la création

littéraire au Luxembourg etc. La production d'une base de données biobibliographiques des auteurs

luxembourgeois constitue d'un côté un préalable à la production d'une histoire littéraire du Luxembourg,

d'un autre côté elle représente sous une optique prospective un ensemble de connaissances nécessaires

à l'accroissement de la réflexivité sociale indispensable dans une société devenant de plus en plus

diversifiée et multiculturelle.

Dans un premier temps a été créée une base de données et des formulaires de recherche. La collecte

des noms d’auteurs a été élaborée sur la base de recherches dans les ouvrages de référence, dans le

système ALEPH, dans la bibliothèque du CNL ainsi que dans la bibliographie courante de la littérature

luxembourgeoise. Le répertoire compte actuellement plus de 1350 références. Des critères uniformes

ont été définis pour décider de l’admission d’un auteur dans le dictionnaire. Après les recherches fondamentales

sur la forme et la structure de notre base de données et la phase de test, le travail de recherche

bibliographique, archivistique et iconographique pour les articles monographiques a pu être entamé

dès fin avril. Étant donné l’importance des pièces de théâtre dans la littérature luxembourgeoise en

général, et pour la première partie du 20e siècle en particulier, un relevé systématique des pièces de

théâtre s’est imposé et a donné lieu à la création d’une base de données spécifique (plus de 330 entrées

actuellement). Au cours des recherches, de nouveaux fonds d’archives ou compléments de fonds d’archives

existants, comprenant des manuscrits, documents personnels et photos ont pu être constitués ou complétés.

Nous citons les exemples des fonds Dicks [Edmond de la Fontaine] (carnets manuscrits, correspondance),

Batty Weber (manuscrit d’une pièce de théâtre inédite, correspondance), Nik. Welter, Jeanine Theis-Kauth

(œuvres complètes), Max et André Duchscher (nombreux manuscrits), C.M. Spoo (manuscrits, dont une

partition manuscrite inconnue jusque là) ou Jean-Paul Maes.

Photographie en noir et blanc représentant plusieurs personnes

dans un bateau au bord d'une rivière. Au milieu, avec chapeau et

barbe, Edmond de La Fontaine.

90

Vivre


»

PROGRAMME TRASU

Traitements de surfaces

Durée: 2003 - 2009

Budget total: 6.000.000 €

1 er appel en 2003: 1 projet

Afin de développer de nouveaux matériaux et d’améliorer les produits existants, la recherche dans le

domaine des traitements de surfaces est de plus en plus importante pour un nombre élevé d’industries

au Luxembourg. Les recherches concernent le développement de nouveaux types de traitements pour

améliorer les propriétés recherchées, telles que l’adhésion, l’usure, la dureté et pour mieux protéger

l’environnement. Le programme de recherche inclut également la caractérisation des surfaces avant et

après le traitement pour mieux comprendre les principaux mécanismes, p.ex. au niveau atomique et

moléculaire.

Comme le domaine des traitements de surfaces est très vaste et les méthodes utilisées très diverses,

un des critères spécifiques était d’intégrer les partenaires industriels luxembourgeois dès le début.

Le domaine des traitements de surfaces est en pleine expansion du fait de l’apparition de nouveaux

matériaux et de nouveaux procédés plus efficaces pouvant répondre à de nouvelles exigences, notamment

dans:

» la création de produits améliorés ou nouveaux;

» l’apparition de nouveaux procédés dits avancés;

» des qualités améliorées;

» la recherche de procédés moins polluants;

Suite au 1 er appel à propositions de projets du programme TRASU en 2003, deux projets ont été soumis

qui, par la suite, ont été évalués par des experts internationaux. De nombreuses entreprises luxembourgeoises

et des partenaires académiques nationaux et internationaux se sont joints au projet. Afin

de mieux développer les compétences, le Fonds a pris la décision de fusionner les deux projets. Suite

aux modifications demandées ce projet modifié commencera en 2005.

Trasu

91


03/06/03

FNR

Development of innovative surfaces by means of

optimized plasma techniques and technology transfer to industries

Centre de Recherche Public Gabriel Lippmann

Centre de Recherche Public Henri Tudor

Personne(s) de contact:

Henri-Noël Migeon, David Duday, Laboratoire d’Analyse des Matériaux (LAM), CRP Gabriel Lippmann

Jos Schaefers, David Ruch, Laboratoire des Technologies Industrielles (LTI), CRP Henri Tudor

Adresse e-mail: migeon@lippmann.lu, duday@lippmann.lu, jos.schaefers@tudor.lu, david.ruch@tudor.lu

Collaborations:

Ateliers Nic Georges, Luxembourg | Balzers, Luxembourg | Ceratizit, Luxembourg

Ceodeux-Puretec, Luxembourg | Circuit Foil, Luxembourg | Ewald Giebel, Luxembourg

Galvalange, Luxembourg | Goodyear Technical Center, Luxembourg | Novellis (Pechiney Eurofoil Lux)

TrefilArbed, Luxembourg | VITO, Flemish Institute of Technological Research, Mol, Belgique

Fraunhofer Institute for Surface engineering and Thin films, Braunschweig, Allemagne

Université du Luxembourg

Laboratoire de Science et Génie des Surfaces (LSGS-Ecole des Mines de Nancy), Nancy, France

Laboratoire de Physique des Milieux Ionisés (LPMIA - Université de Nancy), Nancy, France

Laboratoire de Chimie du Solide Minéral (LCSM – Université de Nancy), Nancy, France

Laboratoire de Génie des Procédés Plasma et Traitements de Surface (LGPPTS-ENSC), Paris, France

Laboratoire Interdisciplinaire de Spectroscopie d’Electrons (LISE – Université de Namur), Namur, Belgique

Unité de Physico-Chimie et de Physique des Matériaux (PCPM – Université de Louvain la Neuve), Louvain

la Neuve, Belgique

Université de Saarbrücken, Allemagne

Durée: 18 mois

Contribution FNR: 1.500.000 € pour le CRP Gabriel Lippmann et

750.000 € pour le CRP Henri Tudor

Prologation éventuelle: 24 mois

Contribution maximale: 2.500.000 € pour le CRP Gabriel Lippmann et 1.250.000 € pour le CRP Henri Tudor

Le projet est réalisé en deux parties, l’une sous la responsabilité du Laboratoire d’Analyse des Matériaux

(LAM) du CRP Gabriel Lippmann et l’autre sous la responsabilité du Laboratoire des Technologies

Industrielles (LTI) du CRP Henri Tudor.

Le LAM va développer, via ce projet, des programmes de recherche fondamentale sur les processus

physico-chimiques dans les plasmas, les interactions plasma-surface et les mécanismes de croissance

de couches minces. Ces recherches fondamentales fourniront la base de plusieurs workpackages dans

lesquels des traitements de surface innovants assistés par plasma sont appliqués à des problèmes

industriels luxembourgeois dans les domaines de la résistance à la corrosion et à l’usure, le nettoyage

de surface, la modification des interfaces dans les matériaux composites ou la promotion d’adhésion

chimique. Les techniques principales utilisées pour ce projet sont: les plasmas atmosphériques (DBD,

OAUGDP, torches micro-ondes), les dépôts physiques ou chimiques en phase vapeur assistés par plasma

(PECVD, PEPVD) et l’implantation par plasma (PIII).

Le LTI va se concentrer sur la mise en place d’un prototype semi-industriel, par voie plasma-atmosphérique,

une alternative technologique, économique et environnementale aux processus de passivation

des substrats métalliques. L’évolution technologique des matériaux en termes de performance

a induit un développement important d’élaboration des matériaux qui s’appuie notamment souvent

sur l’alliance des performances des différents constituants. L’industrie s’est notamment orientée vers

des traitements de surface pour obtenir les qualités requises de leurs matériaux en application.

92

Trasu

En collaboration avec VITO et le CRP Gabriel Lippmann, le LTI va développer un outil d’élaboration

de couches minces à l’échelle semi-industriel en adéquation avec les requêtes de ses partenaires industriels

(Galvalange, Ewald Giebel). Cette ligne prototype permettra de simuler l’homogénéité de dépôt sur des

dimensions importantes, sur des matériaux en mouvement avec des vitesses de défilement proches des cas

réels et sera une alternative technologique, économique et environnementale aux processus de passivation

des substrats métalliques, procédé qui s’effectue actuellement dans des bains chimiques contenant du

chrome hexavalent, substance toxique qui sera interdite à partir de 2007.


»

PROGRAMME SECAL

Sécurité alimentaire

Durée: 2003 - 2009

Budget total: 6.000.000 €

1 er appel en 2003: 6 projets sélectionnés (5.881.533 €)

L’objectif de ce programme est de développer au Luxembourg une compétence scientifique en sécurité

alimentaire au service de l’ensemble des acteurs qui interviennent dans l’analyse des risques, afin

d’étendre la base des connaissances scientifiques et de développer de nouvelles techniques de

surveillance et de prévention du risque. Les domaines de recherche suivants, qui vont ainsi de

l’évaluation des risques à l’étude des stratégies de prévention, ont été retenus comme prioritaires:

» Traçabilité des aliments (y compris les organismes génétiquement modifiés, OGM);

» Qualité chimique et microbiologique des aliments (y compris l’eau potable);

» Impact sur la santé humaine et protection du consommateur.

Une approche intégrée de la sécurité alimentaire «de la fourchette à la fourche» axée sur l'utilisateur

final requiert des investissements en recherche et en développement afin d’étendre la base des

connaissances scientifiques concernant la sécurité alimentaire et de contribuer ainsi à l’établissement

d’une base scientifique solide destinée à l’élaboration de politiques et de réglementations. Les actions

de recherche doivent ainsi porter sur des méthodes plus sûres de production et de distribution des

denrées alimentaires, sur de nouvelles méthodes d’évaluation en matière de contamination, de risques

chimiques et d’exposition à des produits chimiques, et sur le contrôle de l’alimentation.

Le programme a une orientation de recherche fondamentale et appliquée, utilisable directement au

niveau des organismes de contrôle, au niveau des utilisateurs ou au niveau industriel.

Lors du 1 er appel à propositions de projets du programme SECAL, six des neuf propositions ont été

acceptées pour financement. Deux projets ont démarré leurs activités de recherche fin 2004 et les

quatre autres commenceront en 2005.

Secal

93


Projets du programme SECAL:

Code Projet Titre Personne Organisme Date de Durées prévues Budget Dont phase 1

de contact coordonnateur démarrage phase 1+2 prévu (engagée)

FNR03/07/01 Système expert mobile N. Rösch CRP Henri Tudor 1 er octobre 21+27 mois 800.000 € 370.000 €

intégré à un réseau pour 2004

l’analyse systématique des

allergies alimentaires (MENSSANA)

FNR03/07/02 Le développement d’une P. Schosseler CRP Henri Tudor 1 er mai 2005 36 mois 1.200.000 € 1.200.000 €

stratégie d’analyse et

de gestion des risques pour

la contamination de l’eau

potable au Luxembourg –

une approche

interdisciplinaire (CHEMRISK)

FNR03/07/03 Développement de A. Steinmetz CRP Santé 1 er novembre 36 mois 1.199.980 € 1.199.980 €

technologies nouvelles 2004

pour le «tracing» de

constituants alimentaires

FNR03/07/05 Développement de nouveaux L. Hoffmann CRP en 36 mois 983.437 € 983.437 €

outils de diagnostic génoprotéo- Gabriel Lippmann 2005

miques pour l’évaluation

toxicologique de la présence

de disrupteurs endocriniens dans

l’alimentation (ENDIF)

FNR03/07/07 Acquisition des connaissances L. Hoffmann CRP en 36 mois 848.716 € 848.716 €

et du savoir-faire nécessaries Gabriel Lippmann 2005

à une évaluation efficace du

risque lié aux agents pathogènes

se développant dans les eaux

potables au Luxembourg (KAWA)

FNR03/07/08 Epidémiologie moléculaire J. Mossong Laboratoire en 36 mois 849.400 € 849.400 €

de zoonoses bactériennes National 2005

de la chaîne alimentaire

de Santé

au Luxembourg (EPIFOOD)

Total Montant disponible SECAL, 5.881.533 € 5.451.533 €

selon Convention avec l’Etat:

6.000.000 €

94

Secal


FNR

03/07/01

Système expert mobile intégré à un réseau pour l’analyse systématique

des allergies alimentaires (MENSSANA)

Centre de Recherche Public Henri Tudor

Personne de contact: Norbert Rösch, Département SANTEC, CRP Henri Tudor

Adresse e-mail: norbert.roesch@tudor.lu

Site internet du projet: www.santec.lu (Projects – Menssana)

Partenaire(s): Centre Hospitalier de Luxembourg

Durée: 1 er octobre 2004 – 31 décembre 2006

Contribution FNR: 370.000 €

Prolongation éventuelle: 27 mois, contribution maximale FNR de 430.000 €

Selon l’Organisation Mondiale de la Santé, les allergies alimentaires sont devenues un problème majeur

de Santé Publique. Actuellement le traitement recommandé est d’identifier et d’éviter les allergènes.

Ceci nécessite des informations complètes et cohérentes de la part des patients qui doivent être

récoltées à travers un journal afin de permettre d’identifier les allergènes individuels. Une des idées du

projet est de développer un PAA (Personal Allergy Assistant), basé sur l’informatique mobile moderne

et les technologies de bases de données, pour mettre en place une base de données scientifique aidant

à identifier les allergies alimentaires.

Les objectifs du projet sont:

» Développement d’une base de connaissances pour la recherche dans les domaines des allergies

alimentaires, des allergies croisées et des incompatibilités;

» Développement d’un PAA (Personal Allergy Assistant);

» Amélioration de la traçabilité des aliments consommés, de l’identification des allergènes et de la

protection de la personne allergique;

» Création d’un groupe de travail multidisciplinaire «Technologies de l’Information et Allergies»;

» Conduite d’une étude clinique contrôlée pour évaluer l’efficience et les impacts socio-économiques du PAA.

Les résultats attendus sont un système PAA, une base de connaissance opérationnelle, une meilleure

connaissance du traitement médical des allergies alimentaires, un centre de compétence multidisciplinaire

«Technologies de l’Information et Allergies» et le support pour l’EBM (Evidence Based

Medicine) dans le domaine des allergies alimentaires.

Secal

95


03/07/02

FNR

Le développement d’une stratégie d’analyse et de gestion des risques

pour la contamination de l’eau potable au Luxembourg –

une approche interdisciplinaire (CHEMRISK)

Centre de Recherche Public Henri Tudor

Personne(s) de contact: Paul Schosseler, Tom Gallé, Centre de Ressources des Technologies pour l’Environnement

(CRTE), CRP Henri Tudor

Adresse e-mail: paul.schosseler@tudor.lu, tom.galle@tudor.lu

Site internet du projet: www.crte.lu (Rubrique Eau)

Partenaire(s): Administration de la Gestion de l’Eau, Université du Luxembourg, Laboratoire National de Santé

Durée: 1 er mai 2005 – 31 avril 2008

Contribution FNR: 1.200.000 €

Le projet vise à développer l’analyse des risques pour les ressources en eau potable au Grand-Duché

du Luxembourg. Les résultats permettront d’orienter les choix d’une politique de gestion des

ressources hydriques dans une optique de développement durable. Le projet rassemble une équipe

interdisciplinaire qui utilisera ses compétences en hydrogéologie, systèmes d’information géographiques

(SIG), géostatistique, chimie analytique de l’environnement, modélisation et analyse de

risques environnementaux pour dresser un bilan des ressources actuelles et de leur vulnérabilité visà-vis

d’influences anthropiques, et pour faire un pronostic de l’état futur de ces ressources. Le projet

proposera des outils de gestion pour préserver les ressources en eau potable permettant aux acteurs

politiques de se baser sur une analyse cohérente pour prendre leurs choix en politique environnementale

de l’eau.

03/07/03

FNR

Développement de technologies nouvelles

pour le «tracing» de constituants alimentaires

Centre de Recherche Public Santé

Personne de contact: André Steinmetz, StraLux, Laboratoire d’Immunogénétique Allergologie et de Biologie

Moléculaire Végétale, CRP Santé

Adresse e-mail: andre.steinmetz@crp-sante.healthnet.lu

Partenaire(s): Laboratoire National de Santé

Durée: 1 er novembre 2004 – 31 octobre 2007

Contribution FNR: 1.199.980 €

Environ 30% des personnes des pays industrialisés sont touchées par des affections allergiques.

