Kallelse med handlingar 20130227.pdf - Trosa kommun

trosa.se

Kallelse med handlingar 20130227.pdf - Trosa kommun

Kallelsetill sammanträde medkommunstyrelsens2013-02-19Tid: Onsdagen den 27 februari, kl. 18.00Plats:Barken, Bomans hotell, TrosaKaffe och smörgås serveras vid gruppmötenaGruppmöte majoritet: kl. 17.30Gruppmöte Socialdemokraterna, Miljöpartiet ochTrosa Radikaler: kl. 17.30Ärenden:DiarienrTill kommunstyrelsen1. Information från kollektivtrafikmyndighetenom Trafikplan 2017 och den regionalatågtrafiken(Muntlig information från myndighetschef Helena Ekrothoch kollektivtrafikansvarig Lars Wogel)2. Anvisningar för budget 2014 KS 2013/20och planer 2015-2016Utskottsbeslut: i enlighet med förvaltningens förslag3. Remissvar avseende Finansdepartementets KS 2012/137promemoria ”Förslag till ändringar i inkomstutjämningenför kommuner och landsting”Utskottsbeslut: i enlighet med förvaltningens förslag4. Internkontrollplan för Kommunstyrelsen 2013 KS 2013/19Utskottsbeslut: i enlighet med förvaltningens förslag5. Utökade investeringsmedel för ökade KS 2013/21förutsättningar att snabbt klara ökat elevantalUtskottsbeslut: i enlighet med teknik- ochservicenämndens förslag


6. Köp av Hedebyscenen KS 2013/22Utskottsbeslut: i enlighet med teknik- ochservicenämndens förslag7. Beslut om tillfällig utökning av OSA- tjänster KS 2013/34(Tillkommande ärende)8. Exploateringsavtal för del av Hillesta 3:1 i KS 2013/24VästerljungUtskottsbeslut: i enlighet med förvaltningens förslag9. Exploateringsavtal för del av Tureholm 2:277 vid KS 2013/25Smedstorp i TrosaUtskottsbeslut: i enlighet med förvaltningens förslagTill kommunfullmäktige10. Förslag till detaljplan för del av Hillesta 3:1 KS 2013/26i VästerljungUtskottsbeslut: i enlighet med samhällsbyggnadsnämndensförslag11. Förslag till detaljplan för Tureholm 2:277 mfl KS 2013/27(Smedstorp) i TrosaUtskottsbeslut: i enlighet med samhällsbyggnadsnämndensförslag12. Antagande av utvidgat verksamhetsområde för KS 2013/28vatten och spillvatten, Hagstugan iTrosa kommunUtskottsbeslut: i enlighet med teknik- ochservicenämndens förslag13. Begäran om utökad investeringsram 2013 för KS 2013/23om - och tillbyggnad av SkärlagskolanUtskottsbeslut: i enlighet med teknik- ochservicenämndens förslag14. Bidrag 2013 till fristående skolor, enskilt drivna KS 2013/29förskolor, fritidshem och förskoleklasserUtskottsbeslut: i enlighet med humanistiska nämndensförslag15. Bidragsbelopp till fristående gymnasieskolor KS 2013/30enligt Gy 94 och Gy 11 från och med kalenderåret2013Utskottsbeslut: i enlighet med humanistiska nämndensordförandes förslag


16. Ansökan om indelningsändring avseende läns- KS 2012/124och landstingsbyte för Trosa kommunUtskottsbeslut: i enlighet med förvaltningens förslagDeltar ej i beslutet: Tommy Setzman (S) deltar ej ibeslutet.17. Folkomröstning om indelningsändring avseende KS 2013/31läns- och landstingsbyte för Trosa kommunUtskottsbeslut: i enlighet med Daniel Portnoffs (M) yrkandeYrkande: Daniel Portnoff (M) yrkar att kommunstyrelsensarbetsutskott föreslår kommunfullmäktige att enfolkomröstning genomförs i fråga om läns- och landstingsbyteför Trosa kommun.18. Ansökan om anslutning till finskt KS 2013/15förvaltningsområdeUtskottsbeslut: i enlighet med förvaltningens förslag19. Fördjupad analys och handlingsplan för en ökad KS 2011/75sysselsättningsgrad bland kommunensmedarbetareUtskottsbeslut: i enlighet med förvaltningens förslagDeltar ej i beslutet: Tommy Setzman (S) deltar ej ibeslutet.20. Revidering av arvodes- och ersättnings- KS 2012/107reglemente för kommunalt förtroendevalda iTrosa kommun - återremissUtskottsbeslut: kommunstyrelsens arbetsutskottbereder ärendet vidare till kommunstyrelsen utaneget ställningstagande.Övrigt21. Anmälan av delegationsbeslut KS 2013/122. Övriga anmälningsärenden KS 2013/2Daniel PortnoffordförandeJakob Etaatsekreterare


TjänsteskrivelseKommunstyrelsenDnr KS2013/NN2012-02-05EkonomienhetenMargareta SmithTel. 0156-520 11Fax. 0156-520 17margareta.smith@trosa.seAnvisningar för budget 2014 och planer 2015-2016Kommunstyrelsens arbetsutskott föreslår kommunstyrelsen beslutaatt godkänna förslag på budgetanvisningar för 2014 med planer 2015-2016.ÄrendetEkonomienheten har upprättat anvisningar för nämndernas arbete med budget2014 med planer 2015-2016.Liksom tidigare år bygger budgetförutsättningarna på en befolkningsprognos därdet klart framgår förväntat ökat eller minskat behov inom framförallt förskolaoch skola samt äldreomsorg. Den skatteprognos som ligger till grund förbudgetanvisningarna Är Sveriges Kommuners och Landstings prognos fråndecember 2012.De ökade skatteintäkterna, jämfört med budget 2013, tillsammans med 2014 årsföreslagna rationaliseringar, täcker beräknad kostnad för löne- och prisökningar.Margareta SmithEkonomichef


BudgetanvisningarBudget 2014Flerårsplan 2015 - 2016Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17E-post: trosa@trosa.sewww.trosa.se


Budgetprocess ....................................................................................... 1Ekonomistyrning och spelregler ................................................................ 1Budgetförutsättningar – ekonomiskt utrymme ............................................ 3Utgångspunkter för 2014 och 2015 ........................................................ 3Uppräkning av löner och priser .............................................................. 4Demografiska variabler ........................................................................ 4Rationaliseringar/nettokostnadsminskningar 2014 och 2015 ...................... 5Ettårssatsningar 2013 som tas bort 2014 ................................................ 5Utökningar av ram i budget 2013, tkr, som kvarstår och räknas upp medlöne- och prisökning ............................................................................ 5Budget/ramförändringar som kommer att justeras senare ......................... 7Sammanställning av ramförändringar per nämnd o utskott 2014 ................ 8Riktlinjer för budgetarbetet .................................................................... 10Mål och nyckeltal ................................................................................. 10Kvalitet ............................................................................................ 10Kommunalskatt och generella statsbidrag ................................................ 11Finansiella förutsättningar ..................................................................... 11Investeringsbudget anläggningar (tkr) .................................................... 12Investeringsbudget inventarier (tkr) ....................................................... 13Avskrivningar, ränta och kapitalkostnader ............................................. 14Anläggningstillgångar ......................................................................... 14Anvisningar och mallar .......................................................................... 14Tidsplan för budget 2014-2016 .............................................................. 15


BudgetprocessBudgetprocessen syftar till att ge kommunstyrelse och kommunfullmäktigetillräcklig information och bra beslutsunderlag inför beslut om budget 2014 ochflerårsplan 2015-2016 och de politiska prioriteringar som varje budgetbeslutinnebär. Processen syftar också till att ge goda förutsättningar förnämnder/utskott och kontor att planera och styra sin verksamhet mot fastställdamål och inom ramen för tillgängliga resurser.Från och med budget 2006 har gemensamma planeringsförutsättningar tagitsfram som underlag i budgetarbetet. Befolkningsprognoser, demografiskavariabler, visar förändringar av barn i förskole-, grundskole- och gymnasieåldersamt förändring av andelen äldre i befolkningen. De demografiskaförändringarna påverkar i första hand Humanistiska nämndens förskola och skolaoch Vård- och omsorgsnämndens äldreomsorg.Utbyggnad av gator och vägar påverkar kostnader för underhåll och drift, varfördessa också ingår i beräkning av ökade kostnadsramar.Antalet invånare för hela kommunen påverkar kommunens skatteintäkter.Ledningsgruppen träffades 27-28 november 2012 för att gå igenom degemensamma planeringsförutsättningarna inför budget 2014 med planer 2015-2016. Befolkningsprognoserna för 2012-2017 har anpassats efter förra åretsbefolkningsökning och planerade nya bostäder. År 2008 hade Trosa en storbefolkningsökning, vilket främst märktes på antalet barn i för- och grundskola.2009-2011 var befolkningsökningen klart modest och under 2012 ökadebefolkningen med totalt 39 invånare till och med november. Befolkningenminskade under våren för att sedan öka med 86 invånare juli-november.Ledningsgruppen har Kommunfullmäktiges uppdrag att ta fram förslag pårationaliseringsåtgärder varje år från och med budget 2008. För åren 2008-2009var uppdraget 5 miljoner kronor per år och från och med budget 2010 med 3miljoner per år. Rationaliseringarna för 2008-2012 är genomförda och de för2013 är beslutade och kommer att genomföras i år. Ledningsgruppens arbetssättär att ta fram förslag på 2 års rationaliseringar vartannat år. Ledningsgruppenlämnade ett enigt förslag på rationaliseringsåtgärder för 2014 och 2015 till denpolitiska majoriteten (ordförandegruppen) 24 januari 2013.Kommun- och ekonomichef redovisade de ekonomiska förutsättningarna förordförandegruppen 24-25 januari 2013 tillsammans med ledningsgruppen.Samma redovisning gjordes för oppositionen 5 februari.Politiska direktiv till budgetanvisningar för 2013 med flerårsplan lämnades avkommunalrådet 25 januari.Ekonomistyrning och spelreglerKommunfullmäktige antog i juni 2003 en ny ekonomistyrningsmodell för Trosakommun och dess bolag. Ekonomistyrningsprinciperna reviderades i november2007 för att börja gälla från 2008. Under 2009 har ekonomistyrprincipernarevideras avseende central buffert och omfattar nu även äldreomsorg.Resultatenheter har införts för särskilda boende och hemtjänst inom vård- ochomsorg. Mer medel började avsättas i central buffert från 2010.De revideringar av ekonomistyrningen som fullmäktige antog från 2008 varfrämst nödvändiga förändringar/förbättringar för att anpassa den till denpolitiska majoritetens förslag om att införa tydliga valfrihetssystem och riktigaresultatenheter.1


Ekonomistyrning i Trosa kommuns koncern innebär:En medveten och konsekvent process för att påverka organisationens handlandeså att verksamheten genomförs efter invånarnas faktiska behov med rätt kvalitetoch till rimlig kostnad, allt inom ramen för tilldelade resurser och fastställda mål.Följande grundläggande spelregler gäller i kommunen:Inga tilläggsanslag beviljas under budgetåret.Nämnderna ansvarar för att hålla verksamheten inom beslutad ram, drivaverksamheten enligt de mål/uppdrag fullmäktige lagt fast samt följa uppoch utvärdera verksamhetenOm förutsättningarna förändras under löpande budgetår ansvararnämnden för att anpassa och prioritera verksamheten inom gällande ram.Verksamhetsansvariga ansvarar för att hålla sin verksamhet inombeslutad budget, vidta åtgärder under löpande år för att uppnå detta,driva verksamheten enligt de mål/uppdrag nämnden lagt fast samt följaupp och utveckla verksamheten kontinuerligt.Verksamhetsansvarig är den som driver verksamhet och/eller sköterandra åtaganden och har budgeterade medel för detta. I Trosa ska ingabeslut som medför kostnader eller intäkter bokföras utan att ansvaranges.Resultatenhetsansvarig är den som driver verksamhet och erhållerfastställda intäkter i form av peng, check eller pris per utförd prestation.Det ekonomiska resultatet mäts som skillnad mellan intäkter ochkostnader. Över-/underskott överförs till nästkommande år. Det innebäratt åtgärder vidtas under löpande år för att uppnå ett positivt resultat, attverksamheten drivs enligt de mål/uppdrag nämnden lagt fast samt attuppföljning sker och att verksamheten utvecklas kontinuerligt.Fastställd intäkt i form av peng eller check per utförd prestation ärdensamma för en privat entreprenör som för en resultatenhet inomkommunen. Den privata entreprenören ersätts även för fastställdaoverheadkostnader för administration mm, samt för fastställdmomskompensation.Kommunstyrelsen bör ha en central buffert som motsvarar 2 % av debudgeterade verksamhetskostnaderna. Fördelning av medel från dencentrala bufferten ska ske 1 gång per år i samband med att kommunensdelårsbokslut med helårsprognos per augusti behandlas ikommunstyrelsen. Från 2010 omfattar kriterierna för fördelning av medelhärifrån även äldreomsorg. Reglerna för dessa fastställdes under hösten2009.Fördelning ur den centrala bufferten sker endast utefter fastslagnakriterier. (Se finansiella förutsättningar sidan 8.)Övergår en kommunal verksamhet till privat regi, ska inventering och enmarknadsmässig värdering ske av samtliga inventarier och material. Denprivata entreprenören erbjuds att köpa inventarier/material till värderatpris. Överenskommelse av att hyra inventarier kan också slutas. Materialoch inventarier som inte köps eller hyrs av den privata entreprenören skafördelas inom enheter i kommunal regi.2


Budgetförutsättningar – ekonomiskt utrymmeNämndernas budgetramar ökades 2004 och skatten höjdes med 1 krona.Skatten sänktes med 10 öre 2008, med ytterligare 30 öre 2009, 2 öre 2010 och20 öre 2012.Skatten är oförändrad 2013 och 2014.2013 års budget belastas inte med balanserade underskott från tidigare år.I budget 2013 har ramarna räknats upp med 2 % för löner och för övrigakostnader. Läraravtalet 2012 blev klart först under hösten 2012.Verksamheterna inom barnomsorg/utbildning kompenserades helt genom attbudgeten räknades upp. Ökningen ökade även ramar och peng för 2013.I budget 2014 räknas löner och övriga kostnader upp med 2 %.Utgångspunkter för 2014 och 2015Följande intäkts- eller kostnadshöjningar, jämfört med budget 2013, inryms inämndernas/utskottens budgetramar tkr (ökade kostnader redovisas medminustecken). 10 öre skatt = 2 624 tkr 2014. Skatten är oförändrad 2013 och20142014 2015 (ökn från 2014)Ökade skatteintäkter 10 354 21 366Rationaliseringar 3 795 2 205Nya ettårssatsningar -4 500 -5 000Förra årets ettårssatsningar upphör 4 500 5 000Demografi skola/barnomsorg* 795 -2 324Demografi äldreomsorg* 1 552 242Demografi mer fastigheter 183Demografi mer gator 215Demografi mer parker 148Ökade personalkostnader 2,0%/3,0% -6 800 -10 700Ökade priser 2,0%/2,5% -6 300 -8 000Semesteranställningar fritidsgårdar -150Utökning central buffert -300 -300Ökade avskrivningskostnader -4 000 -2 000* Belopp i 2013 års priser3