Ces allergies se développent souvent chez les individus atopiques suite au contact avec certaines

protéines animales, végétales, ou fongiques de notre entourage. Les symptômes les plus couramment

observés sont l’asthme, le rhume allergique, l’urticaire, ou encore le choc anaphylactique.

Les protéines capables d’induire des réponses de type allergique sont appelées allergènes. Elles font

généralement partie de familles de protéines pouvant comporter également des membres non

allergisants. Les allergènes les plus violents sont généralement résistants à la dégradation par la chaleur

et la digestion et se prêtent bien au «tracing» alimentaire.

96

Secal


FNR

La Directive 2003/89 du Parlement Européen et du Conseil prescrit un étiquetage spécifique pour les

aliments contenant des allergènes «cachés» à partir du 25 novembre 2005. Des méthodes d’analyse et

de détection de ces allergènes seront nécessaires afin de permettre les contrôles adéquats.

Le présent projet a pour objectif de développer des technologies améliorant la traçabilité des

constituants de produits alimentaires : une approche protéique, par des anticorps monoclonaux,

permettant de détecter directement certains allergènes, et une approche ADN pour identifier l’origine

des différents constituants. Les allergènes visés sont des parvalbumines animales, et des Lipid Transfer

Proteins (LTPs) végétales (voir Figure). L’identification des espèces animales/végétales se fera à base

de séquences nucléotidiques spécifiques présentes dans les génomes des différentes espèces

considérées. Ont été retenues dans le cadre de cette étude huit espèces animales (bovin, porc, mouton,

cheval, saumon, carpe, maquereau et morue) et huit espèces végétales (blé, maïs, orge, riz, soja,

arachide, noix et sésame). Parmi les cibles technologiques visées figurent l‘élaboration de puces à

protéines et à ADN ainsi que des kits de détection d’allergènes et d’organismes génétiquement

modifiés.

Le projet a débuté en novembre 2004 par une analyse bioinformatique actualisée des allergènes à

l’étude, ainsi que par une mise au point des techniques d’extraction et de séparation des protéines à

partir de plusieurs espèces végétales concernées. Plusieurs séquences codantes de LTPs végétales ont

également été isolées.

Structure tridimensionnelle de la parvalbumine de carpe (gauche, réf. 1) et de la LTP de maïs (droite, ré f. 2).

Modèles «worm» (haut) et «space filling» (milieu), avec hélices alpha en vert et «random coil» en bleu clair.

Les quatre ponts disulfures dans la LTP de maïs sont montrés en jaune brun.

Cates, M. S., Berry, M. B., Ho, E., Li, Q., Potter, J. D., Phillips Jr., G. N.: Metal Ion Affinity and Specificity

in EF-Hand Proteins: Coordination Geometry and Domain Plasticity in Parvalbumin Structure

(London) 7 pp. 1269 (1999)

Gomar, J., Petit, M. C., Sodano, P., Sy, D., Marion, D., Kader, J. C., Vovelle, F., Ptak, M.: Solution structure

and lipid binding of a nonspecific lipid transfer protein extracted from maize seeds. Protein Sci 5 pp.

565 (1996)

Secal

97


03/07/05

FNR

Développement de nouveaux outils de diagnostic génoprotéomiques

pour l’évaluation toxicologique de la présence

de disrupteurs endocriniens dans l’alimentation (ENDIF)

Centre de Recherche Public Gabriel Lippmann

03/07/07 FNR

Acquisition des connaissances et du savoir-faire nécessaires

à une évaluation efficace du risque lié aux agents pathogènes

se développant dans les eaux potables au Luxembourg (KAWA)

Centre de Recherche Public Gabriel Lippmann

98

Secal

Personne(s) de contact: Lucien Hoffmann, Cellule de Recherche en Environnement et Biotechnologies

(CREBS), CRP Gabriel Lippmann

Adresse e-mail: hoffmann@lippmann.lu

Partenaire(s): Laboratoire National de la Santé; CRP Santé

Durée: 36 mois

Contribution FNR: 983.437 €

Il y a de plus en plus d’études qui indiquent que les disrupteurs endocriniens (par exemple pesticides,

PCBs, dioxine, additifs utilisés par l’industrie du plastique, phyto-oestrogènes) qui sont présents dans

nos aliments ont un impact sur la santé humaine, par exemple sur l’apparition d’anormalités

reproductives, sur le développement de certains cancers, sur les rapports filles/garçons des nouveauxnés.

Les objectifs de ce projet sont: d’évaluer l’exposition de la population luxembourgeoise aux

disrupteurs endocriniens; d’utiliser les nouvelles techniques d’expression des gènes (bio-chips) et de

protéomique en vue de développer des biomarqueurs moléculaires pour évaluer l’exposition du

consommateur à des disrupteurs endocriniens présents dans la nourriture. Le projet commencera en

2005.

Personne(s) de contact: Henry-Michel Cauchie, Cellule de Recherche en Environnement et Biotechnologies,

CRP Gabriel Lippmann

Adresse e-mail: cauchie@lippmann.lu

Partenaire(s): Administration de la Gestion de l’Eau

Durée: 36 mois

Contribution FNR: 848.716 €

Ce projet a comme objectifs de développer des techniques et protocoles innovants nécessaires pour

évaluer le risque associé à la présence de pathogènes dans l’eau potable. Les pathogènes ciblés ont

été choisis sur base de leur impact sur la santé, leur persistance dans les systèmes d’approvisionnement

en eau, leur résistance au chlore et leur présence potentielle au Grand-Duché de Luxembourg. Les

pathogènes sélectionnés sont des protozoaires parasites (Giardia, Cryptosporidium), des virus et des

cyanobactéries toxiques. Le projet s’intéressera à la fois à l’eau brute (sources, réservoirs d’Esch-sur-

Sûre), ainsi qu’aux différentes parties des unités de production et aux conduites de distribution d’eau

potable, qui sont des milieux favorables au développement de quantités significatives de pathogènes.


L’objectif spécifique de la première partie du projet est de développer des protocoles peu coûteux et

efficients de détection des pathogènes cibles. Les efforts porteront sur l’automatisation de la collecte

(par ultracentrifugation) et de la détection (par microscopie épifluorescente) de pathogènes présents

à de faibles densités. Dans une deuxième phase, le travail de recherche se concentrera sur le

développement de méthodes d’évaluation de la viabilité, du pouvoir infectieux et de la toxicité des

pathogènes ciblés. Dans un troisième volet, le projet s’intéressera à la relation entre, d’un côté, la

présence et la viabilité, le pouvoir infectieux, respectivement la toxicité des pathogènes et, d’un autre

côté, les caractéristiques environnementales des milieux dans lesquels les pathogènes ont été trouvés.

Le projet commencera en 2005.

FNR

03/07/08

Epidémiologie moléculaire de zoonoses bactériennes

de la chaîne alimentaire au Luxembourg - EPIFOOD

Laboratoire National de Santé

Personne(s) de contact: François Schneider, Joël Mossong, Laboratoire National de Santé, CRP Santé

Adresse e-mail: francois.schneider@crp-sante.lu, joel.mossong@lns.etat.lu

Partenaire(s): CRP Santé

Durée: 36 mois

Contribution FNR: 849.400 €

Les zoonoses bactériennes transmissibles par la chaîne alimentaire (Salmonella, Campylobacter,

Escherichia coli entéropathogène, Listeria) peuvent causer des souffrances humaines ainsi que des

pertes économiques tant à la production qu’à l’industrie alimentaire. En développant des méthodes

moléculaires pour identifier et génotyper les souches bactériennes sur différents niveaux de la chaîne

alimentaire (aliments pour animaux, abattoir, matières fécales, denrées alimentaires, souches

cliniques), le projet a pour buts d’éclaircir leurs modes de transmission, d’identifier les sources

d’exposition et de prévenir de nouvelles épidémies liées à ces bactéries entéropathogènes. Le projet

commencera en 2005.

Secal

99


III. Les mesures d’accompagnement

100

Les mesures d’accompagnement


En complément au financement de la recherche proprement dite, le Fonds soutient également des

mesures d’accompagnement pour renforcer le cadre général de la recherche scientifique au Luxembourg.

En 2004, le Fonds National de la Recherche a lancé deux appels à propositions en ce qui concerne les

mesures d’accompagnement. Ces mesures ont pour but de financer en partie ou totalement des

activités pour la promotion de la culture scientifique, de la coopération scientifique internationale ainsi

que de la coordination nationale en matière de recherche. Il est à noter que les activités sélectionnées

en 2004 peuvent se dérouler au cours de l’année 2004 ou au cours des années suivantes. Les activités

sélectionnées durant les exercices précédents ne sont plus mentionnées dans ce rapport.

Les activités soutenues par le Fonds dans ce cadre sont les suivantes:

MA1: Diverses mesures de promotion de la culture scientifique, de la coopération scientifique internationale

ou de la coordination nationale en matière de recherche

La mesure MA1 est essentiellement destinée à éveiller l’intérêt scientifique chez les jeunes à

travers des expérimentations, mais aussi à intéresser un plus large public aux sciences en leur

montrant l’importance des recherches scientifiques. Cette mesure vise également à soutenir

des activités innovantes et originales promouvant la recherche ou renforçant la collaboration

entre différents acteurs du secteur R&D, que ce soit au niveau national ou, dans des cas précis,

international.

MA2:

MA3:

MA4:

MA4:

MA5:

Participation active de chercheurs débutants à des conférences scientifiques

Par la mesure MA2, le Fonds soutient les présentations scientifiques de jeunes chercheurs en

doctorat, jusqu’à quatre ans après la soutenance de leur thèse, à des conférences internationales

à travers le financement de leurs frais de voyage et frais d’inscription. Cette mesure est

destinée à inciter les chercheurs à présenter les résultats de leurs recherches à l’étranger et à

nouer ainsi des contacts scientifiques importants pour leur future carrière.

Organisation de conférences scientifiques au Luxembourg

La mesure MA3 est destinée à cofinancer des conférences scientifiques nationales ou internationales

organisées au Luxembourg par des associations ou des organismes de recherche

publics. Les conférences doivent être organisées par un comité scientifique. Dans cette même

catégorie, le Fonds cofinance aussi des conférences publiques par des intervenants du Luxembourg

ou de l’étranger pour présenter l’état de l’art dans un domaine scientifique précis à un

public spécialisé ou non.

a) Publication de thèses de doctorat

La mesure MA4 est subdivisée en deux parties. La première partie (MA4a) concerne le financement

ou le cofinancement de l’impression ou de la publication d’une thèse de doctorat.

Le montant maximal du subside du Fonds est de 3.000 €.

b) Publication d’ouvrages scientifiques

En parallèle au financement de thèses de doctorat, le Fonds cofinance sous la mesure MA4b

la publication d’ouvrages scientifiques jusqu’à un montant maximal de 3.000 €.

Préparation de projets de recherche européens

La mesure MA5 permet de rembourser des frais de préparation d’un projet de recherche européen

à des organismes publics luxembourgeois qui coordonnent ce type de projet.

Mesures d’accompagnement

101


MA1

FNR

MA6:

MA7:

Mobilité des chercheurs

La mesure MA6 vise à encourager des collaborations internationales à travers l’accueil de chercheurs

étrangers dans des institutions au Luxembourg, respectivement le séjour de chercheurs

luxembourgeois dans un organisme de recherche à l’étranger. Les demandes sont basées sur

un projet de recherche à réaliser en commun.

Promotion de brevets

La mesure MA7 est destinée à rembourser les frais d’inscription à une conférence ayant comme

thématiques la gestion de la propriété intellectuelle dans le secteur R&D ou les brevets. Cette

mesure s’applique uniquement dans le cadre de projets de R&D du secteur public.

Pour les mesures MA1, MA3 et MA6, les délais pour la réception de propositions sont fixés

annuellement au 1 er avril et au 1 er octobre. Pour les mesures MA2, MA4, MA5 et MA7, les délais sont

fixés en fonction de la date de démarrage de l’activité.

SF:

Festival des Sciences

Tous les deux ans (2003, 2005, ...) le Fonds soutient l’organisation du Festival des Sciences

organisé par le Musée national d’histoire naturelle (www.science-festival.lu).

Aperçu des activités en 2004

Code Titre Nombre de Nombre de Contributions totales

de la mesure propositions reçues propositions acceptées FNR en 2004

MA1 Diverses mesures de promotion R&D 16 13 152.460,00 €

MA2 Participation active à des conférences 41 39 39.115,81 €

MA3 Organisation de conférences 46 40 380.180,89 €

MA4 Publications scientifiques 26 25 53.576,66 €

MA5 Préparation de projets UE 1 1 10.000,00 €

MA6 Mobilité des chercheurs 20 16 115.219,38 €

MA7 Promotion de brevets 0 0 0,00 €

SF Festival des Sciences 0 0 0,00 €

Totaux 150 134 750.552,74 €

102

Mesures d’accompagnement


FNR

MA1

Propostions retenues en 2004

MA1: Diverses mesures de promotion R&D

FNR

04/MA1/01

FNR

04/MA1/08

TITRE DE L’ACTIVITÉ Kanner experimentéieren II

NOM ORGANISATEUR Jean-Paul Greisch

ORGANISME ORGANISATEUR Association Jeunes Scientifiques Luxembourg

DATE DE L’ACTIVITÉ Année scolaire 2004–2005

CONTRIBUTION FNR EN € 4.955,00

TITRE DE L’ACTIVITÉ

NOM ORGANISATEUR

ORGANISME ORGANISATEUR

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

Galileo Science Mobil 2005

Aline Fischer

Musée National d’Histoire Naturelle

Année 2005

25.000,00

FNR

04/MA1/03

FNR

04/MA1/09

TITRE DE L’ACTIVITÉ Flammenzauber und Feuerkunst

NOM ORGANISATEUR Jean-Paul Greisch

ORGANISME ORGANISATEUR Association Jeunes Scientifiques Luxembourg

DATE DE L’ACTIVITÉ 13–14 novembre 2004

CONTRIBUTION FNR EN € 3.000,00

TITRE DE L’ACTIVITÉ Mise en place d’une plate-forme nationale BIODIVERSITE

NOM ORGANISATEUR Fernand Reinig

ORGANISME ORGANISATEUR CRP Gabriel Lippmann

DATE DE L’ACTIVITÉ Années 2004–2005

CONTRIBUTION FNR EN € 15.000,00

FNR

04/MA1/04

FNR

04/MA1/10

TITRE DE L’ACTIVITÉ Catch a Star 3

NOM ORGANISATEUR Fernand Wagner

ORGANISME ORGANISATEUR European Association for Astronomy Education (EAAE)

DATE DE L’ACTIVITÉ Janvier 2005

CONTRIBUTION FNR EN € 1.800,00

TITRE DE L’ACTIVITÉ NIDAGROUP

NOM ORGANISATEUR Salim Belouettar

ORGANISME ORGANISATEUR CRP Henri Tudor

DATE DE L’ACTIVITÉ 1 er septembre 2004–31 août 2005

CONTRIBUTION FNR EN € 12.500,00

FNR

04/MA1/05

FNR

04/MA1/11

TITRE DE L’ACTIVITÉ e-Science Quizz

NOM ORGANISATEUR Fernand Reinig

ORGANISME ORGANISATEUR CRP Gabriel Lippmann

DATE DE L’ACTIVITÉ 1 er août 2004–31 mars 2005

CONTRIBUTION FNR EN € 25.000,00

TITRE DE L’ACTIVITÉ MADLAB made in Luxembourg

NOM ORGANISATEUR Robert Dondelinger

ORGANISME ORGANISATEUR Lycée Technique d’Ettelbruck

DATE DE L’ACTIVITÉ 30 juillet–9 août 2004 et 13–16 octobre 2004

CONTRIBUTION FNR EN € 9.704,83

FNR

04/MA1/06

FNR

04/MA1/12

TITRE DE L’ACTIVITÉ Science Club 2005

NOM ORGANISATEUR Patrick Delhalt

ORGANISME ORGANISATEUR Musée National d’Histoire Naturelle

DATE DE L’ACTIVITÉ Année 2005

CONTRIBUTION FNR EN € 25.000,00

TITRE DE L’ACTIVITÉ Développement et réalisation d’une plate-forme

«Recherche sur le vieillissement au Luxembourg»

NOM ORGANISATEUR Dieter Ferring

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 1 er novembre 2004–30 avril 2005

CONTRIBUTION FNR EN € 10.000,00

FNR

04/MA1/07

FNR

04/MA1/14

TITRE DE L’ACTIVITÉ Trophée de robotique au Luxembourg en 2005

NOM ORGANISATEUR Patrick Delhalt

ORGANISME ORGANISATEUR Musée National d’Histoire Naturelle

DATE DE L’ACTIVITÉ octobre 2004–9 avril 2005

CONTRIBUTION FNR EN € 15.000,00

TITRE DE L’ACTIVITÉ Promotion de la physique.

Remise d’un prix de physique aux meilleurs bacheliers

NOM ORGANISATEUR Jean-Paul Zanter

ORGANISME ORGANISATEUR Association Luxembourgeoise des Physiciens

DATE DE L’ACTIVITÉ septembre 2005

CONTRIBUTION FNR EN € 1.500,00

FNR

04/MA1/15

TITRE DE L’ACTIVITÉ L’Hettangien à Hettange: de la science au patrimoine

NOM ORGANISATEUR Georges Bechet

ORGANISME ORGANISATEUR Musée National d’Histoire Naturelle

DATE DE L’ACTIVITÉ 1 er –3 avril 2005

CONTRIBUTION FNR EN € 4.000,00

MA1

103


MA2

FNR

MA2: Participation active à une conférence scientifique

FNR

04/MA2/01

FNR

04/MA2/07

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Track on engineering e-learning systems» présenté à la conférence»

2004 ACM Symposium on Applied Computing (SAC)» à Chypre

Paraskevas Avgeriou

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

14–18 mars 2004

787,49

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«La valorisation du capital humain sous forme de compétences

linguistiques: une différenciation en fonction du sexe et/ou

en fonction du statut professionnel?» présenté aux «11 es Journées

d’études sur les données longitudinales dans l’analyse du marché

du travail» à Dijon

Carlo Klein

CEPS/INSTEAD

27–28 mai 2004

605,40

FNR

04/MA2/02

FNR

04/MA2/08

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«The changing election coverage of German television. A content

analysis 1190-2003», «Soccer in the media, public mood and how

the German ruling coalition won the last national elections», «The

political effects of sports coverage» présentés à la conférence

«The 2004 International Communication Association» à New Orleans

Reimar Zeh

Université Erlangen Nürnberg

27–31 mai 2004

1.050,23

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«ADS-directory services for mobile ad-hoc networks based on an

information market model» présenté au «International Workshop

on Ubiquitous Computing–IWUC 2004» à Porto

Christian Hutter

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

13–14 avril 2004

1.039,84

FNR

04/MA2/03

FNR

04/MA2/09

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Eel parasite diversity: a tool to monitor aquatic ecosystems?»

présenté au «Workshop and Training Course on Fish Parasites» au

Neusiedler See en Autriche

Frankie Thielen

Abteilung Ökologie – Parasitologie; Universität Karlsruhe

17–23 avril 2004

793,80

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Caractérisations sédimentologique, géochimique et paléontologique

des épisodes de libération massive d’hydrates de méthane

(clathrates) dans l’océan» présenté au «32nd International Geological

Congress 2004» à Florence

Michael Hermoso

Département de Géologie Sédimentaire; Université Pierre et Marie

Curie, Paris

20–28 août 2004

1.005,00

FNR

04/MA2/04

FNR

04/MA2/10

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Multi-agent organizational model for eContracting» présenté à

la «6th International Conference on Enterprise Information

Systems–ICEIS 2004» à Porto

Benjamin Gâteau

CRP Henri Tudor

14–17 avril 2004

1.078,39

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Identification of a population of CD 133 + precursor cells in the

stroma of the human cornea» présenté au «Association for Research

in Vision and Ophthalmology Annual Meeting–ARVO

2004» à Fort Lauderdale

Michelle Thill

Klinik und Poliklinik für Augenheilkunde; Universitätskliniken

Hamburg-Eppendorf

25–29 avril 2004

658,00

FNR

04/MA2/05

FNR

04/MA2/11

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Estimating badger abundance by genotyping remotely plucked

hair» présenté à la «The 50th Easter Conference and AGM of the

Mammal Society» à Leicester

Alain Frantz

Department of Biology and Environmental Science; University of Sussex

16–18 avril 2004

528,91

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Activity -stability relationships in extremophilic enzymes» présenté

à la conférence «Understanding Protein Stability» à Stockholm

Jean-Claude Marx

Laboratoire de Biochimie; Université de Liège

8–14 mai 2004

848,17

FNR

04/MA2/06

FNR

04/MA2/12

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«A very high resolution long-baseline water-tube tiltmeter to record

small signals in the frequency band ranging from earth free

oscillations up to secular tilts» présenté à la «1st General Assembly

of the Geosciences Union» à Nice

Nicolas d’Oreye de Lantremange

Centre Européen de Géodynamique et de Séismologie

25–30 avril 2004

987,43

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Developing single nucleotide polymorphisms (SNP) markers for

adaptive variation in Norway spruce» présenté à la conférence

«Biodiversity: state, stakes and future» à Louvain-la-Neuve

Myriam Heuertz

University of Uppsala

7–9 avril 2004

434,60

104

MA2


FNR

MA2

FNR

04/MA2/15

FNR

04/MA2/23

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Thiolated polymers: stomach-targeted oral delivery of low molecular

weight heparin» présenté au «31st Annual Meeting of the

Controlled Release Society» à Honolulu

Thierry Schmitz

Abteilung Pharmazeutische Technologie; Leopold-Franzens-Universität

Innsbruck

12 – 16 juin 2004

1.375,47

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«The velocity dispersion of poor groups of galaxies» présenté à la

conférence «The Environments of Galaxies: from Kiloparsecs to

Megaparsecs» à Crète

Marc Zimer

Max-Planck Institut für Extraterrestrische Physik

9 – 13 août 2004

850,00

FNR

04/MA2/16

FNR

04/MA2/24

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Using model transformation and architectural frameworks to

support the software development process: the FIDJI approach»

présenté à la «Midwest Software Engineering Conference–MSEC

2004» à Chicago

Gilles Perrouin

Soft Engineering Competence Center; Université du Luxembourg

30 avril 2004

1.006,87

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Déterminants sociaux et psychologiques dans l’émergence de la

douleur musculosquelettique perçue» présenté au

«28th International Congress of Psychology–ICP 2004» à Pékin

Aurélie Duveau

Laboratoire de Psychologie; Université de Metz

8–13 août 2004

1.282,35

FNR

04/MA2/17

FNR

04/MA2/25

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Are there distinct capacities for the short-term maintenance of

serial order and item information?» présenté à la «2nd International

Conference on Working Memory» à Kyoto

Steve Majerus

Département des Sciences Cognitives; Université de Liège

17–20 août 2004

1.313,20

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Creativity, knowledge diversity and the financing of small innovative

firms» présenté à la «European Summer School on Industrial

Dynamics -ESSID» du 28 à Cargèse

Geneviève Schlink

Faculté de Droit, d’Economie et de Finance; Université du Luxembourg

28 août–4 septembre 2004

1.012,19

FNR

04/MA2/19

FNR

04/MA2/26

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Visualizing the Promethee method» présenté à la «20th European

Conference on Operational Research–EURO XX» à Rhodes

Claude Lamboray

Faculté des Sciences Appliquées; Université Libre de Bruxelles

4–7 juillet 2004

934,00

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Marine natural products as potential inhibitors of NF-kB» présenté

au «XI International Symposium of Marine Natural Products» à

Sorrente

Florence Folmer

Department of Chemistry; University of Aberdeen

4–9 septembre 2004

1.013,00

FNR

04/MA2/21

FNR

04/MA2/27

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Ordinal sorting in the presence of interacting points of view: TO-

MASO» présenté à la conférence «Information Processing and Management

of Uncertainty in Knowledge-Based Systems–IPMU

2004» à Perugia

Patrick Meyer

Faculté de Droit, d’Economie et de Finance; Université du Luxembourg

4–9 juillet 2004

882,58

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Bien-être et maintien à domicile. Le cas des personnes âgées de

60 ans ou plus de la ville de Luxembourg» présenté au colloque

«Peut-on prétendre à des espaces de qualité et de bien-être?» à Angers

Philippe Gerber

Cellule GEODE; CEPS/INSTEAD

22–24 septembre 2004

879,33

FNR

04/MA2/22

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Inhibition of the proteasome activity decreases the production

of Amyloid-beta-peptide without interfering with

the PS1-dependant gamma secretase activity» présenté à la «9th

International Conference on Alzheimer’s Disease

and Related Disorders» à Philadelphia

Christiane Feyt

Laboratoire de Pharmacologie; Université Catholique de Louvain

17–22 juillet 2004

1.121,82

MA2

105


MA2

FNR

FNR

04/MA2/28

FNR

04/MA2/35

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Redesigning computer-based learning environments: evaluation

as communication» présenté à la «International Conference on

Education and Information Systems: Technologies and Applications–EISTA

2004» à Orlando

Matthias Brust

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

21–25 juillet 2004

1.535,89

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Multiple roles for RNA interference (RNAi) in trypanosomes»

présenté au «XVth Molecular Parasitology Meeting» à Woods Hole,

Massachusetts

Mickaël Durand-Dubief

Musée National d’Histoire Naturelle, Paris

19–23 septembre 2004

809,38

FNR

04/MA2/29

FNR

04/MA2/36

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«A combination of methods and process tracing as the next step

of scientific advance in coalition research» présenté au «100th

American Political Science Association–APSA Annual Meeting &

Exhibition» à Chicago

Patrick Dumont

Faculté des Lettres, des Sciences Humaines, des Arts et des Sciences

de l’Education; Université du Luxembourg

2–5 septembre 2004

1.115,08

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Small states: economic aspects & questions of quality» présenté

au «Workshop on Small States» à Reykjavik

Marc Hübsch

Rheinisch-Westfälische Technische Hochschule Aachen

17–18 septembre 2004

1.154,65

FNR

04/MA2/30

FNR

04/MA2/37

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Diet of wild boar in Luxembourg», «Wild boar in Luxembourg:

population characteristics and state of health» présentés au «5th

International Wild Boar and Suidae Symposium» à Cracovie

Sandra Cellina

Department of Biology and Environmental Science; University of Sussex

31 août–5 septembre 2004

735,86

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Natural abundance N&O isotope ratios of nitrous oxide from

agricultural soils in southern Alberta (Canada)» présenté au colloque

«Science to Secure Food and the Environment: 2004 ASA-

CSSA-SSSA International Annual Meetings with the Canadian Society

of Soil Science» à Seattle

Luc Rock

Department of Geology & Geophysics; University of Calgary

31 octobre–4 novembre 2004

847,50

FNR

04/MA2/32

FNR

04/MA2/38

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Asian foreign exchange risk exposure» présenté au «Financial

Management Association Annual Meeting» à New Orleans

Aline Muller

Faculté d’Economie, de Gestion et de Sciences Sociales; Université

de Liège

6–9 octobre 2004

1.900,38

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Comparison of numerical models for viscoelastically damped

sandwich beams» présenté à la «International Conference on

Computing Methods–ICCM 2004» à Singapoure

Heng Hu

Laboratoire des Technologies Industrielles; CRP Henri Tudor

15–17 décembre 2004

1.308,47

FNR

04/MA2/33

FNR

04/MA2/39

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Implication of the Notch pathway in microglial activation» présenté

au «7th International Congress of NeuroImmunology» à Venise

Luc Grandbarbe

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

27 septembre–2 octobre 2004

1.304,26

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Shrinking of gold-nanoink pattern by water induced dewetting»

présenté à la conférence «Integrated Nanosystems 2004»

à Pasadena, Californie

Cédric Dockendorf

Laboratory of Thermodynamics in Emerging Technologies;

Eidgenössische Technische Hochschule Zürich

22–24 septembre 2004

1.059,47

FNR

04/MA2/34

FNR

04/MA2/40

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Intelligent & Knowledge-based solutions for mobile & ad-hoc

networks» présenté à la «8th International Conference

on Knowledge-Based Intelligent Information & Engineering Systems–KES

2004» à Wellington, Nouvelle Zélande

Steffen Rothkugel

Université du Luxembourg

20–24 septembre 2004

537,00

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Napoleon und die Mythisierung der Grande Nation» présenté à la

conférence «Remythisierung in der Literatur der Europäischen

Moderne» à Come

Claude Conter

Centre National de Littérature, Mersch

11–15 octobre 2004

531,30

106

MA2


FNR

MA2

FNR

04/MA2/41

FNR

04/MA2/43

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Contributing causes to the challenged implementation of an enterprise

resource planning system» présenté au «VIIIth International

Congress in Project Engineering» à Bilbao

Emilio Tuñón Nieto

NAMSA

6–8 octobre 2004

1.005,70

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Adaptive modeling: an approach and a method for implementing

adaptive agents» présenté au «International Workshop

on Massively Multi-Agent Systems» à Kyoto

Reza Razavi

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

10–11 décembre 2004

1.293,46

FNR

04/MA2/42

FNR

04/MA2/44

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«An incremental neural-based method to discover temporal skeletons

in transactional data streams» présenté à la conférence

«Recent Advances in Soft Computing–RASC 2004» à Nottingham

Christoph Schommer

Faculté des Sciences, de la Technologie et de la Communication;

Université du Luxembourg

16–18 décembre 2004

836,34

TITRE DE L’ACTIVITÉ

NOM PARTICIPANT

ORGANISME PARTICIPANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

«Analyse génétique de la sensibilité au cancer mammaire» présenté

à la conférence «Molecular Regulation of Stem Cells» à Banff

Daniel Stieber

Laboratoire de Biologie du Développement; Université Libre de Bruxelles

10–15 février 2005

1.653,00

Science Club 2004

MA2

107


MA3

FNR

MA3: Organisation d’une conférence scientifique au Luxembourg

FNR

04/MA3/02

FNR

04/MA3/11

TITRE DE LA CONFÉRENCE Ambulante Pflege in Bewegung. Entwicklung,

Möglichkeiten, Grenzen

NOM ORGANISATEUR Ute Tauchhammer

ORGANISME ORGANISATEUR Stëftung Hëllef Doheem

DATE DE L’ACTIVITÉ 3 mars 2004

CONTRIBUTION FNR EN € 5.930,00

TITRE DE LA CONFÉRENCE 10th Workshop on Progress in Analytical Methods in

Trace Metal Specification

NOM ORGANISATEUR Fernand Reinig

ORGANISME ORGANISATEUR CRP Gabriel Lippmann

DATE DE L’ACTIVITÉ 6–9 avril 2005

CONTRIBUTION FNR EN € 23.000,00

FNR

04/MA3/03

FNR

04/MA3/12

TITRE DE LA CONFÉRENCE Surdité, hypoacousie, retard de langage chez l’enfant:

pour une bonne pratique luxembourgeoise

NOM ORGANISATEUR Fernand Pauly

ORGANISME ORGANISATEUR Société Luxembourgeoise de Pédiatrie

DATE DE L’ACTIVITÉ 20 mars 2004

CONTRIBUTION FNR EN € 500,00

TITRE DE LA CONFÉRENCE 16th Symoposium of the International Association

for Cyanophyte Research

NOM ORGANISATEUR Fernand Reinig

ORGANISME ORGANISATEUR CRP Gabriel Lippmann

DATE DE L’ACTIVITÉ 30 août–3 septembre 2004

CONTRIBUTION FNR EN € 22.100,00

FNR

04/MA3/07

FNR

04/MA3/13

TITRE DE LA CONFÉRENCE AISTA 2004–International Conference on Advances in Intelligent

Systems Theory and Applications

NOM ORGANISATEUR Djamel Khadraoui

ORGANISME ORGANISATEUR CRP Henri Tudor

DATE DE L’ACTIVITÉ 15–19 novembre 2004

CONTRIBUTION FNR EN € 25.000,00

TITRE DE LA CONFÉRENCE EMISA 2004: Development Methods for Information

Systems and their Application

NOM ORGANISATEUR Fernand Reinig

ORGANISME ORGANISATEUR CRP Gabriel Lippmann

DATE DE L’ACTIVITÉ 6–8 octobre 2004

CONTRIBUTION FNR EN € 20.762,00

FNR

04/MA3/08

FNR

04/MA3/15

TITRE DE LA CONFÉRENCE Les Chercheurs Luxembourgeois à l’Etranger (cycle de conférences 2005)

NOM ORGANISATEUR Pierre Seck

ORGANISME ORGANISATEUR Section des Sciences de l’Institut Grand-Ducal

DATE DE L’ACTIVITÉ janvier–mai 2005

CONTRIBUTION FNR EN € 8.800,00

TITRE DE LA CONFÉRENCE Globalisierung und Globalgeschichte

NOM ORGANISATEUR Jean-Paul Lehners

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 21–24 octobre 2004

CONTRIBUTION FNR EN € 5.374,82

FNR

04/MA3/09

FNR

04/MA3/16

TITRE DE LA CONFÉRENCE Une politique de civilisation (conférencier: Edgar Morin, CNRS)

Auf der Suche nach einer neuen Ordnung (conférencier: Ralf Dahrendorf)

NOM ORGANISATEUR Serge Kollwelter

ORGANISME ORGANISATEUR ASTI a.s.b.l.