Uppräkning av löner och priserI ramarna för budget 2014 med planer 2014-2015 ingår kostnadsökningar förlöner och priser.Löner 2,0 % år 2014 och 3,0 % 2015 och 2016Priser 3,0 % 2014 och 2,5 % 2015 och 2016PO-pålägget är oförändrat 2014, dvs. 39,5% på vanliga månadslöner.Kommuninterna kostnader för kost och städ ska räknas upp med 2 % för städoch 2 % för kost 2014.Demografiska variablerI bilaga 1, ”Gemensamma planeringsförutsättningar” (GPF), redovisasbefolkningsprognoser fram till 2017. Dessa redovisas för hela Trosa kommun ochför kommundelarna Vagnhärad, Västerljung och Trosa tätort. Uppdelningen ikommundelar skiljer sig från församlingsgränserna för att bättre passa hurarbetet planeras i förskola/skola och inom vård- och omsorg.Bilagan redovisar även samtliga lokaler med kommentarer om därombyggnationer eller andra förändringar har gjorts, pågår eller planeras.De åldersgrupper som redovisas är:1 - 5 år Förskola6 – 15 år f-klass – år 9 i grundskolan, skolbarnomsorg16 - 18 år gymnasiumBefolkningsförändring för år 1-6 samt 7-9, samt får varje årskurs förgrundskolan redovisas också för att tydliggöra förändringar per skola.80-84 år äldreomsorg85- w år äldreomsorg som statistiskt och erfarenhetsmässigt kräver meromsorgFör att räkna fram ökade kostnader för ökat antal invånare äldre än 85 år harutgångspunkt tagits från de marginaleffekter som utjämningssystemet ger tillföljd av invånare i de äldre åldrarna. Vård- och omsorg får en ökad/minskadkostnadsram som motsvarar 80 % av marginaleffekterna, då 20 % av effekternakan hänföras till fasta kostnader som overhead, lokaler, etc. Beloppen redovisasi bilaga 1.De kostnader som redovisas för skolan baserar sig på den ersättning, ”peng” perelev som skolorna får per ålderskategori. ”Pengen” utgår från budget 2013 föralla år. För gymnasieskolan, så grundar sig beloppet på 2013 års snittkostnadper elev.När det gäller förskolan så har kostnaderna beräknats enligt ”peng pertimintervall” och det faktiska timintervall som uppmättes i maj och november2012. Hur stor andel av Trosas 1-5 åringar som går i förskola, har styrts avandelen barn i februari och september 2012 som gick i förskolan.4


Rationaliseringar/nettokostnadsminskningar 2014 och 2015Liksom tidigare år är detta ledningsgruppens förslag. Detaljerna beslutas politiskti samband med budgetberedningen i maj.20131 årssatsningarbortRationalisering2014Rationalisering2015nämnd/utskottpol ledn 0 0KK -450 -125 -330EKO -100 0SBN 0 -85 -125Skola -2 000 -560 -1 000SOC 0 -600 0K&F -500 0VON -400 -800 -575T&S -1 050 -1 100 -400REV 0 0MN 0 -25 -25FIN 0 -500 -150-4 500 -3 795 -2 605Ettårssatsningar 2013 som tas bort 2014Ettårssatsningar 2013tkr nämndsumma/nämndVagnhärads station 100 år 2013 250 KSFörebyggande arbete med trygghetsåtgärder 200 KS 450Biotopåtgärder (Fiske) 100 EKO 100Fortsatt arbete med att förbättra resultaten i skolan 1 000 SkolanUtökad satsning på IT i skolan 1 000 Skolan 2 000Upprustning förskolor i Vagnhärad 750 TSNMatprojekt 200 TSNVassröjning ( 0,5 Mkr i tre år )TSNUtsmyckning rondell i Västerljung 100 TSN 1 050Utvecklad vårdplanering 200 VONAvgiftsprojekt hemtjänst 100 VONSinnenas lilla trädgård 100 VON 400Kulturtryck, mm, 100 KFNIordningställa kring motionsspår med platsbyggdamotionsredskap, stödja andra kommunprojekt, mm 400 KFN 500Totalt 4 500Utökningar av ram i budget 2013, tkr, som kvarstår och räknasupp med löne- och prisökningInför varje budget har kostnadsramarna räknats upp eller justerats för Löneökningar Prisökningar Demografiska förändringar för barn och unga samt äldre medborgareDessa kostnadsökningar finns inte med i nedanstående redovisning.Det gör inte heller ökade kostnader som reglerats med internhyra och ökadekapitaltjänstkostnader. Verksamheternas budgetramar utökades även 2011 och2012, men dessa redovisas inte här5


Ramökningar 2013KommunstyrelsenAdministrativt upphandlingsstöd 200Utökning central buffert 300Fortsatt satsning IT i skolan 1 500HUM/Skola o barnomsorgSärskolan 1 000Komp. 2012 års läraravtal 1 460Kultur och fritidKomp. 2012 års läraravtal 22Vård och omsorgÖkad buffert nämnden 1 000Korttidstillsyn (fritids) LSS 565Totalt 6 0476


Budget/ramförändringar som kommer att justeras senareRamarna är uppräknade enligt de ekonomiska förutsättningarna som harbeskrivits. Ekonomienheten kommer att göra teknisk justering av ram medhänvisning till förändrade kapitaltjänst-/ internhyreskostnader.Förändring av nettoramar inför budgetanvisningarRamar (tkr) 2013 2014 2015 2016Kommunstyrelse 60 454 61 015 62 480 64 306Politisk ledning 7 706 7 860 8 090 8 326Kommunkontor 41 974 42 145 43 030 44 270Ekoutskottet 1 274 1 211 1 260 1 310Central buffert 9 500 9 800 10 100 10 400Humanistisk nämnd 274 610 276 550 286 692 295 692Barnomsorg o utbildning 251 361 253 424 262 916 271 248Individ och familjeomsorg 23 249 23 126 23 776 24 444Kultur & fritid 32 606 32 979 33 963 34 972Vård- & omsorgsnämnd 136 861 137 411 141 283 146 081Teknik & service skatt 31 044 31 472 33 703 36 372Samhällsbyggnadsnämnd 10 797 10 984 11 223 11 595Miljönämnd 950 962 1 015 1 070Revision 740 755 774 794Övr kommungem poster 10 356 16 774 17 427 10 061Pensioner 7 500 7 500 7 500 7 500Kommmungemensamt 3 256 3 274 3 292 561Omställn kostn/övrigt -400 4 500 4 635 0nya satsningar 4 500 5 000 5 000Rationaliseringar 3 mkr 2013o 2014 ligger i ovanståenderamar -3 000 -3 000 -3 000Finansnetto 8 350 8 100 8 100 8 100Ökade avskrin 4 000 2 000 2 000Tot skattefin verks 558 418 568 901 588 560 600 943Skattenetto 544 387 554 741 576 107 601 0397


Sammanställning av ramförändringar per nämnd o utskott 2014Ramför-Ettårssats. Rationaliseringaändringar2013 somNämnd/utskottska bort 2013KSLöner, priser och PO netto 1 042Vagnhärads station 100 år -250Förebyggande trygghetsåtg. -200Central buffert 300TotaltnettoRationaliseringar -125EkoutskottLöner, priser och PO netto 37Biotopåtgärder -100Totalt KS 1 379 -550 -125 704SBNLöner, priser och PO netto 272Rationaliseringar -85Totalt SBN 272 0 -85 187Utbildning/barnomsorgDemografi skolan 2013 års pris -795Löner, priser och PO netto 5 418Fortsätta att förbättra resultat i skolan -1 000Utökad statsning IT i skolan (drift) -1 000Rationaliseringar -560Totalt utbildning/barnomsorg 4 623 -2 000 -560 2 063Individ o familjeomsorgLöner, priser och PO netto 477Rationaliseringar -600Totalt Individ & familj 477 0 -600 -123Kutur & fritidLöner, priser och PO netto 723Kulturtryck, mm -100Platsbygga motionsredskap, mm -400Semsteranställningar fritidsgårdar 150Rationaliseringar 0Totalt kultur o fritid 873 -500 0 3738


Ramför-Ettårssats. Rationaliseringarändr-2013 somTotaltNämnd/utskottingar ska bort 2013 nettoVård och omsorgLöner, priser och PO netto 3 302Demografi VON -1 552Utveckla vårdplanering -200Avgiftsprojekt hemtjänst -100Sinnenas lilla trädgård -100Rationaliseringar -800Totalt VON 1 750 -400 -800 550Teknik o serviceLöner, priser och PO netto 2 032Demografi fastigheter, gator, parker 546Upprustnings förskolor Vgh -750Matprojekt -200Utsmyckning rondell Västerljung -100Rationaliseringar -1 100Totalt TSN skatt 2 578 -1 050 -1 100 428MiljönämndenLöner, priser och PO netto 37Rationaliseringar -25Totalt MN 37 0 -25 12RevisionLöner, priser och PO netto 15Rationaliseringar 0Totalt revision 15 0 0 15FinansförvaltningÖkad avtalstrohet (skall fördelas ut när vi vet) -150Ettårssatsningar 2014 4 500Rationaliseringar -500Totalt finansen 4 500 0 -650 3 850Ökade avskivningskostnader 4 000 4 000Totalt finans exkl skatt 20 504 -4 500 -3 945 12 0599


Riktlinjer för budgetarbetetNämnderna ska bygga sitt arbete för budget 2014 och plan 2015-2016 medbudget 2013 som utgångspunkt. Kostnader och intäkter räknas upp med generella påslag enligtbeskrivningarna under huvudrubrik ”Uppräkning av löner och priser” och nermed 2014 års rationaliseringar, 2013 års ettårssatsningar samt demografi. Nämndens buffert bör vara i storleksordningen 1 procent av budget för attunder året kunna klara förändringar inom fastställd budgetram. Bufferten skarymmas inom ram. Nämnden har ett ansvar för att nödvändiga kostnadsanpassningar genomförs. Nämnderna ska presentera ett budgetförslag i enlighet med fastställd ram. Medel för ettårssatsningar fördelas i samband med budgetberedningen i maj.Mål och nyckeltalKommunfullmäktiges fastställde nya mål för 2013 vilka bröts ner i beslutadenämndsmål. Dessa följs upp för första gången 2013 och bör kvarstå relativtoförändrade inför 2014, om inte särskilt beslut fattas om förändring.Nyckeltal som direkt kan relateras till budgeterade medel ska alltid redovisasmed så objektiva mått som möjligt. Dessa följs sedan upp i delårs- ochårsbokslut.KvalitetTrosa kommun medverkar nu tillsammans med 200 andra kommuner i SverigesKommuners och Landstings projekt, ”Kommunens kvalitet i korthet”.Här följs kommunens kvalitet upp ur ett medborgarperspektiv. Flera avKommunfullmäktiges och nämndernas mål mäts och har mätts genom dettaprojekt. Genom att ingå i detta projekt får Trosa möjlighet att jämföra sig medandra kommuner och med sig själv i tiden. Vi har också stora möjligheter atthitta goda exempel för vissa verksamheter. Projektet har utökats varje år medatt fler kommuner valt att delta.Trosa genomför också Medborgarundersökning vartannat år från 2007. Våren2013 är det dags för en fjärde Medborgarundersökning som genomförs av SCB.Även härifrån mäts flera och viktiga mål upp. Medborgarperspektivet är centraltdå Kommunfullmäktige fastställer mål och det ska genomsyra alla kommunalaverksamheter.10


Kommunalskatt och generella statsbidragKommunen baserar sina beräkningar över skatteintäkter på Sveriges kommuneroch Landstings antaganden och prognoser. Enligt skatteprognos, från 2012-12-18, beräknas kommunens skattenetto öka med 10,4 mkr jämfört med budget2013. Skatteprognosen har beräknats med befolkningsutvecklingen i degemensamma planeringsförutsättningarna som underlag.Finansiella förutsättningarKommunens målsättning för resultatets andel av skatteintäkter och statsbidragär minst 1 procent. Att resultatet satts så lågt som 1 procent beror på att medeläven bör avsättas till kommande pensioner. Under 2012 avsättas 7 procent avkommunens pensionsskuld vilket innebär att målet om 2 % avsättning per år haruppfylllts för hela mandatperioden 2011-2014. Medel motsvarande 1,63 procentav verksamhetens kostnader avsätts i Kommunstyrelsens centrala buffert.(Målsättningen är att bufferten ska vara 2 procent av verksamhetens kostnader).Denna buffert kan användas till att:täcka minskade skatteintäktertäcka ökade pensionskostnadertäcka ökade kostnader för fler förskole-/skolbarn än vad som budgeteratssamt dyrare programval i gymnasieskolantäcka ökade LSS-kostnadertäcka för ökade kostnader för fler äldre invånare vilket medför ökade behovav vård och omsorgöka kommunens resultat11


Investeringsbudget anläggningar (tkr)Projekt Överfört Budget Budget Plan Planskattefinansierade från 2011 2012 2013 2014 2015Stabilisering skredriskområden 1 000 1 000 1 000 1 000 1 000Statsbidrag -1 000 -1 000 -1 000 -1 000 -1 000Fritidsanläggningar och FastigheterRenovering SafirenXVitalisskolanXVitalisskolan etapp 4-6XNy förskola VagnhäradXNy förskola TrosaXInvesteringsreserv Fastigheter X X X XEnergioptimeringsprojektXProjekt TrosaånXNytt tak Trosa VårdcentralXUpprustning utemiljö förskolor X X X XOmbyggnad Trosa FritidsgårdXUpprustning Skärlag X XLäktare HedebyhallenXFageräng belysning/personalutrymmeXVitalis idrottshallXSumma 48 690 17 600 27 550 2 200 10 900Överfört Budget Budget Plan PlanGator och parker från 2011 2012 2013 2014 2015Trafiksäkerhetsåtgärder X X X XLekplatser X X X XUtveckling parker grönmiljö X X X XUtbyte av armaturer X X X XStrandskoning, proj.XProj. ny förbifart TrosaXVagnhärads centrumXVästra långgatanXGc-vägar enligt utredning X X XVägprojekt HäradsvallenXRondell TrosaXVagnhärads å-miljö X X XParkering Vhd StationXPark VästerljungXParkering SafirenXSumma 9 673 6 850 21 515 4 350 1 35012


Projekt Överfört Budget Budget Plan Planavgiftsfinansierade från 2011 2012 2013 2014 2015Reningsverk enligt alternativ AXKorslöt återvinningscentralXÅtervinningsstation KällvikXAllégatanXProj. Vattentäkt/-verk VagnhäradXNy huvudvattenledning SörtunaXRenovering Vagnhärads vattentornXPumpstationer GunnarstensgatanXNyängen etapp 2 vattenledningXStationsvägen spillvattenledningXBiblioteksvägen vattenledningXKv UtternXVerktygsgatan vattenledningXSkärlagsgatan spillvattenledningXSkärlagsparken dagvattenmagasinXNorra Husby, dagvattenXKalkbruksvägen vatten- ochspillvattenledningXNy vattenledning under banvallenXSumma avgiftsfinansierat 5 219 2 750 23 698 1 072 14 595Investeringsbudget inventarier (tkr)Projekt Överfört Budget Budget Plan Planskattefinansierade från 2011 2012 2013 2014 2015Humanistisk nämndInventarier skolkontoret 300 300 300 300Inventarier förskolor/skolor 1 950 1 300 1 200 1 200IT-investeringar till skolan 1 000 0 0 0Inventarier socialkontoret 100 100 100 100Kultur och FritidInventarier 500 250 250 250Oförutsett 100 100 100 100Vård och omsorgLarm, sängar, hjälpmedel, inventarier, mm 500 700 700 700SamhällsbyggnadsnämndInventarier kontoret 75 75 75 75Teknik och servicenämndStädutrustning 100 100 100 100Köksutrustning 300 300 300 300Inventarier tekniska kontoret 100 100 100 100KommunstyrelseIT-investeringar 1 000 1 000 1 000 1 000IT-investeringar skolan (ny- oreinvestering) 0 2 000 2 000 2 000Investering tomrör 100 100 100 100Inventarier kommunkontoret 300 300 300 300Investeringsreserv 25 388 10 000 25 000 25 000 25 000Delsumma nämnder 25 388 16 425 31 725 31 625 31 625Summa skattefinansierade 83 751 40 875 80 790 38 175 43 875Totalt 88 970 43 625 104 488 39 247 58 47013