DATE DE L’ACTIVITÉ 2 soirées entre octobre 2004 et mai 2005

CONTRIBUTION FNR EN € 3.300,00

TITRE DE LA CONFÉRENCE Atelier «Renforcement des capacités pour l’étude de la pauvreté

et des conditions de vie des ménages pour le développement en Afrique»

NOM ORGANISATEUR Pierre Hausman

ORGANISME ORGANISATEUR CEPS/INSTEAD

DATE DE L’ACTIVITÉ 2–4 novembre 2004

CONTRIBUTION FNR EN € 6.954,00

FNR

04/MA3/10

FNR

04/MA3/17

TITRE DE LA CONFÉRENCE Paysages de grès en Europe–Passé, présent et futur Sandstone

landscapes in Europe–Past, present and future

NOM ORGANISATEUR Georges Bechet

ORGANISME ORGANISATEUR Musée National d’Histoire Naturelle

DATE DE L’ACTIVITÉ 25–28 mai 2005

CONTRIBUTION FNR EN € 25.000,00

TITRE DE LA CONFÉRENCE What makes bioethics evolving and what are the waiting to

come, especially in Luxembourg? Reflection with experts, key

partners and bioethical advisory bodies

NOM ORGANISATEUR Susan Michel

ORGANISME ORGANISATEUR CRP Santé

DATE DE L’ACTIVITÉ 19–20 octobre 2004

CONTRIBUTION FNR EN € 11.544,50

108

MA3


FNR

MA3

FNR

04/MA3/18

FNR

04/MA3/25

TITRE DE LA CONFÉRENCE Medizin ohne Ethik? / Médecine sans éthique?

NOM ORGANISATEUR Lukas K. Sosoe

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 22–24 octobre 2004

CONTRIBUTION FNR EN € 7.293,00

TITRE DE LA CONFÉRENCE 24 e Journée Nationale de Biologie Clinique

NOM ORGANISATEUR Robert Fassotte

ORGANISME ORGANISATEUR Société Luxembourgeoise de Biologie Clinique

DATE DE L’ACTIVITÉ 17–18 septembre 2004

CONTRIBUTION FNR EN € 3.992,40

FNR

04/MA3/19

FNR

04/MA3/27

TITRE DE LA CONFÉRENCE FIDJI 2004 (scientiFic engIneering of Distributed Java applIcations)

NOM ORGANISATEUR Nicolas Guelfi

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 24–25 novembre 2004

CONTRIBUTION FNR EN € 6.190,00

TITRE DE LA CONFÉRENCE Regards croisés sur l’Islam et l’Europe: Débats, enjeux,

perspectives (cycle de conférences)

NOM ORGANISATEUR Philippe Poirier

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ octobre–décembre 2004

CONTRIBUTION FNR EN € 6.270,00

FNR

04/MA3/20

FNR

04/MA3/30

TITRE DE LA CONFÉRENCE Cycle de conférences sur la conservation de la nature

NOM ORGANISATEUR Jean-Pierre Schmitz

ORGANISME ORGANISATEUR Fondation «Hëllef fir d’Natur»

DATE DE L’ACTIVITÉ 23 octobre 2004

CONTRIBUTION FNR EN € 3.491,67

TITRE DE LA CONFÉRENCE Nordic-European Venture Forum Luxembourg 2004 (2 e édition)

NOM ORGANISATEUR Mathilde Nankwaya

ORGANISME ORGANISATEUR Nobelux

DATE DE L’ACTIVITÉ 25–26 novembre 2004

CONTRIBUTION FNR EN € 10.000,00

FNR

04/MA3/22

FNR

04/MA3/31

TITRE DE LA CONFÉRENCE Journée d’Etude du Handicap

NOM ORGANISATEUR Raymond Ceccotto

ORGANISME ORGANISATEUR Fondation APEMH

DATE DE L’ACTIVITÉ 27 octobre 2005

CONTRIBUTION FNR EN € 7.806,00

TITRE DE LA CONFÉRENCE Erster Internationaler und Interdisziplinärer Workshop zur

Frauen- und Genderforschung an der Universität Luxemburg.

Tema: Gender & Sciences

NOM ORGANISATEUR Christel Baltes-Löhr

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 3–4 décembre 2004

CONTRIBUTION FNR EN € 4.500,00

FNR

04/MA3/23

FNR

04/MA3/32

TITRE DE LA CONFÉRENCE Philosophie et cetera (cycle de conférences 2e année)

NOM ORGANISATEUR Robert Theis

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ octobre 2004–juin 2005

CONTRIBUTION FNR EN € 4.000,00

TITRE DE LA CONFÉRENCE Longévité et vieillissement: le rôle des hormones

NOM ORGANISATEUR Pierre Seck

ORGANISME ORGANISATEUR Institut Grand-Ducal, Section des Sciences

DATE DE L’ACTIVITÉ 28 novembre 2004

CONTRIBUTION FNR EN € 1.500,00

FNR

04/MA3/24

FNR

04/MA3/33

TITRE DE LA CONFÉRENCE Les Jeudis des Sciences (cycle de conférences 7 e semestre)

NOM ORGANISATEUR Massimo Malvetti

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ octobre 2004–février 2005

CONTRIBUTION FNR EN € 3.000,00

TITRE DE LA CONFÉRENCE Artificial Intelligence (seminar series)

NOM ORGANISATEUR Christoph Schommer

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 1 er janvier–30 septembre 2005

CONTRIBUTION FNR EN € 3.330,00

MA3

109


MA3

FNR

FNR

04/MA3/34

FNR

04/MA3/41

TITRE DE LA CONFÉRENCE Art et Culture à l’époque de Sigismond de Luxembourg (1387-1437)

NOM ORGANISATEUR Paul Reiles

ORGANISME ORGANISATEUR Musée National d’Histoire et d’Art

DATE DE L’ACTIVITÉ 8–11 juin 2005

CONTRIBUTION FNR EN € 25.000,00

TITRE DE LA CONFÉRENCE GOCINA–Geoid and Ocean Circulation in the North Atlantic

NOM ORGANISATEUR Olivier Francis

ORGANISME ORGANISATEUR Centre Européen de Géodynamique et de Séismologie

DATE DE L’ACTIVITÉ 13–15 avril 2005

CONTRIBUTION FNR EN € 8.000,00

FNR

04/MA3/35

FNR

04/MA3/42

TITRE DE LA CONFÉRENCE Colloque sur le patrimoine naturel et la biodiversité encadré par

la XXIIe réunion annuelle des collaborateurs scientifiques du Musée

National d’Histoire Naturelle

NOM ORGANISATEUR Georges Bechet

ORGANISME ORGANISATEUR Musée National d’Histoire Naturelle

DATE DE L’ACTIVITÉ 12 mars 2005

CONTRIBUTION FNR EN € 3.731,00

TITRE DE LA CONFÉRENCE 7. Deutsch-Portugiesischen Gespräche. «Heimat in der

Fremde–Pátria em terra alheia»

NOM ORGANISATEUR Christel Baltes-Löhr

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 9–13 mars 2005

CONTRIBUTION FNR EN € 8.000,00

FNR

04/MA3/36

FNR

04/MA3/43

TITRE DE LA CONFÉRENCE 61 es Journées du groupe de travail européen EURO intitulées

«Aide multi-critère à la décision»

NOM ORGANISATEUR Raymond Bisdorff

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 10–11 mars 2005

CONTRIBUTION FNR EN € 4.202,00

TITRE DE LA CONFÉRENCE Les Jeudis des Sciences (cycle de conférences 8 e semestre)

NOM ORGANISATEUR Massimo Malvetti

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 1 er février–1er juin 2005

CONTRIBUTION FNR EN € 2.000,00

FNR

04/MA3/37

FNR

04/MA3/44

TITRE DE LA CONFÉRENCE Linuxday 2005

NOM ORGANISATEUR Patrick Harpes

ORGANISME ORGANISATEUR CRP Henri Tudor

DATE DE L’ACTIVITÉ 25–26 janvier 2005

CONTRIBUTION FNR EN € 6.200,00

TITRE DE LA CONFÉRENCE Econométrie des taux de change

(organisée par l’Association d’Econométrie Appliquée–AEA)

NOM ORGANISATEUR Virginie Terraza

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 7–8 avril 2005

CONTRIBUTION FNR EN € 13.655,00

FNR

04/MA3/38

FNR

04/MA3/45

TITRE DE LA CONFÉRENCE Les sciences de la Terre dans la société actuelle (cycle de conférences)

NOM ORGANISATEUR Adolphe Muller

ORGANISME ORGANISATEUR Institut géologique Michel Lucius

DATE DE L’ACTIVITÉ Année 2005

CONTRIBUTION FNR EN € 1.692,00

TITRE DE LA CONFÉRENCE Quelle politique sociale pour le Luxembourg?

NOM ORGANISATEUR Marie-France Berger-Modert

ORGANISME ORGANISATEUR Conseil National des Femmes du Luxembourg

DATE DE L’ACTIVITÉ 14–15 avril 2005

CONTRIBUTION FNR EN € 11.265,00

FNR

04/MA3/39

FNR

04/MA3/46

TITRE DE LA CONFÉRENCE Integrated Approaches in Cytoskeleton Research

NOM ORGANISATEUR Evelyne Friederich

ORGANISME ORGANISATEUR CRP Santé

DATE DE L’ACTIVITÉ 27–31 août 2005

CONTRIBUTION FNR EN € 23.239,00

TITRE DE LA CONFÉRENCE

NOM ORGANISATEUR

ORGANISME ORGANISATEUR

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

Progress and Problems in Building a European Legal Order:

Europeanization through the Transposition and Implementation

of EU Directives

Herwig Hofmann

Université du Luxembourg

24–25 juin 2005

7.675,00

FNR

04/MA3/40

FNR

04/MA3/47

TITRE DE LA CONFÉRENCE The Future of Sustainable Residual Waste Management in Europe

NOM ORGANISATEUR André Weidenhaupt

ORGANISME ORGANISATEUR CRP Henri Tudor

DATE DE L’ACTIVITÉ 19–20 mai 2005

CONTRIBUTION FNR EN € 19.678,00

TITRE DE LA CONFÉRENCE Les relèves en Europe d’un après guerre à l’autre

NOM ORGANISATEUR Marianne Backes

ORGANISME ORGANISATEUR Centre Virtuel de la Connaissance sur l’Europe (CVCE)

DATE DE L’ACTIVITÉ 16–18 mars 2005

CONTRIBUTION FNR EN € 8.750,00

110

MA3

FNR

04/MA3/48

TITRE DE LA CONFÉRENCE La Constitution Européenne

NOM ORGANISATEUR Lukas K. Sosoe

ORGANISME ORGANISATEUR Université du Luxembourg

DATE DE L’ACTIVITÉ 17–19 février 2005

CONTRIBUTION FNR EN € 17.455,00


FNR

MA4a

MA4a: Publication de thèses de doctorat

FNR

04/MA4a/01

FNR

04/MA4a/06A

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Schiller und die Tradition des Erhabenen

Paul Barone

Albert-Ludwigs-Universität Freiburg

1.615,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Communication Architecture for Telepresence in Virtual

Environments

Edouard Lamboray

Department of Computer Science;

Eidgenössische Technische Hochschule Zürich

971,00

FNR

04/MA4a/02

FNR

04/MA4a/07

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Wirtschaftsräumliche Möglichkeiten und Grenzen einer wirtschaftsfördernden

Politik für das Großherzogtum Luxemburg

Marc Hübsch

Geographisches Institut;

Rheinisch-Westfälische Technische Hochschule Aachen

2.511,97

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Die Effektivitätsfalle. Bürgerschaftliches Engagement und

Gemeinwesenarbeit zwischen Ergebnisorientierung und

Lebensbewältigung

Chantal Munsch

Institut für Sozialpädagogik, Sozialarbeit und

Wohlfahrtswissenschaften; Technische Universität Dresden

1.337,50

FNR

04/MA4a/03

FNR

04/MA4a/08

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Macroéconomie dynamique internationale: les effets de chocs

permanent et temporaire des termes de l’échange. Ré-examen

de l’effet Harberger-Laursen-Metzler et de la courbe en J.

Olivier Cardi

Cellule de Recherche en Economie Appliquée (CREA);

Université du Luxembourg

1.413,53

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Population Biology of the Endangered Long-Lived Perennial

Scorzonera Humilis

Guy Colling

Institut für Umweltwissenschaften; Universität Zürich

976,00

FNR

04/MA4a/04

FNR

04/MA4a/09

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

La production artisanale dans l’économie de la Gaule Belgique

romaine à partir de la documentation archéologique

Michel Polfer

Université de Metz

1.246,83

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Non-Invasive Genetic Typing in the Study of Badger Ecology

Alain Frantz

Department of Biology and Environmental Science;

University of Sussex

350,00

MA4a

111


MA4b

FNR

MA4b: Publication d’ouvrages scientifiques

FNR

04/MA4b/01

FNR

04/MA4b/08

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes de la conférence «Paysages de grès en Europe–Passé,

présent et futur. Sandstone landscapes in Europe–Past,

present and future»

Georges Bechet

Musée National d’Histoire Naturelle

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes de l’atelier luxemburgo-tunisien intitulés «Incursion tunisienne

dans les lettres luxembourgeoises»

Marion Colas-Blaise

Université du Luxembourg

3.000,00

FNR

04/MA4b/02

FNR

04/MA4b/09

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes de la conférence «EMISA 2004»

Fernand Reinig

CRP Gabriel Lippmann

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Le Jansénisme extra muros ou Antoine Arnauld et la procession

des Jésuites de Luxembourg du 20 mai 1685

Raymond Baustert

Université du Luxembourg

2.950,00

FNR

04/MA4b/03

FNR

04/MA4b/10

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes de la conférence «Globalisierung und Globalgeschichte»

Jean-Paul Lehners

Université du Luxembourg

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Chemopreventive and therapeutic effects of curcumin (manuscrit

scientifique publié dans le journal ’Cancer Letters’)

Marc Diederich

Laboratoire de Biologie Moléculaire et Cellulaire du Cancer,

Hôpital Kirchberg

454,00

FNR

04/MA4b/05

FNR

04/MA4b/11

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

The application of two-dimensional polyacrylamide gel

electrophoresis and downstream analyses to a mixed community

of prokaryotic microorganisms

Paul Wilmes

School of Environmental Sciences; University of East Anglia

940,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Modulation of sensitivity to doxorubicin by the histone deacetylase

inhibitor sodium butyrate in breast cancer cells (article sientifique

publié dans le journal ’International Journal of Oncology’)

Monette Louis

Laboratoire d’Ingénierie Moléculaire et Biochimie Pharmacologique;