Tidsplan för budget 2014-2016Samverkan av respektive nämnds förslag till budget skall ske inom ramen för detlokala samverkansavtalet. För samverkan av det samlade budgetförslaget svararkommunkontoret.Tidplan, budgetprocessen28 november Ledningsgruppen Genomgång avgem.plan.föruts (GPF) o lön/prisuppr24-25 januari Orförandegrupp Redovisning ekonomiskaoch ledningsgrupp förutsättningar5 februari Oppositionen Redovisning ekonomiskaförutsättningar18 februari Ksau Budgetanvisningar o GPF19 februari Central samverkan Budgetanvisningar o GPF27 februari KS Budgetanvisningar o GPFmars-april Nämnder Budgetarbeteapril-8 maj Nämnder Beslut om budgetförslag13 maj Budgetberedning Majoriteten15 maj Nämndsordförande/ OppositionenProduktionschef27 maj Ksau Budgetförslag 2014, flerårsplan2015-201628 maj Central samverkan Budgetförslag 2014 med flerårsplan4 juni KS Budgetförslag 2014 med flerårsplan19 juni KF Budgetbeslut 2014 med flerårsplan2015-201615


Bilagatill budgetanvisningarGemensamma planeringsförutsättningarGPF2014 - 2017Trosa kommunSammanfattning av demografiska variabler samt hur den påverkar kostnadsutvecklingenför förskola/skola samt äldreomsorg.Kommunens samtliga lokaler har uppdaterats i december 20122013-01-191


Demografiska variablerPå följande sidor redovisas befolkningsprognoser fram till 2017 för helaTrosa kommun.De åldersgrupper som redovisas på följande sidor i denna sammanfattning är:Samtliga invånare som utgör underlag för kommande års skatteprognoser.1 - 2 år Förskola3 - 5 år6 år Förskoleklass7 – 11 år12 – 15 år GrundskolaSkolbarnomsorg16 - 18 år Gymnasium80-84 år äldreomsorg85- år äldreomsorg som statistiskt och erfarenhetsmässigt kräver merinsatserDe kostnader som redovisas för grund- och gymnasieskola baserar sig på peng i budget2013 för alla år. Peng för 2013 är den peng som reviderats upp till följd av läraravtalet2012. Kostnaderna för förskolan baserar sig på faktiskt timintervall i maj och november2012 samt peng/timintervall. Kostnaderna för förskola och skolbarnomsorg har, liksomtidigare år, baseras på andel barn 1-5 år i februari och september 2012 som gick iförskola, vilket är 90 procent. Skolbarn som går i skolbarnomsorg har beräknats enligtSkolverkets statistik, förutom för 6-åringarna där vi beräknar att 100 procent går iförskoleklass och skolbarnomsorg.De antaganden som har gjorts då kostnaderna beräknats per år redovisas tydligt.3


Befolkningsprognos alla åldrarÅr/ålder 0-9 10-19 20-29 30-39 40-49 50-59 60-69 70-79 80-89 90-w Summa2003 1 301 1 562 874 1 457 1 355 1 778 1 181 587 414 56 10 5652004 1 271 1 618 811 1 466 1 379 1 717 1 292 602 411 60 10 6272005 1 298 1 618 816 1 442 1 432 1 673 1 447 637 412 56 10 8312006 1 274 1 626 822 1 398 1 503 1 629 1 551 653 425 70 10 9512007 1 274 1 615 847 1 337 1 538 1 584 1 634 693 442 74 11 0382008 1 359 1 617 910 1 354 1 572 1 562 1 750 732 434 73 11 3632009 1 339 1 581 939 1 342 1 583 1 498 1 847 786 433 85 11 4332010 1 332 1 556 933 1 311 1 618 1 486 1 884 839 411 95 11 4652011 1 338 1 509 982 1 278 1 645 1 433 1 929 880 394 104 11 4922012 1 349 1 482 997 1 228 1 682 1 397 1 917 984 368 102 11 5062013 1 379 1 435 1 087 1 211 1 673 1 434 1 839 1 081 381 105 11 6252014 1 400 1 419 1 155 1 189 1 686 1 461 1 770 1 183 391 103 11 7572015 1 428 1 426 1 178 1 197 1 674 1 490 1 702 1 273 408 97 11 8732016 1 461 1 436 1 183 1 223 1 630 1 543 1 624 1 358 426 95 11 9792017 1 476 1 461 1 193 1 250 1 584 1 592 1 569 1 430 444 93 12 092Denna befolkningsprognos är underlag för beräkning av budgetårensskatteintäkter och generella statsbidrag12 300Befolkningen 1 november året innan verksamhetsåret betalar skatt tillkommunen12 10011 90011 75711 87311 97912 09211 70011 50011 50611 625GPF 2013GPF 201411 30011 1002012 2013 2014 2015 2016 2017I ovanstående graf ser man att befolkningstillväxten justerats neråt jämfört med förra årets prognos.4


250Trosa befolkning i ettårsklasser 20142001501005000 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100-wOvanstående graf illustrerar hur kommunens resurser ska fördelas till det störstaverksamheterna barnomsorg och utbildnings samt äldreomsorg.140Befolkningsförändringar 2012-2017 (index=2012)130120110100900-67-1516-1819-6465-7980-8485-w80702012 2013 2014 2015 2016 2017I ovanstående diagram visas befolkningsförändringar per åldersgrupp jämfört med 2012.5


Befolkningsförändringar per kommundelTotalbefolkning i Vagnhärad2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20174 188 4 178 4 186 4 200 4 241 4 268 4 178 4 222 4 264 4 296 4 339 4 3844 800Befolkning Vagnhärad4 6004 4004 2004 3844 123 4 151 4 188 4 178 4 186 4 200 4 241 4 268 4 3394 2644 2964 2224 1784 0003 8003 6003 4003 2003 0002004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Vagnhärads befolkning minskade med 90 invånare 30 september 2011 till 30 september2012. Av dessa var 50 i åldern 19-23 år, dvs den tid som man normalt lämnar hemmetför att till exempel plugga, och 26 invånare var i åldern 46-55 år.Totalbefolkning i Västerljung2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171 071 1 057 1 011 1 043 1 072 1 067 1 038 1 043 1 053 1 063 1 073 1 083Befolkning Västerljung1 1001 0501 051 1 058 1 0711 0571 0431 072 1 0671 0381 0431 0531 0631 0731 0831 0111 0009509008508002004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Västerljungs befolkning minskade med 29 invånare 30 september 2011 till 30 september2012. Av dessa var 15 i åldern 19-23 år.6


Totalbefolkning i Trosa tätort2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20175 557 5 781 6 084 6 160 6 152 6 154 6 287 6 360 6 440 6 500 6 560 6 622Befolkning Trosa tätort7 0006 5006 0005 5005 438 5 494 5 557 5 7816 0846 160 6 152 6 1546 2876 3606 4406 5006 5606 6225 0004 5004 0003 5003 0002004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Trosa tätorts befolkning ökade med 133 invånare 30 september 2011 till 30 september2012. Av dessa var 22 i åldern 1-5 år och 26 i åldern 6-15 år, dvs förskole- ochgrundskoleåldern. 15 invånare 19-23 år flyttade ut.7


Förskola, grundskola, skolbarnomsorg och gymnasiumHela kommunen2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Förskola 1-2 år 244 240 257 250 243 257 259 251 256 265 272Förskola 3-5 år 420 417 412 406 403 408 417 424 433 437 435Förskoleklass 6 år 131 150 151 146 146 135 142 154 148 151 160Grundskola 7-11 år 644 654 688 710 723 736 741 746 759 769 777Grundskola 12-15 år 719 673 630 580 548 546 548 564 585 598 614Gymnasieskola 16-18 år 508 539 554 556 534 484 436 409 405 405 406Barn i förskoleåldern i Trosa kommun4504003501-2 år3003-5 år2502002005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Barn i skolåldern i Trosa kommun9008007006005004003006 år7-11 år12-15 år16-18 år20010002005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20178


Rampåverkan på grund av demografi beräknas med följandefaktorer som grund: Befolkning i olika åldrar omräknas till terminer. Exempel: ett barn som är 7 år hösten2012 är även 7 år våren 2013 (år 1 i grundskolan). Fastställda pengbelopp enligt reviderad budget 2013, samt beräknat snittpris förgymnasielever. Andel barn 1-5 år som går i förskolan har beräknats till 90 procent vilket är snittet avalla 1-5 åringar under februari och september 2012 som gick i förskolan. Andelenbarn 7-12 år i skolbarnomsorg har beräknats enligt Skolverkets senaste statistik förTrosa. Andel 6-åringar i förskoleklass och skolbarnomsorg har beräknats till 100 procent. Vistelsetid har beräknats enligt schema från förskolan maj och november 2012.PengBo-peng 2013, kr/barn/år.-20 t/v 21-40 t/v 41- t/v1-2 år 87 890 114 988 155 1493-5 år 50 335 65 829 88 771Bo-peng 2013, kr/barn/år6 år 7-12 år6-12 år 35 968 28 821Grundskolepeng 2013, kr/barn/årKr/elev/årFörskoleklass 29 186Skolår 1-5 46 680Skolår 6-9 54 867Gymnasiet, 2013, snitt/elev/årsnittkostn netto/elev 105 104Schema förskolanTimintervall BO snitt maj och nov 2012-20 tim/v21-40 tim 41- tim/v1-2 år 36,5 77,5 85% 18,3% 38,9% 42,7%3-5 år 71 128 208% 17,4% 31,4% 51,1%6 år 7-12 årFritids 120,5 469% 20,4% 79,6%Totalt:606 förskolebarn589,5 fritidsbarn9


Andel barn i förskola enligt egen statistik från 2012 ochskolbarnomsorg enligt Skolverkets statistikAndel inskrivna barn 1-5 år i % i förskolan enligt egen statistik2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014Förskola 82 85 86 86 90 85 86 88 88 90 90Famdgh 0 0 0 0 0 0 0 0 0 0 0Andel inskrivna barn 6-12 år i % i skolbarnomsorg enligt Skolverkets statistik2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014Fritids 6-9 år 72 73 79 85 81 86 84 87 84 84 84Famdgh 6-9 år 10 8 5 5 5 3 0 0 0 0 0Fritids 10-12 år 17 15 14 17 17 19 20 20 21 21 21Demografins påverkan på skolans ram i 2013 års nivåMed ovanstående faktorer har kostnaderna beräknats för respektive år ochålderskategori. Avseende år 2013 har de framräknade beloppen jämförts med ramarnaför Budget 2013. Här kan man få den första indikationen på om medel från centralbuffert kan komma att fördelas under 2013 samt om ramarna ska öka eller minska för2014. Ramarna beräknas att minska något till följd av demografin. Antaletgymnasieelever fortsätter att minska 2014 medan analet förskole- och grundskolebarnökar.10


Karta – GPF-områden/kommundelarFörskola och skola per kommundel redovisas på följande sidor12


Vagnhärad2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171-2 år 87,5 94,5 104 103 105 110 101 93 99,5 106 107,53-5 år 160,5 152,5 150 153,5 160,5 167,5 172 175 171,5 166 1646 år 56,5 53 57 56,5 49 48,5 56,5 62 60 62,5 64,57-11 år 263,5 257,5 265 272,5 271,5 261,5 258 267,5 276,5 285 30312-15 år 303 289 265,5 232,5 210,5 209 210,5 211 213 217 216,516-18 år 226,5 237,5 223,5 220 220,5 202,5 171 152,5 153,5 156 153,570Barn i förskoleåldern i Vagnhärad/budgetår60504030201001 år 2 år 3 år 4 år 5 år201220132014201520162017706050403020100Grundskoleelever f-5 Vagnhärad/budgetårf-klass år 1 år 2 år 3 år 4 år 5201220132014201520162017605856545250484644Grundskoleelever år 6-9 i Vagnhärad/budgetårår 6 år 7 år 8 år 920122013201420152016201713


Barn i förskole- och grundskoleålder per budgetår i VagnhäradÅlder/Kalender-/budgetårårskurs 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171 år 49,5 52 48,5 52,5 54,5 45 45,5 51,5 52,5 532 år 45 52 54,5 52,5 55,5 56 47,5 48 53,5 54,53 år 45 47 56 57,5 53,5 56 58,5 50,5 50,5 55,54 år 52 47 47 55 58,5 56 58,5 60,5 53 535 år 55,5 56 50,5 48 55,5 60 58 60,5 62,5 55,5s:a 1-5 år 247 254 257 266 278 273 268 271 272 272f-klass 53 57 56,5 49 48,5 56,5 62 60 62,5 64,5år 1 53 54 55,5 54,5 46,5 47,5 58 63 61,5 64år 2 53,5 54 56 58 54,5 46,5 49 59 64 62,5år 3 53 55 52,5 52,5 57 55 47,5 50 60 65år 4 50 53 55 53 52,5 57 56 48,5 50,5 60år 5 48 49 53,5 53,5 51 52 57 56 49 51,5s:a 1-5 258 265 273 272 262 258 267,5 277 285 303år 6 56,5 50 51 54,5 52 49,5 52,5 57,5 56,5 49,5år 7 78,5 57 50,5 52,5 55,5 52 50 53 57,5 56,5år 8 81,5 77 55,5 49 53 56 52,5 50,5 53 57,5år 9 72,5 81,5 75,5 54,5 48,5 53 56 52 50 53s:a 6-9 289 265,5 233 211 209 211 211 213 217 217s:a 7-9 233 215,5 182 156 157 161 158,5 156 161 167s:a 1-6 314 315 324 326 314 308 320 334 342 353Totalt 1-9 546,5 530,5 505 482 470,5 468,5 478,5 489,5 502 519,5Barn i förskole- och grundskoleålder per läsår i VagnhäradÅlder/Läsårårskurs 07/08 08/09 09/10 10/11 11/12 12/13 13/14 14/15 15/16 16/17 17/181 år 46 53 51 46 59 50 40 51 52 53 532 år 41 49 55 54 51 60 52 43 53 54 553 år 50 40 54 58 57 50 62 55 46 55 564 år 52 52 42 52 58 59 53 64 57 49 575 år 56 55 57 44 52 59 61 55 66 59 52s:a 1-5 år 245 249 259 254 277 278 268 268 274 270 273f-klass 52 54 60 53 45 52 61 63 57 68 61år 1 52 54 54 57 52 41 54 62 64 59 69år 2 54 53 55 57 59 50 43 55 63 65 60år 3 51 55 55 50 55 59 51 44 56 64 66år 4 49 51 55 55 51 54 60 52 45 56 64år 5 50 46 52 55 52 50 54 60 52 46 57s:a 1-5 256 259 271 274 269 254 262 273 280 290 316år 6 61 52 48 54 55 49 50 55 60 53 46år 7 95 62 52 49 56 55 49 51 55 60 53år 8 71 92 62 49 49 57 55 50 51 55 60år 9 72 73 90 61 48 49 57 55 49 51 55s:a 6-9 299 279 252 213 208 210 211 211 215 219 214s:a 7-9 238 227 204 159 153 161 161 156 155 166 168s:a 1-6 317 311 319 328 324 303 312 328 340 343 362Totalt 1-9 555 538 523 487 477 464 473 484 495 509 53014


Västerljung2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171-2 år 24 23 24,5 26 25 22 21 23,5 23 20 20,5 22 22,53-5 år 37,5 39,5 40,5 38 37 44,5 44,5 38,5 36 36 38,5 38,5 37,56 år 17 14 11 14,5 15,5 10,5 14,5 16 16 14,5 11 13 157-11 år 88,5 84 77,5 67 65,5 68,5 65,5 64,5 67,5 72 74 74,5 7412-15 år 86,5 86,5 85,5 80 68 61,5 59,5 58 53 50 52 51,5 54,516-18 år 46 50,5 52 55,5 60 64 61 49 42 41 41 40 37181614121086420Barn i förskoleålden i V-ljung/budgetår1 år 2 år 3 år 4 år 5 år201220132014201520162017181614121086420Grundskoleelever f-5 i V-ljung/budgetårf-klass år 1 år 2 år 3 år 4201220132014201520162017181614121086420Grundskolelever år 6-9 i V-ljung/budgetårår 6 år 7 år 8 år 920122013201420152016201715


Barn i förskole- och grundskoleålder per budgetår i VästerljungÅlder/Kalender-/budgetårårskurs 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171 år 13,5 12 10 12 13 10,5 9 10,5 11 112 år 12,5 13 12 9 10,5 12,5 11 10 11 11,53 år 13 14 14,5 13 9,5 11,5 13,5 12 11 124 år 10,5 13,5 15 15 13 10 12 14 13 125 år 14,5 9,5 15 16,5 16 14,5 10,5 12,5 14,5 13,5s:a 1-5 år 64 62 66,5 65,5 62 59 56 59 60,5 60f-klass 14,5 15,5 10,5 14,5 16 16 14,5 11 13 15år 1 10 15,5 16,5 11 14,5 15,5 16 15 12 14år 2 12,5 10 15 15 10 14,5 16 16,5 16,5 12år 3 13,5 12,5 11 14,5 15,5 11 14,5 16 16,5 15,5år 4 13,5 12 13 12 13 14 11,5 15 16 16,5år 5 17,5 15,5 13 13 11,5 12,5 14 11,5 15 16s:a 1-5 67 65,5 68,5 65,5 64,5 67,5 72 74 76 74år 6 15,5 18 16,5 13,5 13,5 11,5 12,5 14,5 12 15år 7 18,5 14 17 17 13 13 11,5 12,5 14,5 12år 8 23 15,5 13 16 16 13 13 12 13 14,5år 9 23 20,5 15 13 15,5 15,5 13 13 12 13s:a 6-9 80 68 61,5 59,5 58 53 50 52 51,5 54,5s:a 7-9 64,5 50 45 46 44,5 41,5 37,5 37,5 39,5 39,5s:a 1-6 82,5 83,5 85 79 78 79 84,5 88,5 88 89Totalt 1-9 147 133,5 130 125 122,5 120,5 122 126 127,5 128,5Barn i förskole- och grundskoleålder per läsår i VästerljungÅlder/Läsårårskurs 07/08 08/09 09/10 10/11 11/12 12/13 13/14 14/15 15/16 15/17 15/181 år 12 15 9 11 13 13 8 10 11 11 112 år 14 11 15 9 9 12 13 9 11 11 123 år 10 16 12 17 9 10 13 14 10 12 124 år 11 10 17 13 17 9 11 13 15 11 135 år 20 9 10 20 13 19 10 11 14 15 12s:a 1-5 år 67 61 63 70 61 63 55 57 61 60 60f-klass 9 20 11 10 19 13 19 10 12 14 16år 1 11 9 22 11 11 18 13 19 11 13 15år 2 14 11 9 21 9 11 18 14 19 11 13år 3 15 12 13 9 20 11 11 18 14 19 12år 4 14 13 11 15 9 17 11 12 18 14 19år 5 19 16 15 11 15 8 17 11 12 18 14s:a 1-5 73 61 70 67 64 65 70 74 74 75 73år 6 13 18 18 15 12 15 8 17 12 12 18år 7 24 13 15 19 15 11 15 8 17 12 12år 8 26 20 11 15 17 15 11 15 9 17 12år 9 24 22 19 11 15 16 15 11 15 9 17s:a 6-9 87 73 63 60 59 57 49 51 53 50 59s:a 7-9 74 55 45 45 47 42 41 34 41 38 41s:a 1-6 86 79 88 82 76 80 78 91 86 87 91Totalt 1-9 160 134 133 127 123 122 119 125 127 125 13216


Trosa tätort2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 20171-2 år 115,5 113,5 123,5 125 116,5 123 134,5 139,5 138,5 139 142,53-5 år 220,5 221 222 208 198 202 209,5 214,5 224,5 235 237,56 år 69 81 76,5 78,5 82,5 70,5 69,5 77,5 77,5 76,5 81,57-11 år 313,5 322,5 351 368,5 386 409,5 415,5 406,5 409,5 411 40412-15 år 319,5 301,5 294,5 286 277,5 279 284 303,5 319,5 330 345,516-18 år 222,5 247 270 272 252,5 232,5 223,5 215 208 207 214Barn i förskoleåldern i Trosa/budgetår90807060504030201001 år 2 år 3 år 4 år 5 år2012201320142015201620171009080706050403020100Grundskoleelever f-5 i Trosa/budgetårf-klass år 1 år 2 år 3 år 4 år 52012201320142015201620171009080706050403020100Grundskoleelever år 6-9 i Trosa/budgetårår 6 år 7 år 8 år 920122013201420152016201717


FörskolelokalerKommunägda lokalerPopulärnamnFastighetsbeteckningAdressVerksamhetByggårFastighe t-ensursprungsändamålBruksarea(BRA) Uthyrd KommentarerFageräng förskola Fagerhult 2:86 Skolvägen 1, Vagnhärad Förskola 1971/78 Förskola 1 074 Renov pågår 20124st uthus, Fageräng Fagerhult 2:86 Uthus 19Fagerhult förskola Fagerhult 2:212 Gärdesvägen 34, Vagnhär Förskola 1981 Förskola 311 Rimligt uh i 8-10 års perspektivUthus, Fagerhult Fagerhult 2:212 Uthus 19Fagerhult II Fagerhult 2:212 Gärdesvägen 34, Vagnhär Förskola 2006 Förskola 285Tomtaklint förskola Liturgen 1 Björkhamragatan 1, Trosa Förskola 1977/99 Förskola 7462 st uthus, Tomtaklint Liturgen 1 Uthus 13Tomtahill förskola Mässhaken 1 Sockengatan 4, Trosa Förskola 1985 Bostadshus 328 Tillbyggt 30 kvm 2011, yta uppdateradFörråd, Tomtahill Mässhaken 1 Förråd 11Förråd, Tomtahill Mässhaken 1 Förråd 11Björkbackens förskola Kvarnvingen 6 Norrbackag. 1, Trosa Förskola 1982 Förskola 5122st. Uthus Kvarnvingen 6 Uthus 7Alphyddan, förskola Kvarnvingen 6 Norrbackag. 1, Trosa Förskola 2010 Förskola 317Nedervåning förskola, övervåningskolkontor och elevhälsa. Ytan delad med 2Dalbystugan Västerljung-Dalby 2:44 Förskola 1993 342 XUthus, Dalbystugan Västerljung-Dalby 2:44 Kantzows väg 2, Västerljung Uthus 19 XUthus, Dalbystugan Västerljung-Dalby 2:44 Uthus 14 XBjörke gamla fsk Björke 9:6 Norrbyv. 2, Västerljung 1998 135 Här har Harke verksamhet idag, FritidsBjörke NYA fsk Björke 9:1 Förskola 2011 Förskola 340Tallbacken Trosa 10:64 Nyängsvägen 26 Förskola 2005 Förskola, paviljo 328Tallbacken II Trosa 10:64 Nyängsvägen 26 Förskola 2009 Förskola, paviljo 328Tomtalunds förskola Predikanten 2 Tomtaklintgatan 2, Trosa Förskola Vårddcentral 617 Flyttad från inhyrdSumma 5 775Exkl. Dalby (BTA) 5 519Fastighetsinventering FörskolorInhyrda lokalerFastighetsbeteckning Adress Verksamhet ByggårFastighetens ursprungsändamålBruksarea(BRA) Årshyra KommentarerPopulärnamnHasselbackens försk Tors hage 49, Trosa Förskola Bostad 733 728 364 kr Eget ägande från 2013-04Summa 73318


SkollokalerFastighetsinventering GrundskolaKommunägda lokalerPopulärnamnFastighetsbeteckningAdressVerksamhetByggårFastighetensursprungs ändamålBruksarea (BRA)Uthyrd avkommunen KommentarerHusbyskolan Södra husby 5:117 Högtidsvägen 3, Vagnhärad Grundskola 1981 Grundskola 156 Ingen verksamhet 081125Uthus, Husbyskolan Södra husby 5:117 19Hedebyskolan Fagerhult 2:214 Centrumvägen 16B, Vhd Grundskola 1969 Grundskola 3 467 Varav SFI 150 kvm, ytan korr enl nedanGammal matsal RIVEN, yta var 246 kvmNy matsal 0 Från bibliotek till matsal, ytan ingår ovanHedebyskolan, Gymn. o beFagerhult 2:214 Centrumvägen 16B, Vhd Grundskola 1969 Gymnastikhall o matbespisn 710Fornbyskolan Fagerhult 2:214 Centrumvägen 16B, Vhd Grundskola 1977 Grundskola 3 076Fornbyskolan, tillbyggnad Fagerhult 2:214 Centrumvägen 16B, Vhd Grundskola 1998 Grundskola - tillbyggnad 1 702Hedebyhallen Fagerhult 2:214 Centrumvägen 16B, Vhd Grundskola 1999 Idrottshall, fritidsgård 2 270 plus 245kvm, ytan uppdateradSkärlagsskolan Bostället 50 Boställsgatan 1, Trosa Grundskola 1980 Grundskola 2 011 2 nya klassrum, ny entré, ny matsal 2013Paviljong Bostället 50 Boställsgatan 1, Trosa Grundskola 1980 Grundskola 240Tomtaklintskolan Predikanten 1 Tomtaklintvägen 4, Trosa Grundskola 1976 Grundskola 865Tomtaklint, idrottshall Predikanten 1 Tomtaklintvägen 4, Trosa 1976 Idrottshall 1 242Tomtaklint, förråd Predikanten 1 Tomtaklintvägen 4, Trosa Grundskola 1976 Förråd 15Tomtaklint, fritidsgård Predikanten 1 Tomtaklintvägen 4, Trosa Grundskola 1979 Fritidsgård 540Kulturskolan Predikanten 1 Tomtaklintvägen 4, Trosa Grundskola 2009 Kulturskola 260Tomtaklintskolan Predikanten 1 Tomtaklintvägen 4, Trosa Grundskola 2003 Grundskola 3 822Kyrkskolan Kyrkskolan 3:3 Norrbyv. 2, Västerljung Grundskola 1995 Grundskola 1 329 Varav Särskola 142 kvmKyrkskolan, gymn.sal Björke 9:6 Norrbyv. 2, Västerljung 1998 Gymnastikhall 422Kyrkskolan, förråd Björke 9:6 Norrbyv. 2, Västerljung 1998 Förråd 12Vitalisskolan Trosa 10:1 Skolg.1, Trosa Grundskola 1955 Grundskola 4 968 5330 inkl Renoveras och byggs ut. Ny yta inlagd.Vitalisskolan, paviljong Trosa 10:1 Skolg.1, Trosa Grundskola 1976 Grundskolepaviljong 0paviljongRivenVitalisskolan, uthus Trosa 10:1 Skolg.1, Trosa 1955 Uthus 18Vitalisskolan, gymn.sal Trosa 10:1 Skolg.1, Trosa 1967 Gymnastikhall 402 Renoveras 2013Summa 27 54419


Trosa kommuns äldre befolkningTrosa GPF 2014-20172004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 201765-69 år 490 548 585 656 742 832 904 964 979 961 958 920 890 86670-74 år 337 360 376 408 434 469 507 534 624 701 768 823 875 87375-79 år 265 277 277 285 298 317 332 346 360 380 415 450 483 55780-84 år 271 250 243 243 235 229 235 223 219 232 250 268 280 295Över 85 år 200 218 252 273 272 289 271 275 251 254 244 237 241 242600Äldre befolkning i Trosa kommun50040030020075-79 år80-84 årÖver 85 år10002004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017Den äldre befolkningen, 85 år och äldre, visar en liten minskning under de kommandeåren.Äldreomsorgens ram beräknas utifrån marginaleffekter av förändringar i invånarantaletrespektive år. Här utgår vi från belopp i kostnadsutjämningssystemet.Från och med år 2010 har medel i Kommunstyrelsens centrala buffert utökats för attäven omfatta äldreomsorgen. Antal äldre invånare enligt GPF jämförs med verkligt antalinvånare/ålderskategori.20


Demografins påverkan på Vård- och omsorgs ram i 2013 års nivåMarginaleffekter utjämningssystemet- förändring av befolkningfrån föregående år80-84 år 64 991 85-w år 210 3762013enligtGPF2014saknasi budget2013 2014 2015 2016 201780- 84 år 13 -4 18 18 12 15Effekt tkr 80-84 år 845 -260 1 170 1 170 780 97585-w år 3 -15 -10 -7 4 1Effekt tusentalskro 631 -3 156 -2 104 -1 473 842 65Nettoeffekt tusenta 1 476 -3 416 -934 -303 1 621 1 040Ökning ram 80% 1 181 -2 732 -747 -242 1 297 832Underlag för ramminskning 2014-1 552Underlag kostnadsutjämning 2013-2016 från SKLMän 80-84 år 46 254 I Trosa 30/9-12 är 80-84 år 46 % är mänKvinnor 80-84 år 80 953 64 991Män 85-89 år 118 097 I Trosa 85-w år 33 % är män samtidigt är 39% 90 år oKvinnor 85-89 år 174 137 210 376Män 90+ år 226 494Kvinnor 90+ år 315 58221


Äldre invånare i varje kommundelÄldre invånare Vagnhärad180160140120100806075-79 år80-84 årÖver 85 år402002010 2011 2012 2013 2014 2015 2016 2017Äldre invånare Västerljung4540353025201575-79 år80-84 årÖver 85 år10502010 2011 2012 2013 2014 2015 2016 2017Äldre invånare Trosa tätort40035030025020015075-79 år80-84 årÖver 85 år1005002010 2011 2012 2013 2014 2015 2016 201722