Université de Metz

1.070,00

FNR

04/MA4b/06

FNR

04/MA4b/12

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Private Equity Funds

Tom Weidig

Independant Consultant

1.740,83

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes du colloque «Art et Culture à l’époque de Sigismond de

Luxembourg (1387-1437)»

Paul Reiles

Musée National d’Histoire et d’Art

3.000,00

FNR

04/MA4b/07

FNR

04/MA4b/13

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes des 11es Journées Lotharingiennes intitulés «Sépulture,

mort et symbolique du pouvoir au moyen âge–Tod, Grabmal und

Herrschaftsrepresentation im Mittelalter»

Michel Margue

Université du Luxembourg

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Abstract book de la conférence «GAMM 2005»

Massimo Malvetti

Université du Luxembourg

3.000,00

112

MA4b


FNR

MA5

FNR

04/MA4b/14

FNR

04/MA4b/17

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes du cycle de conférences «Les sciences de la Terre

dans la société actuelle»

Adolphe Muller

Institut géologique Michel Lucius

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes du colloque «The Future of Sustainable Residual Waste

Management in Europe»

André Weidenhaupt

CRP Henri Tudor

3.000,00

FNR

04/MA4b/15

FNR

04/MA4b/18

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes de la conférence «Les relèves en Europe d’un après guerre

à l’autre»

Marianne Backes

Centre Virtuel de la Connaissance sur l’Europe (CVCE)

3.000,00

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes du colloque «Econométrie des Taux de Change»

de l’association d’économétrie appliquée (AEA)

Virginie Terraza

Université du Luxembourg

3.000,00

FNR

04/MA4b/16

TITRE DE LA PUBLICATION

NOM AUTEUR

ORGANISME ORGANISATEUR

CONTRIBUTION FNR EN €

Actes des 61 es Journées «Aide Multi-Critère à la Décision» du

groupe de travail européen (EURO)

Raymond Bisdorff

Université du Luxembourg

3.000,00

MA5: Préparation d’un projet de recherche EU

FNR

04/MA5/01

TITRE DU PROJET

NOM PROPOSANT

ORGANISME/PROPOSANT

CONTRIBUTION FNR EN €

Composite and Adaptive Structures: Simulation, Experimentation

and Modelling (CASSEM)

Salim Belouettar

CRP Henri Tudor

10.000,00

MA5

113


MA6

FNR

MA6: Mobilité des chercheurs

FNR

04/MA6/01

FNR

04/MA6/07

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Quantifiying long-term changes in global water cycle using geodetic

measurements of the earth’s shape»

Tonie van Dam

Centre Européen de Géodynamique et de Séismologie

29 mars – 21 mai 2004

4.000,00

Séjour du Dr David Lavallé, University of Newcastle upon Tyne

(UK) au European Center for Geodynamics and Seismology (ECGS)

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Characterization of Viscosity Effects on Nanoindentation Testing

of Polymers using Transient and Harmonic Loading»

Gaston Rauchs

CRP Henri Tudor

12 juillet – 12 septembre 2004

6.166,56

Séjour du prof. Jaroslav Mencík de l’Université de Pardubice au

Laboratoire de Technologies Industrielles du CRP Henri Tudor

FNR

04/MA6/02

FNR

04/MA6/08

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Development and Evaluation of an HIV-1 drug resistance genotyping

on dried blood spots (DBS): A multi-center collaboration

between Kiev (Ukraine), Utrecht (Netherlands) and Luxembourg.»

Jean-Claude Schmit

Centre de Recherche Public Santé

15 septembre – 15 décembre 2004

7.600,00

Séjour du Dr Tetyana Loginova du Kiev Narcological Hospital au

Laboratoire de Rétrovirologie du Centre Hospitalier de Luxembourg

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Damage Mechanisms, Detection and Modelling of Sandwich

Composites»

Salim Belouettar

CRP Henri Tudor

2 août – 3 septembre 2004

3.628,00

Séjour du prof. Nicolae Constantin de l’Université «Politehnica» de

Bucharest au Laboratoire de Technologies Industrielles du CRP

Henri Tudor

FNR

04/MA6/03

FNR

04/MA6/09

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Study of interaction between groundwaters and surface waters

using radioactive and stable isotopes»

Antoine Kies

Université du Luxembourg

1 er septembre – 30 novembre 2004

4.174,82

Séjour de l’étudiante PhD Luisa Stellato du Department of

Envionmental Sciences de la Second University of Naples à l’Université

du Luxembourg

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Travaux de recherche sur différentes questions économiques (localisation

des PME en présence de multinationales étrangères

au Luxembourg, agglomération et dispersion de l’activité économique

entre régions, connaissances sur les externalités

d’agglomération)»

Luisito Bertinelli

Université du Luxembourg

octobre 2004 – octobre 2005

1.200,00

Séjour du Dr Luisito Bertinelli de l’Université du Luxembourg

auprès du Center for Operations Resarch and Econometrics

(CORE) de l’Université catholique de Louvain

FNR

04/MA6/04

FNR

04/MA6/10

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Determination of Radionuclides in Water by Means of LSC and

Alpha Counting»

Antoine Kies

Université du Luxembourg

1 er octobre – 16 décembre 2004

6.900,00

Séjour de Mme Inna Taskaeva, chimiste nucléaire à l’Institute of

Nuclear Research and Nuclear Energy de la Bulgarian Academy of

Sciences de Sofia à l’Université du Luxembourg

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Sozio-demographische Variablen–insbesonders Einkommensvariablen–in

international vergleichbaren Erhebungen»

Uwe Warner

CEPS/INSTEAD

2 août – 31 août 2004

3.071,00

Séjour du Prof. Dr Jürgen Hoffmeyer-Zlotnik du Zentrum für Umfragen,

Methoden und Analysen (ZUMA) de Mannheim

et de la Universität Essen au CEPS/INSTEAD

FNR

04/MA6/05

FNR

04/MA6/11

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Recherches dans le domaine des réseaux ad-hoc sécurisés (problèmes

d’optimisation, de services contextuels, de cryptographie

et d’intrusion)»;

Pascal Bouvry, Steffen Rothkugel

Université du Luxembourg

septembre 2004

3.500,00

Séjour des prof. Bouvry et Rothkugel de l’Université du Luxembourg

chez le prof. Zomaya de l’Université de Sydney

TITRE PROJET DE RECHERCHE «Travaux de recherche concernant la théorie algorithmique des

nombres et la cryptographie et la sécurité des systèmes

d’information»

NOM PROPOSANT Franck Leprévost

ORGANISME PROPOSANT Université du Luxembourg

DATE DE L’ACTIVITÉ septembre 2004 – juin 2005

CONTRIBUTION FNR EN € 7.615,00

NOM ET ORGANISME DE Séjour des prof. J.-C. Asselborn et F. Leprévost de l’Université du

L’ACCUEILLI ET DE L’ACCUEILLANT Luxembourg chez les prof. F. Hess, M. Pohst et A. Schöpp

de la Technische Universität Berlin et vice-versa

114

MA6


FNR

MA6

FNR

04/MA6/06

FNR

04/MA6/12

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Recherches fondamentales et appliquées dans le domaine de la

sécurité et de l’ordonnancement»

Pascal Bouvry

Université du Luxembourg

août–décembre 2004

5.750,00

Séjour de recherche du prof. Franciszek Seredynski de l’Académie

des Sciences de Pologne / l’Institut d’informatique Pologne/Japon

de Varsovie à l’Université du Luxembourg

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

«Travaux de recherche concernant la théorie algorithmique des

nombres et la cryptographie et la sécurité des systèmes

d’information»

Franck Leprévost

Université du Luxembourg

septembre 2004–juin 2005

10.254,00

Séjour des prof. J.-C. Asselborn et F. Leprévost de l’Université du

Luxembourg chez les prof. R. Gillard et A. Panchichkine

de l’Université Joseph Fourier à Grenoble et vice-versa

FNR

04/MA6/15

FNR

04/MA6/17

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

Climate and migrations: how rainfall has shaped Africa’s urbanization

Luisito Bertinelli

Université du Luxembourg

1 er janvier–31 décembre 2005

1.000,00

Séjour de Dr Luisito Bertinelli de l’Université du Luxembourg

chez le prof. Eric A. Strobl de l’Université de Paris et vice-versa

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

Caractérisation des eaux profondes par les radioéléments naturels

Antoine Kies

Université du Luxembourg

3 semaines entre mars et mai 2005

2.000,00

Séjour de M. Stéphane Basseguy de l’Université de la Réunion

à l’Université du Luxembourg

FNR

04/MA6/16

FNR

04/MA6/20

TITRE PROJET DE RECHERCHE

NOM PROPOSANT

ORGANISME PROPOSANT

DATE DE L’ACTIVITÉ

CONTRIBUTION FNR EN €

NOM ET ORGANISME DE

L’ACCUEILLI ET DE L’ACCUEILLANT

Utilisation et impact d’Internet lors des élections nationales et

européennes de juin 2004

Fernand Fehlen

Université du Luxembourg

1 er février–31 mai 2005

12.360,00

Séjour de M. Raphael Kies de l’Institut Universitaire Européen

de Florence à l’Université du Luxembourg

TITRE PROJET DE RECHERCHE Approche anthropologique de l’obésité de l’enfant et de l’adolescent

au Grand-Duché du Luxembourg

NOM PROPOSANT Carine de Beaufort

ORGANISME PROPOSANT Centre Hospitalier du Luxembourg

DATE DE L’ACTIVITÉ 15 février 2005–15 février 2006

CONTRIBUTION FNR EN € 36.000,00

NOM ET ORGANISME DE Séjour de Mme Hanène Samouda de l’Université de la Méditerranée

de Marseille au Centre Hospitalier de L’ACCUEILLI ET DE L’ACCUEILLANT

Luxembourg

FNR-04-MA3-25: 24 e Journée Nationale de Biologie Clinique, sept. 2004

MA6

115


IV. Collaborations

internationales en 2004

116

Collaborations internationales en 2004


»

ESF

European Science Foundation

Participation aux activités de la European Science Foundation (ESF)

Depuis le 1 er janvier 2002, le Fonds est membre de la European Science Foundation (ESF). L’adhésion

à la ESF a été entreprise dans le but de faciliter et de promouvoir les contacts et les collaborations de

chercheurs luxembourgeois avec leurs confrères étrangers.

Représentants nationaux

Pour ce faire, suite à un appel auprès de la communauté scientifique luxembourgeoise, le Fonds a

nommé en 2002 les représentants nationaux suivants dans les comités de la ESF:

» Standing Committee for Physical and Engineering Sciences (PESC):

2002 à 2004: Serge Gillé, CRP Henri Tudor

2005 à 2007: Henri-Noël Migeon, CRP Gabriel Lippmann

» European Medical Research Councils (EMRC):

2002 à 2004: Nelly Kieffer, Université du Luxembourg

2005 à 2007: Charles Pull, Centre Hospitalier de Luxembourg

» Life, environmental and earth sciences (LESC):

2002 à 2004: Lucien Hoffmann, CRP Gabriel Lippmann

2005 à 2007: Olivier Francis, European Centre of Geodynamics and Seismology

» Standing Committee for the Humanities (SCH):

2002 à 2005: Michel Polfer

» Standing Committee for the Social Sciences (SCSS):

2002 à 2004: Antoine Haag

2005 à 2007: Georges Steffgen, Université du Luxembourg

» Governing Council:

Raymond Bausch, Fonds National de la Recherche

La participation des experts luxembourgeois dans les réseaux de la ESF permet ainsi de renforcer les

collaborations scientifiques avec l’étranger. Les frais de voyage relatifs à ces participations sont pris en

charge par le Fonds.

Esf

117


118

Esf

Activités

Les échanges avec la ESF ont porté leurs fruits dès 2002 à travers une participation du Luxembourg

aux programmes et activités suivants de la ESF:

» Integrated Approaches for Functional Genomics

2003 à 2005: Evelyne Friederich, CRP Santé

Suite à la quantité grandissante de données de séquences génomiques issues du ‘Human Genome

project’ et autres projets travaillant dans ce sens, le défi en matière de recherche consiste surtout

à découvrir les fonctions génétiques à partir des informations sur les séquences ADN. Cette nouvelle

discipline est connue sous le nom de ‘functional genomics’. Comme les technologies utilisées dans

ce domaine sont très diverses, le présent programme vise à intégrer et à mettre en réseau les laboratoires

européens, point essentiel pour l’utilisation optimale des ressources.

» European Polar Board

Participation du Luxembourg à partir de 2003: Antoine Kies, Université du Luxembourg

Etabli en 1995, le European Polar Board est le comité d’experts de la ESF dans le domaine de la recherche

dans les régions polaires. Il s’agit d’un programme interdisciplinaire intégrant des disciplines très diverses,

parmi lesquelles les sciences de la terre et les sciences de l’environnement.

» Quantitative Methods in the Social Sciences

2003 à 2007: Gaston Schaber, CEPS/INSTEAD

Ce programme vise à renforcer les compétences en Europe pour analyser des bases de données complexes

qui sont nécessaires pour informer les responsables politiques, en particulier, notamment pour

encourager le développement des réseaux européens de jeunes chercheurs.

» European Social Survey

2003-2005: Uwe Warner et Monique Borsenberger, CEPS/INSTEAD

Il s’agit d’une enquête biannuelle coordonnée par la ESF et réalisée dans 23 pays qui permet un accès

libre aux données de chacun de ces pays pour les chercheurs en sciences sociales. Les première

et deuxième vagues de l’enquête en 2003 respectivement 2004/05 ont été financées dans le cadre

du programme pluriannuel ‘VIVRE demain au Luxembourg’.

» Representations of the Past: National Histories in Europe (NHIST)

2004-2007: Michel Margue, Université du Luxembourg

The programme is the collaborative effort of more than sixty leading scholars from more than 20

European countries. Its agenda will be implemented by four teams which will investigate

1. the institutions, networks and communities which produced national histories and were themselves

influenced by the idea of national history,

2. the construction, erosion and reconstruction of national histories in their relationship with competing

representations structured by the social cleavages in a society (such as class, race/ethnicity, religion

and gender),

3. national histories and their relationship with regional, European and world histories,

4. the national histories in their spatial relationships and mutual interdependency with other national histories.

» Eurocores

Le Fonds a participé en 2004 à un appel à projets au sein du programme EUROCORES (EUROpean

Science Foundation Collaborative RESearch programme) dans le domaine de la biodiversité. Le

schéma EUROCORES prévoit le soutien de projets de recherche avec plusieurs partenaires internationaux.

Les projets font l’objet d’une évaluation internationale gérée par la ESF tandis que le financement

est garanti par les organisations participantes au niveau national. Une participation plus

importante aux futurs EUROCORES initiés par la ESF est prévue à travers un futur programme pluriannuel

de collaboration internationale du Fonds.

Des informations détaillées concernant tous les programmes, activités et autres opportunités

de collaboration dans le cadre de la ESF sont disponibles sur le site www.esf.org.


»

ERCIM

European Research Consortium

in Informatics and Mathematics

Participation aux activités du European Research Consortium

in Informatics and Mathematics (ERCIM)

ERCIM est un consortium regroupant des instituts de recherche de 18 pays européens dans le domaine

des technologies de l’information et des mathématiques appliquées.

ERCIM a comme objectifs de:

» renforcer la Communauté Européenne dans les domaines des STIC et des mathématiques appliquées;

» identifier les domaines de recherche émergeants en Europe;

» aider ses partenaires dans leurs relations avec la Communauté Européenne

et d’autres organismes internationaux;

» favoriser la réalisation de projets internationaux;

» promouvoir les synergies entre des programmes complémentaires;

» réunir ressources et compétences pour renforcer la position de l’Europe dans la recherche et le

transfert de l’innovation.

Les principaux comités d’ERCIM sont le ‘Board of Directors’ et le ‘Executive Committee’ qui coordonnent

les activités du consortium et sont les intermédiaires entre les communautés de recherche nationales

et ERCIM.