Lokaler Vård- och omsorgFastighetsinventeringÄldreomsorgKommunägda lokalerPopulärnamnAdressByggårFastighetsbeteckningVerksamhetFastighetensursprungsändamålBruksarea (BRA) Årshyra KommentarerÄngsgården Predikanten 2 Tomtaklintgatan 2, Trosa Äldreboende Vårddcentral 2 286 Flyttad från inhyrdRubinen Gärdesv. 34A Gruppboende 260Flyttad från inhyrd, Eget behov av helastället för effektivare verksPaletten Gärdesv. 34A 310 Flyttad från inhyrdS umma 2 856FastighetsinventeringInhyrda lokalerPopulärnamnÄldreomsorgAdressByggårFastighetsbeteckningVerksamhetFastighetensursprungsändamålBruksarea (BRA) Årshyra KommentarerTrosagården Karlsborg 9 Rodergatan 3, Trosa Äldreboende Äldreboende 5 195 4 679 556 krTekniska i fortsättningen avtalspartfrom 2012Trosagårdens tillbyggnad Karlsborg 9 Rodergatan 3, Trosa Äldreboende Äldreboende 1680 2 497 000 kr se ovanGärdesvägen 37,Häradsgården Fagerhult 2:11 Vagnhärad Äldreboende 4 232 3 870 288 kr se ovanTrygghetsboende Västerljung Ljungvägen 470 000 kr Nya hyra 2012-6Nytt gruppboendeVid Vårdcentralen?Boendestödj, saml.lokal Biblioteksvägen 1A 67? 364 116 kr Ombyggnation 2014-2015?Samlingslgh i ansl tillgruppboende Fodergången 27 ?? 59 50 676 krS umma 11 16 623


FritidsanläggningarFastighetsinventeringFritidsanläggningarKommunägda lokalerPopulärnamn Fastighetsbeteckning Adress Verksamhet ByggårFastig- hetensursprungsändamålBruks-area(BRA)Entreprenad/uthyrdKommentarerSafiren Fagerhult 2:216 Centrumvägen 22, Vagnhärad Simhall 1991 Simhall 2 498 XRen overa s 20 11- 2 0 14.Kostnader överflyttade tillK&F från TS budget 2013Havsbadet, 18 byggnader Öbolandet 2:1 Trosa havsbad, Edanö, Trosa Fritidsanläggning 1000 XEdanö Gård, 6 byggnader Öbolandet 2:1 Edanö gård Fritidsanläggning 345 XKråmö, 23 byggnader Kråmö Naturreservat 1:4 Kråmö Fritidsanläggning Fritidshus 1896 XGästhamnen, 3 byggnader Trosa 10:1 Fritidsanläggning 226 XHamncafé Ö:a hamnplan 2010 Café 75 XHäradsvallen, 5 byggnader Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning 570 X Nybyggda omkl.rum 2010Häradsvallen, omklädningsrum Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning 2000 Omklädningsrum 279Häradsvallen Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning 221Häradsvallen, förråd Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning Förråd 14Häradsvallen, omklädningsrum Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning 2000 Omklädningsrum 41Häradsvallen, garage Kroka 1:8 Häradsvallens IP, Vhd Fritidsanläggning 2011 Garage 16 Renoverad 2011Skärlagsvallen, 5 byggnader Trosa 11:55 Skärlagsgatan, Trosa Fritidsanläggning 490 XFinska föreningen Lånesta 1:2 Samlingslokal 203 XSocitetshuset Utsikten 5 Alpgatan , Trosa Fritidsanläggning Samlingslokal 225 Säljes 2015?Garvaregården, 4 byggnader Garvaregården 122 V:a Långgatan 40 650 (X)Lånestahallen 1 5 34Summa 10 054Inhyrda lokalerPopulärnamn Fastighetsbeteckning Adress Verksamhet ByggårFastighetensursprungsändamålBruksarea(BRA) Årshyra KommentarerTrosa Kvarn Trosa Kvarn 1 Högbergsgatan, Trosa Fritidsanläggning 1928 220 451980 200+20Ungdomens hus 312 528408Summa 53224


Administrativa lokalerKommunägda lokalerPopulärnamnFastighetsbeteckningAdress Verksamhet ByggårFastig- hetensursprungsändamålBruksarea(BRA) Årshyra KommentarerVita kommunhuset Sjukstugan 9 V Långgatan 4, Trosa Kontor 1890 Sjukstuga 753Likboden Sjukstugan 9 V Långgatan 4, Trosa Uthus 77 rusta till förråd???Gula kommunhuset Fiskekapellet 1,2,4,5 V Långgatan 5, Trosa Kontor 1890 Bostadshus 932Gula kommunhuset, uthus Fiskekapellet 1,2,4,5 V Långgatan 5, Trosa Uthus 126Alphyddan, förskola Kvarnvingen 6 Norrbackag. 1, Trosa 317Nedervåning förskola, övervåning skolkontor ochelevhälsa. Ytan delad med 2Mjölkboden Fiskekapellet 1,2,4,5 V Långgatan 5, Trosa Kontor Uthus 99TOM !! Fixa konferensrum på övervåningen + evförråd nere?VON adm. Predikanten 2 Tomtaklintgatan 2, Trosa Kontor Vårddcentral 305 Flyttad från inhyrdSoc. Adm Predikanten 2 Tomtaklintgatan 2, Trosa Kontor Vårddcentral 457 Flyttad från inhyrdGamla IV Vårdcentralen Gymnasium Vårddcentral 80 Soc från hösten början av 2012 när lokalfix klarSumma 3 065FastighetsinventeringAdministrativa lokalerInhyrda lokalerPopulärnamn Fastighetsbeteckning AdressVerksamhetByggårFastig- hetensursprungsändamålBruksarea(BRA) Årshyra KommentarerResursgruppen Swedbank? Busstorget 5 Kontor 224 91016 krBezo invest. Soc lämnade mars 2012 in iVårdcentralen upphörde 2012-12-31Trosa bibliotek Rådstugan 1 Torget 1, Trosa Bibliotek Rådstuga 536 415 084 kr Hyra uppdat för 2012, köpes förh pågårVhd bibliotek Swedbanks gamla lokal Vhd centrum 240 000 kr Hyra fastställd till 240 000kr, nytt avtal 2013VHD nya bibliotek Torget 1 2013IT-enheten Verktyget 4 Industrig. kontor 139 334 kr Köp?LSS Verktyget 4 Industrig. 315 974 kr Köp?Hälso o sjukvårdsenheten Verktyget 4 Industrig. 160 416 kr Köp?Hemtjänsten Verktyget 4 Industrig. 160 416 kr Köp?Summa 4 667Hyrorna uppdaterade med 2012´s siffror25


Övriga lokalerFastighetsinventeringÖvriga lokalerKommunägda lokalerPopulärnamnFastighetsbeteckningAdressVerksamhetByggårFastighetens ursprungsändamålBruksarea (BRA)Uthyrd avkommunenKommentarerAmbulansen 247 XKroka, 7 byggnader 853 XKorslöt, soptipp, kontor Korslöt 2:59 Korslöt, Vagnhärad Kontor 77 X Trotab bygger nya lokalerStationshuset Norra Husby 1:18 m fl Stationsområdet, Vhd 1917 Stationshus 439 säljes, förh pågårVhd Station, bostadshus Norra Husby 1:18 m fl Stationsområdet, Vhd 1917 Bostadshus 234 X säljes, förh pågårVhd Station, bostadshus Norra Husby 1:18 m fl Stationsområdet, Vhd 1917 Bostadshus 174 X säljes, förh pågårVhd Station, förråd Norra Husby 1:18 m fl Stationsområdet, Vhd 1917 Förråd 51 säljes, förh pågårVhd Station, förråd Norra Husby 1:18 m fl Stationsområdet, Vhd 1917 Förråd 9 säljes, förh pågårTROTAB Världens Ände 1 Uddbergagatan 2, Trosa 1971 Förråd 630 X rivningskontraktTROTAB Världens Ände 1 Uddbergagatan 2, Trosa 1971 Skärmtak 200 X rivningskontraktTROTAB Världens Ände 1 Uddbergagatan 2, Trosa 1985 Pers.utr o förråd 527 X rivningskontraktTROTAB Världens Ände 1 Uddbergagatan 2, Trosa 1985 Skärmtak 281 X rivningskontraktTROTAB Världens Ände 1 Uddbergagatan 2, Trosa 1998 Kontor 144 X rivningskontraktSumma 3 619FastighetsinventeringInhyrda lokalerFastighetens ursprungsändamålUthyrd avkommunenÅrshyra KommentarerPopulärnamnFastighetsbeteckningAdressVerksamhet ByggårBruksarea (BRA)Bomans toalett25 600 krToalett hamnen Danfo 133 704 kr kolla köp?Soc går ur lokalen 2013. InAlkoholterapeut Östra Långgatan 79, Trosa 54 300 kr i IVSteget in, Måsen, OSA Östra Långgatan 79, Trosa Affär/kontor 818 530 451 krSumma 8184 olika avtal!! Ur dec 2013,ny lokal industrigatan2014. Köp?26


TjänsteskrivelseKommunstyrelsenDnr 2012/1372013-02-06KommunkontoretMargareta SmithTel. 0156-520 92Fax. 0156-520 17Margareta.smith@trosa.seRemissvar avseende Finansdepartementets promemoria”Förslag till ändringar i inkomstutjämningen förkommuner och landsting”Förslag till beslutKommunstyrelsen beslutaratt anta förvaltningens förslag till yttrande som sitt eget.__________ÄrendetTrosa kommun har genom 2012-12-19 mottagit en remissförfrågan frånFinansdepartementet om att yttra sig om förslag till ändringar iinkomstutjämningen för kommuner och landsting.Trosa kommun anser att Finansdepartementets förslag till förändringar iutjämningssystemet, vilket i huvudsak baseras på utjämningskommitténs förslag(besvarades i särskild remiss augusti 2011) i huvudsak är godtagbart och att detinförs från 2014.Trosa kommun föreslår dock en fortsatt översyn av kostnadsutjämningens delaravseende löner och kollektivtrafik då resultatet ej speglar kommitténs ambitioner(Trosa kommunens remissvar från augusti 2011).Johan SandlundKommunchefMargareta SmithEkonomichefBilagor1. Remissvar avseende ”Förslag till ändringar i inkomstutjämningen förkommuner och landsting” (Dnr Fi2012/4726), 2013-02-06


2013-02-06FinansdepartementetAvdelningen för kommuner ochstatligt ägande103 33 STOCKHOLMRemissvar avseende ”Förslag till ändringar i inkomstutjämningenför kommuner och landsting”(Dnr Fi2012/4726)SammanfattningTrosa kommun anser att Finansdepartementets förslag till förändringar i utjämningssystemet,vilket i huvudsak baseras på Utjämningskommitténs förslag (besvarades isärskild remiss augusti 2011) i huvudsak är godtagbart för införande från 2014.Trosa kommun föreslår dock en fortsatt översyn av kostnadsutjämningens delar avseendelöner och kollektivtrafik då resultatet ej speglar kommitténs ambitioner (seTrosa kommunens remissvar från augusti 2011)Trosa kommuns synpunkterTrosas synpunkter av Finansdepartementets förslag till förändringar av utjämningskommitténförslag till utjämningssystemetFinansdepartementet förslag avseende sänkt kompensationsgrad i inkomstutjämningför de kommuner och landsting med en skattekraft över 115 procent av riktes skattekraftär acceptabel.Införande av strukturbidrag till kommuner med en skattekraft under 115 procent avriktes skattekraft är acceptabel då det innebär att ingen kommun eller landsting fårett sämre utfall av de föreslagna förändringarna i inkomstutjämningen.Vad ändringen av kostnadsutjämningens delmodell, Barn och ungdom med utländskbakgrund, består i är svårt att utläsa i promemorian varför det är svårt att lämnasynpunkter avseende denna.Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 •E-post: www.trosa.se1


Trosa kommun har liksom andra kommuner svårigheter att översätta de ekonomiskaeffekterna som redovisas i tabellbilagorna till promemorian och jämföra dessa medutjämningskommitténs förslag från 2011. Tabellbilagan baseras på 2012 år utjämningmed utjämningskommitténs förslag och dess effekter baseras på 2011 års utjämning.En adekvat bedömning kan göras först då beräkning har genomförts på grundval av2014 års strukturella förutsättningar. En sådan beräkning kan presenteras av SverigesKommuner och Landsting tidigast under våren 2013.Trosas synpunkter i remissvar till utjämningskommitténs förslag till nytt utjämningssystem,som besvarades i augusti 2011, kvarstår enligt nedan.Den kommunala utjämningen föreslås även fortsättningsvis baseras på en långtgåendeinkomstutjämning, huvudsakligen finansierad av staten, samt en inomkommunalkostnadsutjämning baserad på standardkostnader. Detta är acceptabelt för Trosakommun. De förändringar som Trosa kommun biträder kommenteras inte separat idetta yttrande.Den översyn av faktorer inom kostnadsutjämningen som genomförs framstår på flertaletpunkter som väl motiverad.När det gäller utjämningen av kostnader inom förskola, fritidshem och annan pedagogiskverksamhet är det av stor vikt att den faktiska vistelsetiden speglas i utjämningen,då orter med hög förvärvsfrekvens och höga kostnader för barnomsorg annarsriskerar att missgynnas.Kommittén konstaterar i resonemangen kring inkomstutjämningen att tillväxt sker ilokala arbetsmarknadsregioner. Det är därför ologiskt att kostnadsutjämningen avseendelönekostnader ej baseras enbart på LA-region, utan även på länstillhörighet.Trosa kommun påverkas av detta skäl negativt av utjämningen avseende lönekostnader.Trosa kommun får ett märkbart sämre utfall än de kommuner med vilka viprimärt konkurrerar om arbetskraften med, i södra Stockholms län. Detta är inte acceptabeltför Trosa kommun.Även avseende utjämningen av kollektivtrafikkostnader är kommitténs förslag mindrebra. Kollektivtrafik konstateras i betänkandet vara en viktig källa för att åstadkommatillväxtdrivande regionförstoring. Kommitténs förslag speglar inte detta samband utantar primärt sin utgångspunkt i historiska gränser och strukturer. Utjämningsmodellengynnar inte heller sökandet efter kostnadseffektiva och till stor del avgiftsfinansieradekollektivtrafiklösningar. Trosa kommun underkänner därför förslaget till utjämning avkollektivtrafikkostnader.I övrigt accepterar Trosa kommun förslag till förändringar i utjämningssystemet.Johan Sandlund Ann-sofie Soleby Eriksson (S) Daniel Portnoff (M)Kommunchef Oppositionsråd KS ordförandePostadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 •E-post: www.trosa.se2


Kommunstyrelsen2013-02-01KS2013/19EkonomMathias MöllerTel. 0156-520 12Fax. 0156-520 32Mathias.moller@trosa.seInternkontrollplan för Kommunstyrelsen 2013Förslag till beslutKommunstyrelsen föreslås beslutaatt fastställa Kommunstyrelsens internkontrollplan för 2013att till revisorerna överlämna tjänsteskrivelsen samt internkontrollplanenSammanfattningKommunkontorets projektgrupp för intern kontroll har arbetat fram KSinternkontrollplan för 2013 års verksamheter och räkenskaper.En projektgrupp inom Kommunkontoret arbetade med ramverk för internkontroll för kommunen och internkontrollplan för Kommunstyrelsen undervintern 2009-2010. Deltagare i projektgruppen kommer från enheterna ekonomi,personal, kansli, IT och service. Arbetet resulterade bland annat i en nyinternkontrollplan för Kommunstyrelsen för 2010 samt ”Riktlinjer för attförhindra och upptäcka oegentligheter eller misskötsel i arbetet”. Bådabeslutades av Kommunstyrelsen under våren 2010.En sammanställning av utförda kontroller rapporteras för Kommunstyrelsen eftervarje räkenskapsår i samband med bokslut.Mathias MöllerEkonomBilagor:Internkontrollplan 2013 för Kommunstyrelsen