Représentants nationaux

Les représentants nationaux dans les comités et groupes de travaux ERCIM sont les suivants:

» Board of Directors:

2002 - 2005: Eric Dubois, CRP Henri Tudor

» Executive Committee:

2002 – 2005: Nicolas Guelfi, Université du Luxembourg

» Editorial Board:

2002 – 2005: Patrik Hitzelberger, CRP Gabriel Lippmann

» Working Group « Electronic Commmerce »:

2002 – 2005: Benoît Otjacques, CRP Gabriel Lippmann

2002 – 2005: Djamel Khadraoui, CRP Henri Tudor

» Working Group «Environmental Modelling»:

2002 – 2005: Henri-Michel Cauchie, CRP Gabriel Lippmann

2002 – 2005: Paul Schosseler, CRP Henri Tudor

» Task Force «European Liaison Officers»:

2002 – 2005: Béatrix Barafort, CRP Henri Tudor

Ercim

119


» Working group «Applications of Numerical Mathematics in Science»:

2002 – 2005: Salim Belouettar, CRP Henri Tudor

» Working group «E-learning»:

2002 – 2005: Luc Vandenabeele, CRP Henri Tudor

2002 – 2005: Denis Zampunieris, Université du Luxembourg

» Groupe de travail «Informatics and mathematics applied to interventional medicine»:

2004 – 2005: Pierre Plumer, CRP Henri Tudor (SANTEC)

» Groupe de travail «Dependable Software - Intensive Systems»:

2004 – 2005: Reza Razavi, Université du Luxembourg

2002 – 2005: Steffen Rothkugel, Université du Luxembourg

» Groupe de travail «Soft Computing»:

2002 – 2005: Pierre Emile Mousel, Université du Luxembourg

2004 – 2005: Pascal Bouvry, Université du Luxembourg

» Groupe de travail «Semantic Web»:

2004 – 2005: Thibaud Latour, CRP Henri Tudor

» Groupe de travail «Rapid Integration of Software Engineering techniques»:

2004 – 2007: Nicolas Guelfi, Université du Luxembourg

» Groupe de travail «Data and Information Mining»:

2005 – 2008: Christoph Schommer, Université du Luxembourg

» Task Force «Fellowships» / Bourses ERCIM:

2002 – 2005: Ulrike Kohl, Fonds National de la Recherche

Les Bourses ERCIM

Les bourses ERCIM encouragent les jeunes chercheurs de niveau post-doctoral du monde entier à

travailler sur un problème de recherche dans deux centres du réseau ERCIM. Les candidats désireux

d’obtenir une telle bourse envoient leurs demandes à ERCIM en utilisant le formulaire qui peut être

téléchargé à partir du site www.ercim.org. ERCIM dresse alors une liste de toutes les candidatures avec

les CV des personnes et avec leurs propositions de projets de recherche, liste qui est envoyée aux institutions

partenaires d’ERCIM, parmi celles-ci le Fonds National de la Recherche.

Le Fonds lance deux fois par an des appels pour attribuer une bourse en vue d'accueillir un chercheur

pour une période de neuf mois dans un institut au Luxembourg et pendant une période supplémentaire

de neuf mois dans un autre institut ERCIM à l'étranger.

En 2004, les bourses suivantes ont été retenues pour un financement par le Fonds:

» Monika Lanzenberger (de nationalité autrichienne), pour un séjour du 1 er octobre 2005 au 31 juin

2006 au CRP Henri Tudor (Responsable: Thibaud Latour);

» Shalini Gupta (de nationalité indienne), pour un séjour du 15 avril 2006 au 15 janvier 2007 au CRP

Henri Tudor (Responsable: Salim Belouettar).

Des renseignements supplémentaires sont disponibles sur le site d’ERCIM

http://www.ercim.org/activity/fellows/fellowship.html respectivement sur le site du Fonds www.fnr.lu.

120

Ercim


»

COST

Coopération dans le domaine

de la recherche scientifique et technique

Participation du Luxembourg à la Coopération

dans le domaine de la recherche scientifique et technique (COST)

COST est une action de coopération européenne dans le domaine de la recherche scientifique et technique

créée en 1971 à l'initiative de la France. COST coordonne l'activité de recherche de 34 pays de l'Europe

géographique dans les domaines les plus variés.

Les projets présentés à l'initiative des chercheurs rassemblent entre 5 et 25 pays (15 en moyenne).

Le financement porte exclusivement sur les frais de coordination (rencontres entre les équipes, frais

d'édition, missions courtes de jeunes chercheurs…), les coûts de la recherche étant pris en charge par

chaque pays dans le cadre des programmes nationaux.

Sur demande du Ministère de la Culture, de l'Enseignement supérieur et de la Recherche (MCESR), le

Fonds avait lancé en 2002 un appel auprès de la communauté scientifique du Luxembourg en vue de

la nomination de représentants luxembourgeois dans les comités techniques de COST. Depuis, le Fonds

rembourse les frais de participation de représentants aux réunions COST, au cas où ces frais ne seraient

pas déjà pris en compte par COST.

La coordination nationale de COST est assurée par le Ministère de la Culture, de l’Enseignement

supérieur et de la Recherche.

Représentants nationaux

» Coordination nationale:

Josiane Entringer, Ministère de la Culture, de l’Enseignement supérieur et de la Recherche

» Technical Committee Social Sciences and Humanities:

Lony Schiltz, Université du Luxembourg

» Technical Committee Agriculture, Food Sciences and Biotechnology:

Jean François Hausman, CRP Gabriel Lippmann

» Technical Committee Environment:

Lucien Hoffmann, CRP Gabriel Lippmann

André Weidenhaupt, CRP Henri Tudor

» Technical Committee Medicine and Health:

Claude Muller, Laboratoire National de Santé

» Technical Committee Meteorology:

Laurent Pfister, CRP Gabriel Lippmann

Cost

121


En 2004, le Luxembourg a manifesté son intérêt pour participer à dix actions COST, nouvelles ou en cours:

Action N° Titre Institution intéressée

B22 Drug development for parasitic diseases CRP Santé

859 Phytotechnologies to promote sustainable land CRP Gabriel Lippmann

use management and improve food safety

274 Theory and Applications of Relational Structures Université du Luxembourg

as Knowledge Instruments (TARSKI)

A21 Restorative Justice Developments in Europe Université du Luxembourg

858 Viticulture: biotic and abiotic stress grapevine defence CRP Gabriel Lippmann

mechanisms and grape development

634 On- and off site environmental impacts of runoff and erosion CRP Gabriel Lippmann

725 Establishing a European phenological data CRP Gabriel Lippmann

platform for climatological applications

280 Channel Modelling and Propagation Impairment SES-ASTRA

Mitigation for Millimetre Wave Radio Systems

636 Xenobiotics in the urban water cycle CRP Henri Tudor

C18 Performance assessment of urban infrastructure services: CRP Henri Tudor

the case of water supply, wastewater and solid waste

Des informations détaillées concernant les activités COST et la participation luxembourgeoise dans les diverses ‘actions COST’

peuvent être consultées sur le site http://cost.cordis.lu/src/home.cfm.

122

Cost

Participation du Luxembourg à des actions COST


ERA-NET

» European Research Area Networks

Participation du Fonds aux Réseaux ERA-NET

(European Research Area Networks)

Le Fonds participe depuis 2003 à trois réseaux ERA-NET (European Research Area Networks) financés

par le 6 e programme-cadre de l’Union Européenne dans l’objectif de renforcer l’Espace Européen de

Recherche en rassemblant des organisateurs de programmes de recherche du secteur public des différents

Etats européens.

Les réseaux auxquels participe le Fonds sont les suivants:

» ERA-NET Materials (ENMatSSA) – Specific support action (SSA) du 1 er décembre 2003 au 30 septembre

2004 et MATERA – Action coordonnée (CA) du 1 er février 2005 au 31 janvier 2009

» ERA-NET Neuron – SSA

» ERA-NET ERA-AGE – Coordinated Action (CA)

ERA-NET Materials (ENMatSSA) – phase préparatoire

(Specific support action)

Le projet ERA-NET Materials a eu pour but d’installer progressivement des programmes de recherche

régionaux et nationaux dans des pays et régions membres afin de travailler ensemble au niveau régional,

national voire européen sur des programmes de recherche concernant les sciences des matériaux.

Cette activité, d’une durée de 10 mois (1 er décembre 2003 au 30 septembre 2004) qui a commencé

avec une phase préparatoire, a été lancée par certains pays listés ci-après.

Les premiers contractants du réseau ERA-NET Materials sont:

» National Technology Agency, TEKES, Finlande,

» Academy of Finland, AKA, Finlande,

» Institute for the Promotion of Innovation by Science and Technology in Flanders, IWT, Belgique,

» Enterprise Ireland, EI, Irlande,

» Fonds National de la Recherche, FNR, Luxembourg,

» Research Council of Norway, RCN, Norvège,

» Ministry of Higher Education, Science and Technology, MHEST, Slovénie, et

» Latvian Council of Science, LCS, Lettonie.

Lors des réunions de travail en 2004, le groupe a continué d’intégrer d’autres pays dans le réseau afin

d’élargir les compétences et de promouvoir la coopération internationale dans ce domaine des matériaux

et a soumis un nouveau dossier MATERA lors de l’appel du 1 er octobre 2004 de la Commission Européenne.

Era-Net

123


» Ministry of the Walloon Region, DGTRE, Wallonie/Belgique,

» Icelandic Centre for Research, RANNIS, Islande,

» Ministry of Economic Affairs and Labour, MWA-NRW Rhénanie-Palatinat/Allemagne,

» Ministry for University, Education and Science, MIUR, Italie,

» Invest Northern Ireland, Invest NI, Grande-Bretagne/Irlande du Nord,

» Innovation Promotion Agency KTI/CTI, Suisse,

» Ministry of Scientific Research and Information Technology MSRIT/MNII, Pologne.

La phase préparatoire du projet a commencé avec 8 organisations participantes provenant de 7 pays

européens et s’est élargie vers un projet regroupant 15 organisations de 13 pays. Le projet a aussi une

collaboration vitale avec d’autres projets ERA-NET dans le domaine des matériaux. Le projet MATERA

pourra être élargi par d’autres organisations promouvant des activités dans le domaine des matériaux au

niveau national, régional et international.

A la fin du projet, il est prévu de lancer des activités transnationales dans le domaine de la science des

matériaux et de l’ingénierie. Les travaux du projet MATERA commenceront à partir du 1 er février 2005

pour une durée de 4 années. Il est prévu de lancer au cours du deuxième semestre 2005 un site internet

avec un espace public et un espace réservé aux partenaires afin de mieux coordonner les activités

et de faciliter l’échange de données et d’informations (www.matera.fi).

124

Era-Net

Extension du réseau:

ERA-NET Neuron – phase préparatoire (Specific support action)

Le ERA-NET NEURON a pour but de préparer un réseau qui unit des programmes de recherche européens

nationaux et régionaux dans le domaine des maladies en rapport avec les neurosciences. Les maladies

de troubles neurologiques affectent plus d’un milliard de personnes sur la terre. Les thèmes prioritaires

des programmes de recherche soutenus par les établissements impliqués dans ce projet sont la dégénérescence

neurologique et la réparation neurale.

Les 13 et 14 septembre 2004 a eu lieu à Berlin la réunion «Structuring European Neuroscience

Funding» qui avait pour but de disséminer les résultats obtenus lors du projet. Plus de quarante

participants de diverses institutions nationales se sont réunis pour discuter des défis futurs dans les

neurosciences. La réunion a également servi à finaliser la demande à la Commission européenne pour

fonctionner comme ERA-NET à part entière. A la fin du projet le réseau a trouvé une dizaine de

partenaires:

» Deutsches Zentrum für Luft- und Raumfahrt e.V., PT-DLR, Allemagne,

» Fonds National de la Recherche, FNR, Luxembourg,

» Ministry of Scientific Research and Information Technology, MSRIT, Pologne,

» Israel Ministry of Health, CSO-MOH, Israel,

» Austrian Science Fund, FWF, Autriche,

» Institut national de la santé et de la recherche médicale, INSERM, France,

» Academy of Science, AKA, Finland,

» Swedish Research Council, SRC, Suède,

» Medical Research Council, MRC, Grande Bretagne,

» Ministry of Education and Research, MER, Roumanie,

» Centre National de la recherché Scientifique, CNRS (France),

» Ministry of Health, Italie.

Malheureusement la demande n’a pas été retenue pour financement dans un premier temps, mais une

proposition retravaillée sera introduite au cous du premier trimestre 2005.


«ERA-AGE» European Research Area in Ageing Research (Coordinated Action)

Le réseau ERA-AGE est coordonné par le professeur Alan Walker de l’Université de Sheffield et comprend

14 partenaires européens. La durée du projet est de 60 mois, commençant le 1 er mars 2004 et

se terminant le 28 février 2009.

Les partenaires du réseau ERA-AGE sont:

» University of Sheffield, Royaume-Uni,

» Austrian Academy of Sciences, Autriche,

» Academy of Finland, Finlande,

» Direction des Recherches sur le vieillissement de la Caisse Nationale d’Assurance Vieillesse, France,

» Fonds National de la Recherche, Luxembourg,

» The Netherlands Organisation for Health Research and Development, Pays-Bas,

» The Research Council of Norway, Norvège,

» Executive Agency for Higher Education and Research Funding, Roumanie,

» The Swedish Council for Working Life and Social Research, Suède,

» Projektträger Deutsches Zentrum für Luft- und Raumfahrt e.V., Allemagne,

» The Medical Research Administration, The Chief Scientist Office, Israeli Ministry of Health, Israel,

» Istituto Superiore di Sanita, Italie,

» Latvian Council of Sciences, Lettonie,

» Ministerio de Ciencia y Tecnología, Espagne.

Etant donné que tous les pays participant à ce réseau prennent conscience des transformations importantes

en cours résultant du vieillissement des populations dans les sociétés industrialisées, le but principal

du réseau ERA-AGE est:

» de recenser à un niveau européen les activités de recherche dans ce domaine fortement interdisciplinaire,

et

» d’envisager la collaboration entre les partenaires du réseau à travers le développement de futurs

programmes communs.

Dans un premier temps, les réunions du réseau se consacrent à la création d’une banque de données

des programmes pluriannuels et d’autres activités importantes existant dans les pays participants, en

dénichant des exemples de bonnes pratiques.

Il est envisagé de développer des programmes de recherche en commun, pour lesquels les partenaires

trouveront un financement futur à travers leurs propres ressources ou en collaboration avec des partenaires

nationaux intéressés.

Par ailleurs, chaque partenaire du réseau s’engage à organiser des forums nationaux entre institutions

qui financent des activités dans le domaine de la recherche sur le vieillissement, afin d’échanger des

informations à un niveau national et international en vue d’une meilleure coordination des activités.

Le premier forum national au Luxembourg sera organisé par le Fonds le 4 octobre 2005, en collaboration

avec l’Université du Luxembourg. Outre les institutions finançant la recherche, le forum au

Luxembourg invitera les acteurs importants dans le domaine du vieillissement, les ministères concernés,

les associations, les chercheurs, etc.

Le projet envisage la publication régulière d’une Newsletter.

A partir de 2005, des informations détaillées concernant le projet seront disponibles sur le site

www.shef.ac.uk/era-age/.

Era-Net

125


126


Autres Collaborations

internationales

Collaboration avec la National Science Foundation des Etats-Unis

Le Fonds est partenaire dans un réseau de collaboration dans le domaine de la recherche des matériaux

coordonné par la National Science Foundation (NSF, www.nsf.org) depuis 2003 et a participé à l’appel

à propositions de projets communs en octobre 2004. La NSF lance régulièrement des appels à propositions

communes entre les Etats-Unis et les pays membres européens.

Deux propositions de projets avec une participation luxembourgeoise ont été soumises. L’évaluation

de la partie luxembourgeoise sera réalisée début 2005 par les experts indépendants sélectionnés par

le Fonds, tandis que la partie américaine du projet sera évaluée par les experts choisis par la NSF.

Les résultats de l’évaluation seront communiqués en 2005.

International Council for Science (ICSU)

Fin 2004, le Fonds National de la Recherche a adhéré à l’ICSU (International Council for Science,

www.icsu.org), une organisation non gouvernementale fondée en 1931 qui regroupe plus de 100

conseils de recherche scientifique et d’académies scientifiques à travers le monde entier. Le but de l’organisation

est de promouvoir l’activité scientifique internationale dans tous les domaines de la recherche

et d’adresser les sujets d’importance majeure pour la science et la société. L’adhésion permettra de

nouer des contacts intéressants avec des partenaires internationaux.