InternkontrollplanNämnd/förvaltning: Kommunstyrelsen/kommunledningenFör tidsperiod: 2013-01-01 - 2013-12-31Kommunens Internkontrollreglemente och anvisningarna till detta, ligger till grund för denna plan.Resultaten av kontrollerna rapporteras löpande. Rapportering ska ske skriftligt, se reglementet.Rapportering ska göras till Kommunstyrelsen 1 gång per år på genomförda kontroller och dess resultat.Förkortningar: Bedömning risk och konsekvensKC Kommunchef Risk = risk att det inträffarPC Produktionschef Konsekvens = ekonomisk, personell, förtroende om det inträffarEkC Ekonomichef 3Hög risk/allvarlig konsekvensPeC Personalchef 2Måttlig risk/konsekvensKsekr Kommunsekreterare/Kanslichef 1Låg risk/liten konsekvensPsekr PersonalsekreterareRA Redovisningsansvarig * Punkter som markerats med stjärna ska ingåEk Ekonomer i samtliga nämnders internkontrollplanerEk.ass EkonomiassistenterITC IT-chefInf InformatörRutinnummer/rutin Kontroll- Ansvarig Metod Frekvens Rapport Risk Konsmoment tillPolitisk ledning:POL:1 Representation Reglerna följs. EkC Stickprov 1 gång per år KC 2 2POL:2 Rätt arvode Rätt arvode till rätt person. Koll analyslista. Ksekr Komplett 1 gång/mån KC 1 1POL:3 Närvarolistor Närvarolistor hålls tillgängliga med aktuella uppgifter. Ksekr Komplett 1 ggr per år KC 2 1Kanslienheten/Ärendehant:KAN:1 Postöppning Post öppnas och distribueras korrekt i enlighet medsekretessregler och fullmakter.Ksekr Komplett översynav postöppning,2 ggr per år KC 2 1KAN:2 Lagkännedom Kansliets ska ha tillgång till och tillhandahålla relevantoffentligrättslig lagstiftning.Ksekr Kontroll gentemotaktuelllagstiftning.1 ggr per år KC 2 31 G:\Nämnder\Ksau\KSau13\Tjänsteskrivelser\0218\IK-plan KS 2013\Internkontrollplan KS 2013


Rutinnummer/rutin Kontroll- Ansvarig Metod Frekvens Rapport Risk Konsmoment tillKAN:3 Verkställande av fattadebeslut i Ksau, KS och KFAtt ärendet "beslutsuppföljning" genomförs minst tvågånger om året.Ksekr Kontroll gentemotärendeförteckning2 ggr per år FC, KS 1 2KAN:4 Delegering* Att delegeringsordningen är relevant med avseende påkommunkontorets organisation och befattningar m.m.Ksekr Komplettgenomläsning avdelegeringsordningen1 ggr per år FC, KC 1 2KAN:5 Dokumenthantering* Aktuell dokumenthanteringsplan finns och är tillgängligoch relevant.Arkivans. Komplett översynoch genomläsningav befintligaplaner1 ggr per år FC, KC 1 2KAN:6 Information på hemsidorsom administreras av kanslietInformationen är uppdaterad, relevant och informativ. Ksekr Komplettgenomläsning2 ggr per år 1 1KAN:7 Styrdokument beslutade avKS och KF*KAN:7 Styrdokument beslutade av Styrdokumenten hålls aktuella och lättillgängliga. Ksekr Komplett 1 ggr per år FC, KC 2 2Styrdokumenten hålls aktuella och lättillgängliga. Ksekr Komplettgenomgång avgällandestyrdokumentKAN:8 Svarsfrekvens synpunkter Kontroll att synpunkter som kommer viasynpunkthanteringen besvaras inom 7 dagar.Ksekr Stickprov 1 ggr per år KC 1 1Servicenheten:SER:1 Mobiltelefoner Aktuell mobiltefefonpolicy finns. Servicechef Komplett 1 ggr per år KC 2 1SER:2 Nycklar till kommun-husenvid nyanställning och avslutadanställning.Återlämning av nycklar. Servicechef Komplett 1 ggr per år KC 1 2SER:3 Nycklar till lokaler,uthyrningslägenhet samtpassagebrickor.Återlämning av nycklar samt passagebrickor. Servicechef Stickprov 1 ggr per år KC 2 33 G:\Nämnder\Ksau\KSau13\Tjänsteskrivelser\0218\IK-plan KS 2013\Internkontrollplan KS 2013


Rutinnummer/rutin Kontroll- Ansvarig Metod Frekvens Rapport Risk Konsmoment tillSER:4 Leasingbilar och tankkort. Återlämning av nycklar samt tankkort, kvitto och ifyllningav körjournal.Servicechef Stickprov 1 ggr per år KC 2 2SER:5 Passersystem lokalbokning Att relevant förteckning på personer med relavantbehörighet finns samt att passerbrickor återlämnas.Servicechef Stickprov 2 ggr per år FritidsC 2 3Personal:PER:1 Bisysslor * Inventering av bisysslor. KC, PC Vid utvecklingssamtal1 ggr per år KC 2 2PER:2 Arbetsmiljö * Riskanalys och handlingsplan. PeC Komplett 1 ggr per år KC 3 2PER:3 Tillbud och arbetsskador Att rapportering sker enligt fastställda rutiner. Psekr Stickprov 1 ggr per år Resp PC 1 2PER:4 Rehabiliteringsutredning Upprättande och uppföljning av planer. Psekr Stickprov 1 ggr per år PeC 1 2PER:5 Kvittokontroll Att kvitton finns för egna utlägg som rapporteras digitalt. Psekr Stickprov 1 ggr per år Respenh.chef1 1PER:6 Personalkostnader * Rimlighetsbedömning av kostnader för resp. verksamhet. PeC Komplett Vid bokslut KC 1 3PER:7 Rätt lön * Analyslista - Rätt lön till rätt person. Enh.chef Komplett 1 gång/mån PeC, KC 2 2PER:8 Pension Rimlighetsbedömning av pensionsnivån. Psekr Komplett Vid förstapensionsbetalningenPeC 1 3PER:9 Pension Rätt pensionsavgift inbetalas. LönekontoretKorstabeller 1 ggr per år Psekr 1 2PER:10 Behörigheter att attesteralönerapporter och att anställaAttestkontroll mot reglemente. LönekontoretKomplett 2 ggr per år Psekr 1 3PER:11 Korrekt lön i lönesystemet Kontroll av lön i lönesystemet mot anställningsavtal. Psekr Stickprov 3 ggr per år PeC 1 2PER:12 Löneavdrag vid frånvaro Kontroll och att det finns bra fungerande rutiner påKommunkontoret 2013.Psekr Komplett 2 ggr per år Psekr 1 34 G:\Nämnder\Ksau\KSau13\Tjänsteskrivelser\0218\IK-plan KS 2013\Internkontrollplan KS 2013


Rutinnummer/rutin Kontroll- Ansvarig Metod Frekvens Rapport Risk Konsmoment tillEkonomi:EK:1 Attestrutin för skannadefakturor i IMAtt endast personer i attestförteckningen är behöriga attattestera fakturor i IM.EkC Avstämningattestförteckningmot behörigheteri IM1 ggr per år KC 1 2EK:2 Behörigheter samtåterlämning av bankdosor.Att behörigheter avslutas hos banken samt bankdosoråterlämnas.EkC Komplett genomgångav behörigai internetbanken1 ggr per år KC 1 3EK:3 Aktuella dokument hosbankenAtt bankens förteckning över vilka som får tecknakommunens konton är aktuell.EkC Begäraförteckning frånbanken.1 ggr per år KC 1 3EK:4 Nya leverantörer Kontroll av korrekt företag, F-skatt inte med på "svartalistan".RA Stickprov 2 ggr per år EkC 1 3EK:5 Leverantörsbetalningar Fakturabelopp, moms, kontering, F-skatt,organisationsnummer samt betalningsdag. Betalningaröverstigande 20.000 kr som sänds till bankgirot stämmeröverens med fakturaunderlaget.tRA Enl rutin vid varjeutbetalningstillf.Alltid EkC 2 3EK:6 Bokföringsordrar ochinternräkningarAtt orsak till omföringen framgår samt att attest finns. Ek.ass Stickprov 1 ggr per år EkC 1 1EK:7 Utbetalningsordrar Att kvittounderlag överenstämmer medutbetalningsorder.Ek Stickprov 1 ggr per år EkC 1 1EK:8 Kontroller av scannadefakturorKontroll av att ekonomiska reglementet efterlevsgällande: mobiltelefonräkningar, representationskonton,leasingbilar, utbildningar samt kurser.Ek Stickprov 1 ggr per år EkC 1 2EK:9 Kontroll av tankkortsfakturor Kontroll att fakturor stämmer mot kvitton. Ek Stickprov 2 ggr per år EkC 1 2EK:10 Kreditering av kundfakturor Att underlag och beslut finns. Ek.ass Stickprov 1 ggr per år EkC 2 2EK:11 Moms Momsdeklaration upprättas korrekt. RA Komplett 1 ggr permånadEkC 2 3EK:12 Krav Kravåtgärder vidtas i enlighet med policy. RA Stickprov 2 ggr per år EkC 1 25 G:\Nämnder\Ksau\KSau13\Tjänsteskrivelser\0218\IK-plan KS 2013\Internkontrollplan KS 2013


Rutinnummer/rutin Kontroll- Ansvarig Metod Frekvens Rapport Risk Konsmoment tillEK:13 Resursfördelningsmodell Kontroll att resursfördelning till reultatenheter görs enligt fastställda pengbelopp och regler.Ek Enl. rutin 2 ggr per år EkC 2 2EK:14 Kontroll av oegentligheter Kontroll och rimlighetsbedömning avseende inköp ochinköpsvolymer över tid, främst med fokus påprivatkonsumentvänliga produkter.EkC Kontoanalys avrelevanta konton.2 ggr per år KC 2 2IT:IT:1 Datoranvändning Kontroll av kommungemensamma program, licenser. ITC Stickprov 1 ggr per år KC +resp PC2 2IT:2 Behörigheter i AD (ActiveDirectory - kommunens nätverk)Korrekta behörigheter har givits och är dokumenteradeoch rutin för säkerhet införs.ITC Stickprov 2 ggr per år KC +resp PC3 2IT:3 Inköp av mjuk- och hårdvara Inköp kanaliseras via IT-enheten. ITC Enl. rutin 2 ggr per år KC +resp PC3 1IT:4 Datorer i skolorna Kontroll att återanvända datorerna INTE innehåller någraprogram som kräver licens.ITC Stickprov 3 ggr per år KC +SkolC2 2IT:5 IT-säkerhet lösen påITC Komplett 1 ggr per år KC 1 3servrarna Kontrollera att varje server har ett unikt lösenord.Övrigt:Ö:1 Personuppgiftslagen (PuL)* Reglerna i personuppgiftslagen är kända och tillgängliga. PuL-ombud Stickprov 1 ggr per år KC 2 2Ö:2 Personuppgiftslagen (PuL)* Att förteckning enl. §39 PuL är uppdaterad och anmäldtill PuL-ombud.PuLambassadörStickprov 1 ggr per år PuLombud2 26 G:\Nämnder\Ksau\KSau13\Tjänsteskrivelser\0218\IK-plan KS 2013\Internkontrollplan KS 2013


TjänsteskrivelseKommunstyrelsenDnr2013/122013-02-19EkonomienhetenMargareta SmithTel. 0156-520 92Fax. 0156-520 32Margareta.smith@trosa.seUtökad investeringsram för ökade förutsättningarna attsnabbt klara ökat elevantalFörslag till beslutKommunstyrelsen föreslås beslutaatt utöka Teknik- och servicenämndens investeringsram, skattekollektivet, 2013med 3 000 tkr för ombyggnation av slöjdsalarna till klassrumatt finansiera investeringen genom att ianspråkta Kommunstyrelsensinvesteringsreserv som minskas från 25 000 tkr till 22 000 tkrÄrendetElevantalet till en enskild skola kan förändras snabbt och det kan vara svårt, föratt inte säga omöjligt, att bygga ut en skola eller förskola under så kort tid somskulle behövas. Marken i anslutning till tre skolor förbereds för att snabbt kunnafå en paviljong på plats, motsvarande 2 klassrum, om behov uppstår.Investeringsmedlen avser att användas till markarbeten, förbereda VAanslutningar,el, mm.Margareta SmithEkonomichefBilaga:Tjänsteskrivelse från Teknik- och servicenämndenExp till:Teknik- och servicenämndenTekniska enhetenAkten


SammanträdesprotokollTeknik- och servicenämndenTrosa KommunSammanträdesdatum2013-02-14§ 10 Dnr TSN 2013/12Investeringsmedel för att öka förutsättningarna för attsnabbt klara ökat elevantalTeknik- och servicenämnden beslutar föreslåkommunstyrelsen beslutaatt avsätta 3 mkr i investeringsmedel för tre stycken så kallade ”plug in”lösningar vid tre skolområden.ÄrendetTeknik- och servicenämnden har ofta hamnat i situationer som gjort att mansnabbt måste få fram en ny förskola eller bygga om i en skola för att klarasnabba omställningar när elevantalet ändras. Antalet elever förändras inommycket kort tid och det som de gemensamma planeringsförutsättningarna visadeför sex månader sedan gäller inte mer än några månader.I de lägena får ofta teknik- och servicenämnden uppdraget att bygga en förskolaeller bygga om en skola med mycket knappa tidsmarginaler vilket ökar risker förfel och skapar problem för både tekniska och skolan. Genom att förbereda treskolområden med så kallad ”plug in” lösning minimeras sådana risker.En sådan lösning innebär att man gör klart för VA-anslutningar, el och annannödvändig teknisk försörjning så att man kan ställa en tillfällig lösning ianslutning till en skola tills man vet exakt vad som behövs och om det behövspermanent. Dessa snabba lösningar kan också permanentas om så är önskvärt.Ärendets beredningTjänsteskrivelse från produktionschef Claes-Urban Boström och teknisk chef StigTördahl, 2013-02-04.Kopia tillKommunstyrelsenAktenJusterandes signaturUtdragsbestyrkande9


TjänsteskrivelseTeknik- och servicenämndenDnr TSN 2013/122013-02-04Kultur, fritids, teknik- ochservicekontoretClaes-Urban BoströmTel. 0156-520 66Fax. 0156-523 03claes-urban.bostrom@trosa.seÖka förutsättningarna för att snabbt klara ökat elevantalTeknik- och servicenämnden föreslås besluta:att föreslå KS avsätta 3 mkr i investeringsmedel för tre (3) stycken så kallade”plug in” lösningar vid tre skolområden.Snabba omställningarAlltför ofta har vi hamnat i situationer som gjort att vi fått kasta oss in iframtagandet av en ny förskola eller bygga om i en skola för att klara snabbaomställningar när elevantalet ändras. Antalet elever förändras inom mycket korttid och det som de gemensamma planeringsförutsättningarna visade för sexmånader sedan gäller inte mer än några månader.I de lägena får ofta Teknik- och servicenämnden uppdraget att bygga en förskolaeller bygga om en skola med mycket knappa tidsmarginaler vilket ökar risker förfel och skapar problem för både oss och skolan.För att minimera sådana risker och finna en lösning som gör att vi kan vara litemer förberedda vid dessa snabba omställningar vill vi förbereda i ett första skedetre skolområden med så kallad ”plug in” lösning.En sådan lösning innebär att vi gör klart för VA-anslutningar, el och annannödvändig teknisk försörjning så att vi kan ställa en tillfällig lösning i anslutningtill en skola tills vi vet exakt vad som behövs och om det behövs permanent.Dessa snabba lösningar kan också permanentas om så är önskvärt.I denna lösning ingår att vi handlar upp en standardlösning med två klassrum,toalett och övriga tillhörande delar som vi kommer överens om. Dessastandardlösningar finns inte inrymda i de tre miljoner kronor som det kostar attförbereda tre skolområden utan är något som vi tillsammans med skolkontoretmåste återkomma om.Tillsammans med skolkontoret tror vi därför att en lösning enligt ovan kanunderlätta för samtliga inblandade parter så att den extremt kortahandläggningstid som förekommit de senare åren kan hanteras på ett för allabättre sätt. Vi tror även att det är en mycket god strategi för att möta en snabbtillväxt.Claes-Urban BoströmProduktionschefStig TördahlTeknisk chef


SammanträdesprotokollTeknik- och servicenämndenTrosa KommunSammanträdesdatum2013-02-14§ 6 Dnr TSN 2013/3Köp av Hedebyscenen och bryggaTeknik- och servicenämnden beslutar föreslåkommunstyrelsen beslutaatt köpa Hedebyscenen samt bryggan för en (1) krona.ÄrendetHedebyscenen och bryggan vid Betelskyrkan kom till under ett EU-projekt dåHedebygruppen bildades och en rad aktiviteter och arrangemang kom till iVagnhärad. Hedebygruppen har sedan dess skött om dessa anläggningar.Under 2012 tog Hedebygruppen kontakt med förvaltningen om att kommunenskulle överta driften av Hedebyscenen och bryggan då föreningen inte längreorkade ta det ansvaret längre.Trosa kommun kan inte ta på sig driften av någon annans anläggning mengenom att köpa anläggningarna kan kommunen ta över driften. Både scenen ochbryggan kommer att läggas in i underhållsplanen så att de bevaras på bästamöjliga sätt.Ärendets beredningTjänsteskrivelse från produktionschef Claes-Urban Boström och teknisk chef StigTördahl, 2013-02-04.Kopia tillKommunstyrelsenAktenJusterandes signaturUtdragsbestyrkande5


TjänsteskrivelseTeknik- och servicenämndenDnr TSN 2013/32013-02-04Kultur, fritids, teknik- ochservicekontoretClaes-Urban BoströmTel. 0156-520 66Fax. 0156-523 03claes-urban.bostrom@trosa.seKöp av HedebyscenenTeknik- och servicenämnden föreslås besluta:att föreslå KS att köpa Hedebyscenen samt bryggan för en (1) krona.ÄrendetHedebyscenen och bryggan vid Betelskyrkan kom till under ett EU-projekt dåHedebygruppen bildades och en rad aktiviteter och arrangemang kom till iVagnhärad. Hedebygruppen har sedan dess skött om dessa anläggningar och dehar varit uppskattade för Vagnhäradsborna.Under 2012 tog Hedebygruppen kontakt med förvaltningen om att kommunenskulle överta driften av Hedebyscenen och bryggan då föreningen inte längreorkade ta det ansvaret längre. Ordförande Tage Carlssons bortgång under 2012gjorde att mycket av den drivkraft och engagemang för driftfrågor av detta slagförsvann.Trosa kommun kan inte ta på sig driften av någon annans anläggning men vi kansjälvklart köpa dem och därmed ta över driften. I detta fall ser vi detta som enviktig möjlighet för främst Vagnhäradsborna att ha tillgång till både utescenenoch bryggan. Både scenen och bryggan kommer att läggas in i vårunderhållsplan så att vi bevarar dem på bästa möjliga sätt.Förvaltningen och Hedebygruppen är helt överens om villkoren i framtagetköpekontrakt.Claes-Urban BoströmProduktionschefStig TördahlTeknisk chef


Kommunstyrelsen2013-02-19DnrKS2013/34EkonomichefMargareta SmithTel. 0156-520 92Fax. 0156-520 32margareta.smith@trosa.seBeslut om tillfällig utökning av OSA-tjänsterFörslag till beslutKommunstyrelsen beslutaratt tilldela kommunens arbetsmarknadsenhet 300 000 kr förverksamheten rörande OSA (Offentligt Skyddat Arbete) för 2013att medlen överförs från Kommunstyrelsens egen buffert som därmedminskas från 510 tkr till 210 tkrÄrendetNär det gäller OSA kvarstår behovet av de under 2012 äskade medlen förtillfällig anställning för att förhindra långtidsinskrivning inomsocialtjänsten. Målgruppen för OSA har ofta utmaningar i form avmångfacetterad problematik och riskerar, om inte insats sker, att bli kvarinom socialtjänsten.Kommunstyrelsen förfogar över en egen buffert på 510 000 kronor för atthantera oväntade behov och händelser. Kommunstyrelsen har ettövergripande ansvar för arbetsmarknadsfrågor i allmänhet. Det är därförrimligt att kommunstyrelsen även 2013 avsätter 300 000 kronor för attmöta arbetsmarknadsläget. Kommunstyrelsen återstående buffert för2013 blir därmed 210 000 kronor.Johan SandlundKommunchefMargareta SmithEkonomichef


TjänsteskrivelseKommunstyrelsen2013-01-11SamhällsbyggnadskontoretBjörn WieslanderTel. 0156-520 30bjorn.wieslander@trosa.seExploateringsavtal för del av Hillesta 3:1 i VästerljungFörslag till beslutSamhällsbyggnadskontoret föreslårkommunstyrelsen beslutaatt godkänna förslag till exploateringsavtal avseende del av Hillesta 3:1i Västerljung,att uppdra till mark och exploateringschefen underteckna exploateringsavtaletoch i övrigt genomföra avtalet.ÄrendetNy detaljplan har tagits fram för del av Hillesta 3:1. Detaljplanen innebär att 9stycken villatomter kan tillskapas.Förhandlingar har förts med exploatören ägaren till Hillesta 3:1 omexploateringsavtal.Björn WieslanderMark och exploateringschefBilagor1. ExploateringsavtalBeslut till:Björn WieslanderAkten


TjänsteskrivelseKommunstyrelsen2013-02-08SamhällsbyggnadskontoretBjörn WieslanderTel. 0156-520 30bjorn.wieslander@trosa.seExploateringsavtal för del av Tureholm 2:277 vidSmedstorp i TrosaFörslag till beslutSamhällsbyggnadskontoret föreslårkommunstyrelsen beslutaatt godkänna förslag till exploateringsavtal avseende del av Tureholm 2:277 vidSmedstorp i Trosa,att uppdra till mark och exploateringschefen underteckna exploateringsavtaletoch i övrigt genomföra avtalet.ÄrendetNy detaljplan har tagits fram för Tureholm 2:277 mfl vid Smedstorp i Trosa.Detaljplanen innebär att inom nu antagen del för Tureholm 2:277 kan ca 37 nyavillatomter tillskapas för exploatören/fastighetsägaren Ekologiska Byggvaruhuseti Sverige AB.Förhandlingar har förts med exploatören ägaren till Tureholm 2:277 omexploateringsavtal, som innehåller sedvanliga klausuler om gatu- och VAutbyggnadmm inom planområdet.Dessutom skall exploatören till Trosa kommun bekosta del i framtida förbiled vidHunga motsvarande 100.000 kronor per nybildad tomt/bostad samt kostnad förnya VA-ledningar från V.Fän via Västerljungsvägen fram tillexploateringsområdet.Björn WieslanderMark och exploateringschefBilagor1. ExploateringsavtalBeslut till:Björn WieslanderAkten


TjänsteskrivelseKommunstyrelsen2013-02-08SamhällsbyggnadskontoretMats GustafssonTel. 0156-520 27mats.gustafsson@trosa.seFörslag till detaljplan för del av Hillesta 3:1 i VästerljungFörslag till beslutSamhällsbyggnadsnämnden föreslårkommunstyrelsen föreslå kommunfullmäktige beslutaatt anta förslag till detaljplan för del av Hillesta 3:1 i Västerljung.ÄrendetTrosa kommun har aktivt arbetat för att få till stånd en utbyggnad i Västerljung.Eftersom planarbetet vid Björke 3:17 fick avbrytas p g a nya fynd avfornlämningar har kommunen tillsammans med markägare i området samtLänsstyrelsen sökt efter andra alternativ i Västerljung.Samhällsbyggnadsnämnden har tagit fram förslag till detaljplan för rubriceratområde som ligger utmed Hammarbyvägen strax öster om Västerljungssamhälle.Detaljplanen syftar till att möjliggöra totalt 9 nya villatomter.Samhällsbyggnadsnämnden har 2013-01-22, § 10 beslutat att föreslåkommunfullmäktige anta förslag till detaljplan för rubricerat område.Mats GustafssonSamhällsbyggnadschefBilagor1. Förslag till detaljplan för Hillesta 3:12. Protokoll från Samhällsbyggnadsnämnden 2013-01-22, § 10


ANTAGANDEHANDLINGP L A N B E S K R I V N I N GDetaljplan för del av Hillesta 3:1, Västerljung,Trosa kommunUpprättad 2013-01-09SBN 2012/7


2P L A N B E S K R I V N I N Gtillhörande detaljplan för del av Hillesta 3:1, Västerljung, Trosa kommunHANDLINGARTill detaljplanen hör- Plankarta- Planbeskrivning med redovisning om planens genomförande- Fastighetsförteckning- UtställningsutlåtandeDetaljplanen handläggs enligt nya Plan- och Bygglagen, 2010:900.PLANENS SYFTE OCH HUVUDDRAGDetaljplanens syfte är att möjliggöra byggnation av nio småhus utmed Hammarbyvägen.Bebyggelsen ska placeras på de högre partierna i anslutning till vägen med hänsyntill de fornlämningar som finns i närområdet. Gestaltningen tar sin utgångspunkt iden rådande bebyggelsetraditionen i området.TIDIGARE STÄLLNINGSTAGANDENÖversiktsplanerI gällande översiktsplan (ÖP 2010) är delar av området markerat som nytt boendeområde.Där står bland annat att Hammarby är en naturlig fortsättning från Västerljungssamhälle efter utbyggnaden invid Hammarbyvägen och av Björke.PLANDATALäge och arealPlanområdet är beläget nordost om Västerljungs samhälle.Markarealen är cirka 2,5 hektar.MarkägoförhållandenPlanområdet är privatägt liksom intilliggande mark. Hammarbyvägens förlängning ärdragen såväl över kommunal mark som över privatägd mark.DetaljplanerOmrådet är inte planlagt sedan tidigare.FÖRUTSÄTTNINGAR OCH FÖRÄNDRINGARMark, vegetationOmrådet är delvis småkuperat och bevuxet med barrskog med inslag av lövträd. Detsydöstra kvarteret är beläget inom ett hagmarksområde.Geotekniska förhållandenTerrängen utgörs till övervägande del av moränmark med inslag av berg i dagen.Grundläggningsförhållandena bedöms som goda.


3MarkradonOmrådet är beläget inom normalrisk för radon. I samband med detaljplaneläggningenav Björke 3:17 gjordes en markradonundersökning som inte visar på några förhöjdanivåer.KulturminnesvårdPlanområdet ligger inom en mycket fornlämningsrik miljö. I dess direkta omgivningfinns den lagskyddade fasta fornlämningen Västerljung 2:1, 285 m fl, stensättning ochgravfält med cirka 90 synliga gravanläggningar samt gravarna Västerljung 3, 263 och264. Det sydöstra kvarteret gränsar direkt till fornlämningsområdet Västerljung 6:1.I samband med att ett tidigare planprojekt skulle byggas ut, Björke 3:17, upptäcktesnya fornlämningar vilket gjorde att planen helt avslutades. Mot bakgrund av detta undersökteTrosa kommun tillsammans med Länsstyrelsen i Södermanland alternativalokaliseringar i Västerljung för bostäder. Utifrån detta gjordes en särskild utredningnordöst om Björke 3:17 på Hillesta 3:1. Resultatet från undersökningen låg därefter tillgrund för avgränsningen av de nu föreslagna bostadskvarteren.Bebyggelse och andra ingrepp som väg- eller ledningsdragning får ej ske inom fornlämningeller dess skyddsområde. Kvarteren har som tidigare nämnts avgränsatsmed hänsyn till fornlämningarna och dess skyddsområden. Inom skyddsområdet ärbebyggelse, andra anläggningar eller markarbeten som kan skada fornlämningen intetillåtna.Om fornfynd eller fornlämning påträffas ska arbetet omedelbart avbrytas och anmälangöras till länsstyrelsen. Några ytterligare arkeologiska åtgärder behöver inte görasinom planområdet vid genomförandet av detaljplanen.Ny bebyggelsePlanen medger 9 villatomter för småhus i 1 med möjlighet att inreda vinden. Tomtstorlekvarierar från ca 1000 – 1900 m 2 . Bostäderna placeras med husen nära en ”byväg”och uteplatser på trädgårdssidan.Byggnadsutformning, utemiljöBebyggelsen kommer att bli synlig i landskapet och med sitt friliggande läge. Som enintegrerad del av fornlämningsområdet kommer den även att påverka upplevelsen avdetta. Planbestämmelserna innehåller därför utformningsanvisningar beträffande färgsättning,i syfte att ge området en sammanhållen karaktär även med individuellt formade”kataloghus”. Byggnadshöjden begränsas till 6,0 meter och 8,5 m i totalhöjd.Det är önskvärt att fasaderna utförs enhetligt av träpanel och färgsätts med röd slamfärg,som ger en god anknytning till kulturlandskapet. Takvinkeln utförs mellan 27 och36 grader. Takbeläggning utförs med tegelröda takpannor.För bostadshus i det södra kvarteret bör minst en uteplats placeras i riktning motHammarbyvägen så att bostadshusen fungerar som avskärmning från järnvägen.Detta gäller så länge Södra stambanan är i drift.TillgänglighetOmrådet har god tillgänglighet för personer med nedsatt rörelse- eller orienteringsförmåga.Tillgänglighetskraven kan uppfyllas.