European Union Research Organisations’ Head of Research Councils

(EUROHORCS)

EUROHORCs (www.eurohorcs.org) a été créé en 1992 en tant qu’association informelle de conseils de

recherche nationaux et d’organisations non universitaires de recherche publiques analogues des

Etats-membres de l’Union Européenne. EUROHORCs constitue un forum et un réseau indépendant réunissant

les présidents de telles organisations afin de discuter des sujets d’un intérêt commun et afin de

renforcer l’influence d’organisations nationales de recherche et de la Communauté Européenne sur la

politique de recherche en Europe et sur le développement de l’Espace Européen de la Recherche. Monsieur

Jean-Frank Wagner, président du Conseil Scientifique, a représenté le Fonds National de la Recherche

au cours des réunions semestrielles d’EUROHORCS sur la coopération internationale. Le 21 mai 2004,

le Fonds a organisé l’assemblée EUROHORCS à Luxembourg. La deuxième réunion semestrielle a eu lieu

le 22 octobre 2004 à Lisbonne.

Réunion annuelle des conseils consultatifs pour la recherche et la technologie

Le Fonds National de la Recherche a organisé le 17 et 18 juin 2004 la réunion annuelle des Présidents

et Secrétaires Généraux des conseils consultatifs pour la Recherche et la Technologie des pays de l’Union

Européenne à Luxembourg. Le thème de cette réunion a été “More Research for Europe, towards 3%

of the GDP: measures undertaken in the EU member countries to reach the objective”. Les représentants

venant d’Allemagne, d’Autriche, de Belgique, du Danemark, de l’Espagne, de l’Estonie, de la Finlande,

de France, de l’Irlande, de la Lettonie, des Pays-Bas, de la République Slovaque, de la République

Tchèque, du Royaume-Uni et de la Slovénie ont dans un premier temps présenté les activités de leurs

conseils et ont ensuite discuté des mesures à prendre pour atteindre les objectifs de Barcelone.

Autres Collaborations internationales

127


Journée de rencontre sur la recherche biomédicale

En collaboration avec le CRP Santé, le Fonds National de la Recherche a organisé le 1 er décembre 2004

une journée de rencontre sur le thème de la recherche biomédicale réunissant une centaine de chercheurs

du Luxembourg et de la région lorraine. Cette journée a été destinée à nouer des contacts et échanges

entre les chercheurs et devrait ainsi permettre de cibler les thématiques d’intérêt commun pour éventuellement

établir des collaborations transfrontalières. Des sessions de rencontre simultanées selon 8

thématiques particulières ont été tenues: Cardiologie, Cancérologie, Santé publique, Neurologie/Psychiatrie,

Génétique/Biologie moléculaire, Toxicologie, Immunologie et Maladies Infectieuses, Transfert de technologies

et Economie en Santé. Suite à cette journée, plusieurs groupes de recherche ont fait savoir

leur intérêt pour développer des projets en communs.

Participation au cluster européen ‘Science Festivals’ mis en place par le CREST

Le Fonds a participé au Cluster ‘Science Festivals’ dans le cadre des activités du CREST de l’Union Européenne.

Ce cluster, coordonné par le Ministère de la Recherche français, réunit une quinzaine d’organisateurs

de festivals de sciences dans les pays membres de l’Union Européenne afin de discuter des activités

communes au niveau de la ‘European Science Week’ et afin de s’échanger sur les expériences

nationales d’organisation de festivals. La participation à ce cluster a engendré la participation de cinq

associations françaises de promotion de la culture scientifique au ‘Science Festival 2005’ qui aura lieu

du 22 au 30 octobre 2005 au Luxembourg. De même, une collaboration avec ‘Scienca Viva’ au Portugal

a été nouée pour inviter des chercheurs portugais à présenter leurs travaux et leurs carrières scientifiques

dans certaines écoles luxembourgeoises caractérisées par un pourcentage élevé d’écoliers d’origine portugaise,

ceci dans le cadre de la campagne ‘Firwat net Fuerscher’ organisée pendant les mois de juin

à novembre 2005 sous la coordination du Musée National d’Histoire Naturelle, dans le cadre de l’initiative

‘chercheur’ de la Commission Européenne.

Accord de coopération avec la Wallonie

Désirant contribuer au développement et à l'intensification de la coopération scientifique et, par cela

même, à la consolidation des liens traditionnels unissant la Wallonie et le Luxembourg, le Fonds National

de la Recherche Scientifique (FNRS) et le Fonds National de la Recherche (FNR) ont signé un accord de

coopération scientifique le 21 mai 2004.

Madame Simoens du FNRS; Monsieur Bausch du FNR

128

Autres Collaborations internationales


Prix interregional de la recherche

Tout comme en 2003, le Fonds National de la Recherche a participé en 2004 au jury du prix interrégional

de la recherche destiné à stimuler le réseau et la coopération des établissements d’enseignement supérieur

et des organismes de recherche au sein de la Grande Région. Parmi les douze candidatures reçues, sept

propositions ont inclu des collaborations avec le Luxembourg.

Le prix d’un montant de 5000 € a été attribué au réseau «Matériaux nanostructurés, micro-nanotechnologies:

des recherches de pointe en Grande Région» et sera remis dans le cadre du 8 e sommet de

la Grande Région le 25 janvier 2005 à Metz. Le réseau concerne une collaboration entre le Professeur

Patrick Alnot de l’Université Henri Poincaré de Nancy, le Professeur Jan Kristian Krueger de l’Université

de Sarre, et le Professeur Roland Sanctuary de l’Université du Luxembourg. Il a été recommandé

au réseau de collaborer étroitement avec le réseau «Le NanoSIMS 50 au centre de la Grande Région»

coordonné par le Dr Henri-Noël Migeon du CRP Gabriel Lippmann, Luxembourg, et qui est soutenu

par la Commission Européenne en tant que réseau d’excellence dans le domaine des nano-analyses de

matériaux.

Collaboration R&D avec la Suisse et le Japon

En 2004, le Fonds a commencé à nouer des contacts avec la Japan Society for the Promotion of

Science, la Japan Science and Technology Corporation et l’Ambassade du Japon au Luxembourg, en vue de

présenter la recherche japonaise le 22 octobre 2005 à l’occasion de l’ouverture du Science Festival 2005.

Les possibilités de collaboration scientifique avec la Suisse ont également été explorées et une présentation

du Fonds National de la Recherche Suisse est prévue en 2005 à Luxembourg.

European Space Agency (ESA);

European Molecular Biology Organisation (EMBO)

D’autres participations et collaborations internationales potentielles seront étudiées en concertation

avec le Ministère de la Recherche, telles que les opportunités qui résultent de la participation du

Luxembourg dans la European Space Agency (ESA) depuis fin 2004, et d’une participation éventuelle

à la European Molecular Biology Organisation (EMBO), prévue pour l’année 2005 par le Ministère de

la Recherche.

European Space Agency (ESA)

Autres Collaborations internationales

129


V. Autres activités en 2004

130

Autres activités en 2004


Réunion d’un panel d’experts le 10 décembre 2004

Le 10 décembre 2004, le Fonds National de la

Recherche a réuni un panel d’experts afin de discuter

des meilleures procédures pour déterminer

les futurs programmes pluriannuels de recherche.

Les recommandations des experts aideront le

Fonds à orienter son choix pour définir en 2005

les futurs programmes pluriannuels de recherche.

Mise en place d’un système de gestion

Afin d’optimiser le travail du secrétariat, le Fonds a étudié la mise en place d’une plateforme de gestion

pour ses activités administratives. Après qu’un cahier de a été rédigé avec l’aide d’experts du Centre

de Recherche Public Gabriel Lippmann et du Centre de Recherche Public Henri Tudor, le Fonds a

démarré fin 2004 le développement de cette plateforme de gestion.

Présentation des résultats de recherche

Le 19 mai 2004, le rapport annuel de l’année 2003 du Fonds National de la Recherche a été présenté.

Les résultats de recherche réalisés dans le cadre des programmes pluriannuels en cours ont été présentés

au nouveau siège du Fonds à la Chambre de Commerce au Kirchberg par les responsables de

projets de recherche des programmes SECOM, NANO, EAU, BIOSAN et VIVRE, en présence d’une centaine

de chercheurs et d’invités du monde politique, économique, et social.

Participation aux ‘Science Days’ Europapark Rust en Allemagne

Du 14 au 16 octobre 2004, les Science Days ont eu lieu à l’Europapark Rust en Allemagne. Le Fonds

a visité les activités durant la journée du vendredi 15 octobre 2004, et en particulier l’atelier MADLAB

organisé par M. Robert Dondelinger, professeur du lycée technique d’Ettelbruck dont la participation

à ce festival a été financée par le Fonds.

Participation du Luxembourg au Daejeon Science Festival en Corée du Sud

Grâce à un co-financement du Fonds National

de la Recherche, le Grand-Duché de Luxembourg

a participé au Science Festival en Corée

du Sud qui a eu lieu du 30 juillet au 9 août

2004. Sur invitation de l'association européenne

des événements scientifiques, EUSCEA,

Monsieur Robert Dondelinger, professeur de

physique au lycée technique d'Ettelbruck, a participé

à ce festival avec l'atelier MADLAB qui a déjà connu un grand succès lors des festivals des sciences

au Luxembourg en 1995, 1997, 2000 et 2003.

Autres activités en 2004

131


Initiative Chercheur en Europe 2005: Campagne «Firwat nët Fuerscher?»

Dans le cadre d’un appel à propositions du 6 e programme-cadre de la Commission Européenne, le

Fonds a participé à une proposition visant une campagne nationale pour promouvoir la profession du

chercheur auprès des jeunes et du grand public. La proposition a été soumise par le Musée National

d’Histoire Naturelle le 2 décembre 2004, et elle a été retenue pour un soutien financier à hauteur de

92.000 € par la Commission européenne.

La campagne aura lieu du 8 juin au 30 novembre 2005 et rassemble différents partenaires: le Musée

National d’Histoire Naturelle, l’Association Jeunes Scientifiques, le Ministère de la Culture, de l’Enseignement

supérieur et de la Recherche, le Ministère de l’Education Nationale, l’Université du Luxembourg, le Laboratoire

National de Santé, Luxinnovation et le Fonds National de la Recherche.

Les activités suivantes auront lieu au Luxembourg, chaque volet étant coordonné par un des partenaires

de la proposition:

» lancement de la campagne européenne et nationale, le 8 juin 2005,

» enquête qualitative auprès des jeunes pour mieux comprendre leurs choix de matières et leur orientation

professionnelle,

» rédaction d’un guide du jeune chercheur (profession: chercheur) destiné aux 16 à 25 ans,

» série de brefs reportages de 2 à 3 minutes sur la profession du chercheur en collaboration avec RTL

durant le mois d’octobre (période du Science Festival),

» supplément trimestriel au Wort (tirés à part de 4 pages) et supplément annuel au Lëtzebuerger Land,

» édition spéciale du Pannewippchen, journal bimestriel du Musée s’adressant aux enfants entre 6 à 12 ans,

» développement d’un site www.fuerscher.lu; www.science.lu ou www.science-for-all.lu, et

» 7 au 30 novembre 2005 : les chercheurs se rendent dans les écoles; pour tenir des cours en relation

avec le programme scolaire; visites supplémentaires de laboratoires; série de conférences de chercheurs

portugais dans les écoles avec des pourcentages élevés d’enfants d’origine portugaise.

Rencontre avec Monsieur Tarrach, nouveau recteur de l’Université

Le 6 décembre 2004, une première réunion d’information entre Monsieur Tarrach, le nouveau recteur

de l’Université du Luxembourg (UL), Messieurs Decker et Dondelinger du Ministère de la Culture de l’enseignement

supérieur et de la Recherche et Messieurs Henrion, Wagner et Bausch du Fonds a eu lieu

dans les locaux du Fonds. Lors de cette rencontre, les activités du Fonds ont été présentées. Il a été

souligné qu’il est important d’entretenir un échange régulier entre les acteurs et de promouvoir la coopération

entre l’UL et le Fonds.

132

Autres activités en 2004


Déménagement du Fonds

Le 17 février 2004 le Fonds a déménagé au bâtiment Antoine de Saint-Exupéry du complexe administratif

de la Chambre de Commerce à l’adresse suivante:

Fonds National de la Recherche

6, rue Antoine de Saint-Exupéry, B.P. 1777

L-1017 Luxembourg

tél:+352 261925-1; fax:+352 261925-35

e-mail: fnr@fnr.lu; site: www.fnr.lu

Autres activités en 2004

133


VI.Activités prévues en 2005

134

Activités prévues en 2005


2 e appel à propositions du programme NANO

Dans le cadre du programme NANO, qui a commencé en 2001, le Fonds lancera un deuxième appel à

propositions de projets de recherche en 2005 avec un budget de 700.000 €. Le délai de soumission

sera publié sue le site Internet du Fonds et le dossier de soumission pourra être téléchargé sur le site

www.fnr.lu.

Participation au EUROCORES ESF «Social Sciences»

Le Fonds a décidé de participer au programme EUROCORES ‘European Collaborative Research Projects in

the Social Sciences’ de la ESF à travers le programme VIVRE, afin de promouvoir les collaborations

internationales en sciences sociales.

La participation des chercheurs luxembourgeois à cet appel implique la soumission en commun d'un

projet de recherche avec au moins trois partenaires de trois pays membres différents de la ESF. L'appel

n'a pas de limitations thématiques; il est ouvert à tous les domaines en sciences sociales. Cependant,

la participation de chercheurs luxembourgeois est liée à la condition de choisir un thème défini par le

programme «Vivre demain au Luxembourg».

Le délai de soumission des propositions est fixé au 1 er juin 2005, les projets qui seront sélectionnés

pourront démarrer au plus tôt le 1 er janvier 2006. Le dossier de l’appel peut être téléchargé du site de

la ESF www.esf.org (voir ECRP 2005 Call for Proposals).

Lancement d’un nouvel appel général du programme VIVRE fin 2005

Le prochain appel général du programme 'VIVRE demain au Luxembourg' a été reporté à la fin de l'année

2005. Il a été jugé essentiel d'attendre la mise en place des nouvelles priorités de recherche de l'Université

du Luxembourg avant de lancer cet appel.

Etant donné que la production de données et le développement de banques de données sont largement

dominants parmi les projets du 1 er appel VIVRE actuellement en cours, le prochain appel général visera

des projets de recherche et analyses plus fondamentaux concernant des thèmes d'une importance socioéconomique

pour le Luxembourg. Les projets devront avoir une orientation pluridisciplinaire et pluriéquipe,

y compris des collaborations internationales. Un critère essentiel sera également la création de

nouvelles compétences dans les domaines du programme VIVRE, à travers l’engagement de chercheurs

ayant une expérience de plusieurs années de post-doctorat, d’un côté, et à travers l’engagement de

jeunes boursiers doctorants, de l’autre.

Le calendrier provisoire pour cet appel VIVRE est le suivant:

1 er décembre 2005 » lancement de l'appel à propositions.

1 er mai 2006 » délai de soumission des propositions.

1 er octobre 2006 » résultats de l'évaluation.

mi-octobre ou début décembre 2006 » décision FNR.

1 er janvier 2007 » démarrage des projets retenus.

Activités prévues en 2005

135


Exposition à Bruxelles «La Recherche au Grand-Duché de Luxembourg» en 2005

Dans le cadre de la présidence du Luxembourg de l’Union Européenne (1 er janvier 2005 – 30 Juin

2005), le Ministère de la Recherche et le Fonds souhaitent profiter de cette mise en lumière pour présenter

les centres et activités de recherche du Luxembourg. En collaboration avec le Ministère de la Culture, de

l’Enseignement supérieur et de la Recherche, le Ministère de l’Economie et Luxinnovation, le Fonds

National de la Recherche organise une exposition sur la recherche au Luxembourg qui sera inaugurée

le 17 mars 2005 à Bruxelles.

L’exposition présentera par le biais d’une trentaine de panneaux et une vingtaine de vitrines

» les principaux acteurs de la recherche publique,

» des entreprises actives dans le domaine de la recherche,

» des projets de recherche et produits innovants développés au Luxembourg,

» les programmes, instruments et réseaux de soutien à la recherche et à l’innovation disponibles au Luxembourg,

» ainsi que le Luxembourg comme terre d’entreprenariat et de technologies.

Mise en place d’un système de gestion à partir de 2005

Afin d’optimiser le travail du secrétariat, le Fonds National de la Recherche a préparé en 2004 la mise

en place d’une plateforme de gestion pour ses activités administratives. Les travaux se poursuivront

en 2005 afin que le système soit opérationnel fin 2005.

Programme INTER

Le Fonds a décidé de proposer un futur programme au Gouvernement destiné à renforcer la collaboration

internationale dans les domaines de recherche apparentés aux programmes pluriannuels du Fonds. Ce

programme, qui sera soumis au Gouvernement en 2005, a été élaboré par le Conseil Scientifique et le

Conseil d’Administration du Fonds comme suite directe des recommandations des experts des cinq comités

de pilotage des programmes qui ont été unanimes à soutenir l’importance des collaborations internationales

pour améliorer la qualité de la recherche au Luxembourg. Le programme ne visera pas la participation

à des projets individuels au niveau international, mais uniquement la participation à des programmes

internationaux qui sont développés en commun avec d’autres Fonds ou Conseils de recherche à l’étranger,

ou des programmes qui existent déjà au niveau international et auxquels le Fonds pourra décider de

participer. Jusqu’à présent, les participations internationales du Fonds se sont limitées pour la plupart

aux remboursements de frais de voyage ou à des services de tiers très précis et restreints. Disposer d’un

programme de collaboration internationale permettra au Luxembourg de participer à plus courte

échéance à des programmes et opportunités qui se présentent dans les domaines reconnus comme

prioritaires.

Appel à propositions pour les futurs programmes pluriannuels

Afin d’envisager les meilleures thématiques pour les nouveaux programmes pluriannuels de recherche,

le Fonds prévoit de lancer un nouvel appel à propositions pour de futurs programmes. Il s’agit aussi

bien de nouvelles propositions que de possibles extensions de programmes en cours. Les propositions qui

seront envoyées au Fonds dans le cadre de cet appel seront ensuite discutées avec tous les partenaires potentiels,

les Ministères concernés, les représentants politiques, les organismes de recherche y compris

l’Université du Luxembourg, les représentants des entreprises, et les différents acteurs concernés par les domaines

thématiques respectifs. Il est également envisagé de commencer une étude ‘foresight’ pour définir

les priorités de recherche du Fonds pour les années à venir et pour impliquer les différents acteurs

le mieux possible dans un dialogue sur l’utilisation des résultats de recherche, afin d’augmenter

l’impact des activités de recherche à long terme.

136

Activités prévues en 2005


Science Festival 2005

En collaboration avec le Musée National d’Histoire Naturelle, le Fonds a lancé un appel fin 2004 pour

soutenir des activités très diverses (ateliers, conférences, expositions, shows et bus scientifiques etc.)

dans le cadre du Science Festival qui aura lieu du 22 au 30 octobre 2005 au Centre Culturel de Rencontre

Abbaye de Neumünster et au Naturmusée à Luxembourg-Grund.

Plus d’une centaine de propositions ont été reçues au délai du 15 janvier 2005, dont la plupart ont

pu être retenues pour le programme du Festival. Celui-ci promet de devenir très riche avec une grande

variété d’activités pour toutes les catégories d’âge. Le programme sera annoncé dès l’été sur le site du

Festival www.science-festival.lu.

Le Science Festival 2005 reprend deux initiatives internationales pour les inclure dans le programme

prévu, à savoir l’année internationale de la physique (voir www.physics2005.org), d’une part, et ‘2005

année des échanges entre les peuples de l’UE et du Japon’ d’autre part. Ainsi une partie des activités

est réservée à ces deux thèmes, sans que le programme soit pour autant limité à ces actions.

Comme en 2003, les entreprises privées feront également partie du programme en présentant leurs recherches

et l’importance des innovations de l’industrie dans la vie de tous les jours.

Activités prévues en 2005

137


VII.Bilan financier 2004

138

Bilan financier 2004


Au Conseil d'Administration du

FONDS NATIONAL DE LA RECHERCHE

Etablissement Public

Luxembourg

» RAPPORT DE REVISION

Conformément au mandat donné en Conseil de Gouvernement en sa séance du 6 juin 2003, nous

avons contrôlé les comptes annuels ci-joints du FONDS NATIONAL DE LA RECHERCHE pour l’exercice

clôturé au 31 décembre 2004. Les comptes annuels relèvent de la responsabilité du Conseil d’Administration.

Notre responsabilité est, sur base de nos travaux de révision, d’exprimer une opinion sur ces comptes

annuels.

Nous avons effectué nos travaux de révision selon les normes internationales de révision. Ces normes

requièrent que nos travaux de révision soient planifiés et exécutés de façon à obtenir une assurance

raisonnable que les comptes annuels ne comportent pas d’anomalies significatives. Une mission de révision

consiste à examiner, sur base de sondages, les éléments probants justifiant les montants et informations

contenus dans les comptes annuels. Elle consiste également à apprécier les principes et méthodes

comptables suivis et les estimations significatives faites par le Conseil d’Administration pour l’arrêté

des comptes annuels, ainsi qu’à effectuer une revue de leur présentation d’ensemble. Nous estimons

que nos travaux de révision forment une base raisonnable à l‘expression de notre opinion.

A notre avis, les comptes annuels ci-joints donnent, en conformité avec les prescriptions légales et réglementaires

en vigueur au Luxembourg, une image fidèle du patrimoine et de la situation financière du

FONDS NATIONAL DE LA RECHERCHE au 31 décembre 2004 ainsi que des résultats de l’exercice se

terminant à cette date.

H.R.T. REVISION S.à.r.l.

Dominique RANSQUIN

Luxembourg, le 10 mars 2005

Bilan financier 2004

139


»

BILAN

31 décembre 2004

ACTIF 2004 2003

ACTIF IMMOBILISE

Immobilisations incorporelles (note 3) 982,61 € 3.303,37 €

Immobilisations corporelles (note 4) 50.076,40 € 38.971,94 €

TOTAL ACTIF IMMOBILISE 51.059,01 € 42.275,31 €

ACTIF CIRCULANT

Autres créances 37.559,39 € 21.352,54 €

Avoirs en banques, en comptes de chèques postaux, 17.074.965,24 € 11.139.862,01 €

chèques et encaisse

TOTAL ACTIF CIRCULANT 17.112.524,63 € 11.161.214,55 €

COMPTES DE REGULARISATION 38.154,67 € 21.706,44 €

17.201.738,31 € 11.225.196,30 €

Les notes renvoient à l’annexe.

PASSIF 2004 2003

CAPITAUX PROPRES

Fonds de réserve (note 5) 2.087.569,15 € 1.428.312,36 €

Excédent (déficit) de l’exercice (202.661,16) € 659.256,79 €

1.884.907,99 € 2.087.569,15 €

DETTES

Dettes sur achats et prestations de services 64.000,32 € 63.160,71 €

Dettes fiscales et au titre de la sécurité sociale 15.458,75 € 19.694,26 €

Autres dettes 213.379,39 € 790.717,72 €

TOTAL DETTES 292.838,46 € 873.572,69 €

COMPTES DE REGULARISATION

Contributions et fonds différés (note 6) 15.023.991,86 € 8.264.054,46 €

17.201.738,31 € 11.225.196,30 €

Les notes renvoient à l’annexe.

140

Bilan financier 2004


»

COMPTE DE PROFITS ET PERTES

Pour l’exercice clôturé au 31 décembre 2004

2004 2003

Contributions et fonds (note 6) 415.000,00 € 1.083.900,00 €

Autres charges externes (608.144,77) € (403.364,79) €

Frais de personnel (note 8) (353.497,62) € (290.702,80) €

Corrections de valeur sur immobilisations corporelles et incorporelles (notes 3 et 4) (29.133,10) € (19.874,38) €

RÉSULTAT D’EXPLOITATION (575.775,49) € 369.958,03 €

Autres intérêts et produits assimilés 374.474,20 € 291.381,67 €

Intérêts et charges assimilées (1.937,40) € (2.082,91) €

Résultat financier 372.536,80 € 289.298,76 €

RÉSULTAT PROVENANT DES ACTIVITÉS ORDINAIRES (203.238,69) € 659.256,79 €

Produits exceptionnels 577,53 € -

EXCEDENT / (DEFICIT) DE L’EXERCICE (202.661,16) € 659.256,79 €

Les notes renvoient à l’annexe.

»

ANNEXE

31 décembre 2004

NOTE 1 - GENERALITES

Le Fonds National de la Recherche (ci-après le «Fonds») est un établissement public créé par la loi du

31 mai 1999.

Le Fonds a pour mission:

» de recevoir, de gérer et d’employer des allocations et dons provenant de sources publiques ou privées

en vue de la promotion sur le plan national de la recherche et du développement technologique

dans le secteur public, appelés par la suite «R&D», ainsi que

» d’entretenir un processus de réflexion continu en vue de l’orientation de la politique nationale de

R&D, en fonction des données économiques et de l’évolution scientifique et technologique ainsi

que sur base d’études approfondies.

Bilan financier 2004

141


Le Fonds est administré par un Conseil d’Administration composé de représentants des ministères ainsi

que de représentants du secteur privé, sous la tutelle du Ministre ayant dans ses attributions la recherche

scientifique et la recherche appliquée.

Le Conseil d’Administration est assisté du Conseil Scientifique qui est son organe consultatif en matière

scientifique.

Le siège du Fonds est situé au 20, Montée de la Pétrusse à L-2912 Luxembourg jusqu’au 15 février

2004 et au 6, rue Antoine de Saint-Exupéry à L-1017 Luxembourg-Kirchberg à partir du 16 février 2004.

Les comptes du Fonds sont tenus selon les principes et modalités de la comptabilité commerciale.

NOTE 2 - PRINCIPES, REGLES ET METHODES COMPTABLES

» Principes généraux

Les comptes annuels sont établis conformément aux dispositions légales et réglementaires luxembourgeoises

et aux principes comptables généralement admis.

Les principales méthodes utilisées pour l’établissement des comptes annuels en conformité avec ces

principes sont décrites ci-dessous.

» Conversion des devises

La société tient sa comptabilité en € et le bilan et le compte de profits et pertes sont exprimés dans

cette devise. Les actifs et passifs exprimés dans une autre devise sont évalués au cours de change en

vigueur à la date de clôture du bilan.

» Immobilisations incorporelles

Les immobilisations incorporelles sont enregistrées à leur prix d’acquisition, déduction faite des corrections

de valeur. Les corrections de valeur sont calculées de façon linéaire sur une période de 3 ans.

» Immobilisations corporelles

Les immobilisations corporelles sont comptabilisées au prix d’acquisition et sont montrées au bilan

nettes des corrections de valeur cumulées y relatives. Les corrections de valeur sont calculées de façon

linéaire sur base de la durée de vie estimée des éléments individuels qui constituent l’immobilisation.

» Créances et dettes

Les créances sont inscrites au bilan au plus bas de leur valeur nominale ou de leur valeur estimée de

réalisation. Une correction de valeur est pratiquée lorsque la valeur estimée de réalisation est inférieure

à la valeur nominale. Les dettes sont inscrites au bilan à leur valeur nominale.

» Capitaux propres

Le Fonds n’a pas été doté de fonds propres lors de sa constitution. Les fonds propres seront constitués

par les excédents d’exploitation annuels, dans la mesure où le Conseil d’Administration décide de les

affecter à ce poste.

142

Bilan financier 2004


» Compte de régularisation passif – Contributions et fonds différés

Les allocations reçues de l’Etat luxembourgeois par le Fonds conformément à la mission qui lui a été

confiée par la loi du 31 mai 1999 sont comptabilisées en comptes de régularisation – passif. Seules

les allocations de fonctionnement sont prises en résultat, les allocations destinées aux programmes de

recherche et aux mesures d’accompagnement étant versées aux bénéficiaires sur base des échéances

prévues dans les contrats

NOTE 3 – IMMOBILISATIONS INCORPORELLES

Concessions, brevets etc.

PRIX D’ACQUISITION

Au 1.1.2004 9.114,86 €

Acquisitions de l’exercice -

Au 31.12.2004 9.114,86 €

CORRECTIONS DE VALEUR

Au 1.1.2004 (5.811,49) €

Dotations de l’exercice (2.320,76) €

Au 31.12.2004 (8.132,25) €

VALEUR NETTE AU 31.12.2004 982,61 €

NOTE 4 – IMMOBILISATIONS CORPORELLES

Autres installations, outillage et mobilier

PRIX D’ACQUISITION

Au 1.1.2004 73.471,73 €

Acquisitions de l’exercice 37.916,80 €

Au 31.12.2004 111.388,53 €

CORRECTIONS DE VALEUR

Au 1.1.2004 (34.499,79) €

Dotations de l’exercice (26.812,34) €

Au 31.12.2004 (61.312,13) €

VALEUR NETTE AU 31.12.2004 50.076,40 €

Bilan financier 2004

143


NOTE 5 – FONDS DE RESERVE

Au 1.1.2004 1.428.312,36 €

MOUVEMENTS DE L’EXERCICE

Affectation de l’excédent de 2003 selon CA du 19/03/2004 659.256,79 €

Au 31.12.2004 2.087.569,15 €

NOTE 6 – COMPTES DE REGULARISATION PASSIF

Au courant de l’année 2004, le Fonds a reçu un montant de € 11.165.000 (2003: € 7.833.900,00)

en tant que dotation pour l’année 2004. Compte tenu du report de l’année passée de € 22.583.900,00,

le montant disponible s’élève à € 33.748.900,00 et concerne les programmes, les mesures d’accompagnement

et autres affectations suivants:

2004 2003

Programme commerce électronique (SECOM) 5.400.000,00 € 4.900.000,00 €

Programme Nanotechnologies et matériaux innovateurs 5.050.000,00 € 4.750.000,00 €

Programme EAU 3.900.000,00 € 2.900.000,00 €

Programme Santé et Biotechnologie 5.250.000,00 € 3.000.000,00 €

Programme VIVRE 5.250.000,00 € 2.750.000,00 €

Programme TRASU 2.000.000,00 € -

Programme SECAL 1.500.000,00 € -

Mesures d’accompagnement 2.300.000,00 € 1.600.000,00 €

Frais de fonctionnement 3.098.900,00 € 2.683.900,00 €

33.748.900,00 € 22.583.900,00 €

Les fonds disponibles ont été alloués de la façon suivante:

Contributions et fonds différés

Au 1.1.2004 8.264.054,46 €

Mouvements de l’exercice

Fonds reçus 11.165.000,00 €

Dotations aux programmes de recherche (3.418.834,00) €

Dotations aux mesures d’accompagnement (571.228,60) €

Dotations de fonctionnement (415.000,00) €

Au 31.12.2004 15.023.991,86 €

Les dotations aux programmes de recherche et aux mesures d’accompagnement tiennent compte des

montants encore à verser au 31.12.2004 à certains bénéficiaires pour un montant total de € 37.723,00

(2003: 648.820,83). Ce montant est repris dans le poste «autres dettes».

144

Bilan financier 2004


NOTE 7 – IMPÔTS

Selon les dispositions de l’article 16 de la loi du 31 mai 1999 le Fonds est affranchi de tous impôts et

taxes au profit de l’Etat à l’exception de la taxe sur la valeur ajoutée et des taxes rémunératoires.

NOTE 8 – PERSONNEL

2004 2003

Nombre de personnes occupées en moyenne au cours de l’exercice 7 6

Bilan financier 2004

145


FONDS NATIONAL

DE LA RECHERCHE

www.fnr.lu


Impression – imprimerie saint-paul luxembourg

Création graphique – Marc Pieper

Ce rapport est également disponible sur le réseau Internet à l’adresse : www.fnr.lu

© fonds national de la recherche 2005

The annual report is available in a summarized printed English version upon request at fnr@fnr.lu,

or may be downloaded from www.fnr.lu


www.fnr.lu

© fonds national de la recherche 2005

More magazines by this user
Similar magazines