4GatunätLokalgatan förlängs från Hammarbyvägen i Västerljungs samhälle. Respektive bostadskaraktärhar en mindre lokalgata som slutar i en vändplan där fastigheterna ärplacerade.ParkeringAll parkering sker inom tomtmark.Gång- och cykeltrafikGående och cyklister är hänvisade till det befintliga vägnätet. Trafiken bedöms inteöka i en sådan utsträckning att separata gång- och cykelvägar behöver byggas ut.Avståndet till centrala Västerljung är ca 500 m. Hammarbyvägen mellan planområdetoch Västerljungs samhälle kommer även när planområdet är utbyggt vara sparsamttrafikerad och trafikmiljön kommer att erbjuda såväl en trygg väg till förskola och skolasom goda möjligheter till passage mellan bostäderna för barn som bor i området.ServiceSkola och förskola finns på gång- och cykelavstånd i samhället. Övrig kommersielloch offentlig service finns i Vagnhärad och Trosa.KollektivtrafikVästerljung trafikeras av regionala busslinjer. De två hållplatserna längs Västerledentäcker huvuddelen av den befintliga orten. Planområdet ligger ca 800 meter från närmastebusshållplats.GrönområdenDe nya bostäderna kommer att ha god tillgång till naturmark i den närmaste omgivningen.Teknisk försörjningVA och dagvattenLedningar för kommunalt vatten och avlopp utförs i gatumark och ansluts till befintligavatten- och spillvattenledningar i Västerljung.Dagvatten ska infiltreras, och ska om möjligt omhändertas inom tomtmark i enlighetmed kommunens VA-policy.EldistributionEn högspänningsledning går längs planområdets nordvästra gräns. För den nya bebyggelsenläggs ledningar i gatumark.Tele- och fibernätFör den nya bebyggelsen läggs ledningar förslagsvis i gatumark.UppvärmningByggnader ska vara utformade så att energiförbrukning minimeras. För att underlättakonvertering till alternativa värmekällor ska byggnaderna förses med lämpligt värmesystem,exempelvis ett vattenburet system. Utnyttjandet av förnyelsebara energikällorska eftersträvas för att möjliggöra en långsiktig ekologisk hållbar uppvärmning. I de fallfjärrvärmeanslutning är möjlig bör detta eftersträvas.Störningar


5I närheten av planområdet passerar södra stambanan. Sträckan är kurvig vilket göratt hastigheten är begränsad till 70 km/h. Banan trafikeras av knappt 30 persontåg/dygnsamt ett fåtal godståg/dygn. En stor del av tågtrafiken har letts om via Västrastambanan med tanke på banans låga kvalitet och det är i princip uteslutande regionalapendeltåg mellan Norrköping/Nyköping och Stockholm som trafikerar sträckan.En bullerutredning har gjorts för planområdet. Undersökningen visar att vare sigHammarbyvägen eller Södra stambanan genererar störningar i någon större utsträckningsom gör att de riktlinjer som finns äventyras. Samtliga bostäder får en ekvivalentljudnivå vid fasad som understiger 55 dB(A). Beräkningar har även gjorts avmaximal ljudnivå för planområdet. Den visar att i det sydöstra kvarteret har en föreslagenfastighet värden mellan 71-75 dB(A) och två fastigheter har värden mellan 76-80 dB(A). Detta innebär t ex att att minst en uteplats uteplatser bör anläggas medhuset som avskärmning.Boende inom planområdet i framtidenPlanområdet invid Hammarbyvägen erbjuder en kvalitativ miljö med frisk luftoch få miljöstörningar i ett ljust läge. Inom området finns goda möjligheter tillrekreation och friluftsliv. Västerljung har, förutom strövområden och rikakulturmiljöer, också närhet till golfbanor och andra friluftsanläggningarsamt närhet till kust och hav för bad- och båtliv.Området är utformat för att vara barnvänligt. Planområdet ger goda kontaktmöjligheterför de boende vilket gynnar såväl barn som vuxna. Sociala nätverklokalt ökar möjligheterna för en trygg och säker omgivning.Tryggheten i området bygger bland annat på att människor har lätt för att lärakänna igen varandra men också lära känna varandra. Igenkännandet byggersociala nätverk och bryggar över generationsgränser. För barn är det en trygghetatt vuxna finns i utemiljön och har ett öga på leken. För vuxna är det en trygghetatt känna de barn som är ute i näromgivningen. Området har bebyggelsen samladi kvarter som har god kontakt med fönster och entréer. Det ska göra att mankänner sig trygg när man rör sig i området, inte minst kvällstid.Området är planlagt för att vara tillgängligt för alla oavsett exempelvis bakgrund,kön eller ålder. Bostäderna utformas så att de viktigaste funktionerna är tillgängligaför rörelsehindrade.Miljökonsekvensbeskrivning och behovsbedömningEn behovsbedömning har gjorts av kommunen, som bedömer att planen inte innebärnågon betydande miljöpåverkan som avses i miljöbalken 6 kap. En särskildmiljökonsekvensbeskrivning upprättas därmed inte.


6REDOVISNING AV GENOMFÖRANDET OCH DESS KONSEKVENSERTidplanBeslut om samråd Samhällsbyggnadsnämnden oktober 2012Samrådstid oktober – november 2012Granskning vinter 2012/2013Antagande Kommunstyrelsen/fullmäktige våren 2013Laga kraft våren 2013Planarbetet bedrivs med normalt planförfarande enligt ovanstående tidplan. Den ärpreliminär och kan komma att justeras under arbetets gång.GenomförandetidGenomförandetiden är tio (10) år räknat från den dag planen vunnit laga kraft. Genomförandetideninnebär att ändras eller upphävs planen före genomförandetidenhar fastighetsägaren rätt till ersättning för den skada denne åsamkas. Efter genomförandetidenfortsätter detaljplanen att gälla med dess byggrätter men ändras ellerupphävs planen finns det ingen rätt till ersättning för de byggrätter som går förlorade.Ansvarsfördelning och huvudmannaskapKommunen är inte huvudman för vägar och gemensamma ytor inom planområdet.Planområdet är perifert beläget i anslutning till Västerljungs tätort. I sambandmed planens genomförande ska gemensamhetsanläggning inrättas för den nya lokalgatansamt även för tillfartsvägarna till bostadskvarteren. Gemensamhetsanläggningenför lokalgatan/Hammarbyvägen ersätter gamla servitut och rättigheter förtillfartsväg till intilliggande fastigheter.Mark-, exploaterings- och avtalsfrågor, bygglovansökan och därmed enligt Plan- ochbygglagen förenliga moment handläggs av Samhällsbyggnadskontoret på TrosakommunVatten och avlopp ansluts vid den punkt kommunen anvisar. Anslutande ledningarutanför planområdet samt ledningsnätet inom området byggs ut i enlighet medkommunens standard av exploatör/fastighetsägare samt lämnas sedan över tillkommunen respektive den gemensamhetsanläggning som därefter tar över drift ochunderhåll av nätet utanför respektive inom planområdet. Frågor som rör utbyggnadav vatten- och avloppsnätet handläggs av Tekniska enheten vid Trosa kommun.Vattenfall Eldistribution AB ansvarar för elnätet och planområdet ansluts i enlighetmed nätägarens instruktion. Telia Sonera AB ansvarar för telenätet. Kostnadenoch ansvar för genomförandet åvilar exploatören/fastighetsägaren.Exploatör/fastighetsägare ansvarar för alla byggnader och anläggningar inomkvartersmark.Nybyggnadskarta beställs av Metria, Katrineholm, eller den som för tillfället ärkommunens mät- och kartentreprenör.Lantmäteriförrättningar föranledda av aktuell detaljplan hanteras av LantmäterimyndighetenSödermanlands län. Det är exploatören/fastighetsägaren som initieraroch bekostar de fastighetsrättsliga åtgärder som planen redovisar.


7I samband med utbyggnad av det kommunala vatten- och avloppsnätet förberedsför framtida fibernätsanslutning. Planområdet ansluts till tele i enlighet med nätägaresinstruktioner. Kostnad och ansvar för genomförandet åvilar exploatören/fastighetsägaren.AvtalKostnader för upprättande och genomförande av detaljplanen åvilar berörd fastighetsägare.Planavgift ska ej tas ut vid bygglov. Kostnader för bygglov debiterasenligt taxa. I samband med planens antagande tecknas ett exploateringsavtalmellan Trosa kommun och fastighetsägaren.Trosa 2013-01-09SamhällsbyggnadskontoretLinda AxelssonPlanchef


SammanträdesprotokollSamhällsbyggnadsnämndenTrosa kommunSammanträdesdatum2013-01-22§ 10 Dnr SBN 2012/7Detaljplan för del av Hillesta 3:1Samhällsbyggnadsnämnden beslutaratt godkänna förslag till granskningsutlåtandeatt efter revidering godkänna förslag till detaljplan och därefter skicka planenvidare till kommunstyrelsen och kommunfullmäktige för antagandeÄrendetTrosa kommun har aktivt arbetat för att få till stånd en utbyggnad i Västerljung.Eftersom arbetet vid Björke 3:17 fick avbrytas p g a nya fynd av fornlämningarvilket resulterade i en omfattande arkeologisk undersökning har kommunentillsammans med markägare i området samt Länsstyrelsen sökt efter andraalternativ i Västerljung och dess närområde.En första arkeologisk undersökning har gjorts och av de områden som var aktuellafrån början återstår två. Dessa har nu bearbetats och ett planförslag har arbetatsfram. Detaljplanen föreslår en utbyggnad av totalt nio bostäder i två kvarter.Bostäderna är lokaliserade utmed Hammarbyvägen och ska utformas i traditionellsörmländsk stil. Ett justerat förslag till detaljplan har granskats och efter revideringföreslås detaljplanen nu godkännas och slutligen antas av kommunfullmäktige.Planen handläggs med normalt planförfarande.BeredningSamhällsbyggnadsnämndens protokoll, 2012-03-13, § 33Samhällsbyggnadsnämndens protokoll, 2012-10-23, § 104Samhällsbyggnadsnämndens protokoll, 2012-12-04, § 118Kopia tillAktenJusterandes signaturUtdragsbestyrkande12


TjänsteskrivelseKommunstyrelsen2013-02-08SamhällsbyggnadskontoretMats GustafssonTel. 0156-520 27mats.gustafsson@trosa.seFörslag till detaljplan för Tureholm 2:277 mfl(Smedstorp) i TrosaFörslag till beslutSamhällsbyggnadskontoret föreslårkommunstyrelsen föreslå kommunfullmäktige beslutaatt anta del av förslag till detaljplan för Tureholm 2:277 mfl (Smedstorp) i Trosatill den del som omfattar fastigheterna Tureholm 2:277, 2:362 och 2:363rödmarkerat område enligt bifogad karta.ÄrendetSamhällsbyggnadsnämnden har tagit fram förslag till detaljplan för rubriceratområde som ligger nordväst om centrala Trosa. Det är en del av en iöversiktsplanen utpekad förlängning av Trosa tätort utmed Västerljungsvägen.Detaljplanen syftar till att i sin helhet möjliggöra totalt ca 100 nya bostäder.Bebyggelsen ska i huvudsak bestå av småhus i form av villor, kedjehus ochradhus.Planprocessen har bedrivits parallellt med utredningsarbetet för Förbifart Trosavarför en del av planområdet utmed Hungavägen och Västerljungsvägentillsvidare är undantaget från antagande. Dessutom undantas från antagandeexploateringsfastigheten Tureholm 2:355 som omfattar planområdets nordöstradel eftersom exploateringsavtalet för denna del ännu ej är klart.Samhällsbyggnadsnämnden har 2012-12-04, § 115 beslutat att föreslåkommunfullmäktige anta förslag till detaljplan för rubricerat område.Mats GustafssonSamhällsbyggnadschefBilagor1. Karta med rödmarkerat område av detaljplanen som skall antas2. Förslag till detaljplan för Tureholm 2:277 m.fl. (Smedstorp)3. Protokoll från Samhällsbyggnadsnämnden 2012-12-04, § 115


1I224743LM 2:3552:277TUREHOLM TUREHOLM 2 2:355 2:3555HUNGA 1:2I1461514TUREHOLM 2:1T36351114X=653250323130X=6532403130X=65323X=653222118 191720X=6532156 826 m 2 1 961 m 22 179 m 2352 102 m 21:800 (A1 )4,54,522111g11112IIIIBuIKHCIIIIIIPLANBESTÄMMELSERSe bilaga.Del av detaljplanen somej tas upp för antagande.GRANSKNINGSHANDLING 2013-02-04Till planen hör:PlanbeskrivningGenomförandebeskrivningFastighetsförteckningIllustrationsplanBilaga till detaljplanTureholm 2:277, 2:355, 2:362 och 2:363Trosa kommunAntagandehandlingBeslutsdatum BeslutsdatumSamrådSBN 2012-03-13, § 35GranskningUpprättad 2012-09-27SBN 2012-09-11, § 75UtställningLinda AxelssonplanchefBengt Smidemanarkitekt SAR/MSA, Tekn DGodkännandeAntagandeLaga kraft00 o9,011II6,09,51KHC16,5g111III9,59,56,51114,5u1II8,5u8,011,018,0111IIg116,516,59,53,08,011119,58,019,59,5I4,54,54,51IIMETERfornlämninguIuuuu111111B4 II 9,5n1 v1 f3e1 150e5 30292816151424482347n146g245B2II8,0 18,5 1214420g546n1 f3e1 150e4 800e5 30n1 f34519e1 150e4 800431843464245v1 f3e1 100e4 400e5 304140n1 n3 f1 f2 v2 v3e2 130/300e4 800e5 30n13938424140g33738272539 3924232221201916f3 v4e3 300e5 100n1 v1 f3e1 150e4 800e5 30g137181715B3 IIE13620BIIe5 50g1e5 50n1 v1 f4e1 150e4 800e5 30n4 g2g2B235n33433f3e3 150e4 800f3 e1 100e4 300f3 e1 100e4 3006,5 132353136g2383730E22129e3 100E24039g1n1 v1 f4e1 150e4 800g12841L14227n1 n3 f1 f2 v2e2 130/300e4 800e5 30B226e5 302524n1 n3g4 e3 18022e6 3g22343B2 II21e6 24242B4 II162018181719v1 f3 e1 100e4 400 e5 150194117v1 f3e1 100e4 400n2 g3e3 3043g1g2e3 150154014391638n13736B2n1I g1n1 v1 f4 e1 180g2e4 800 e5 30351343e6 2n1 n34342n1 v1 f3e1 100e4 40040n1 n34125262728n1g11539TUREHOLM 2:36316 1617B4e6 1B4 II38e6 22:362n1 n3n1 n3e3 140e5 40 f1 f3e1 150n537e5 30 e7B1B IIL134n1 n3e6 233g332g4 e3 1801231g1e6 4n1Ie3 30g332 33v1 f3e1 150e4 800e5 3030g1312930n128g11127g2263022I e3 50E2n1 n3g1282321e6 325g124n1182322n1 n320172120191619181716B2n1 n318n1 n31115172615B1e6 32514161413L1g1e6 4242212f1 e1 10020151811e4 300141611131510e3 200 n2 g314n1 n3109I e3 200g1n1 n313I e3 2001210N12161215(A1)11II e3 500n1 g2101013Y=121900129118eskrivning enl HMK-ka.upprättad av Kartenheten Nyköpings kommun0 10 20 30 40 50 60 70 80 90 100


PLANBESTÄMMELSERFöljande gäller inom områden med nedanstående beteckningar. Där beteckning saknas gällerbestämmelsen inom hela planområdet. Endast angiven användning och utformning är tillåten.GRÄNSBETECKNINGARPlanområdets gränsAnvändningsgränsEgenskapsgränsIllustrationslinje som visar avgränsningen avfornlämningsområdetANVÄNDNING AV MARK OCH VATTENB Bostäder får uppföras som friliggande enbostadshusB1Bostäder får uppföras som friliggande enbostadshus på stolpar alternativt suterränghusB2 Bostäder i kedjehus eller radhusB3 Bostäder i flerbostadshusB4 Bostad i högst en huvudbyggnad på högst en fastighetE1 VärmeanläggningE2 TransformatorstationKHC Kontor, handel, servering, service, övernattning, förskolaL1 Grönyta för odlingslotter, lek, djurhållning, dagvattendamm, pumpstationUPPLYSNINGARFornlämningar skyddas enligt 2. Kap KML. Enligt 6 § KML är detförbjudet att utan tillstånd från Länsstyrelsen göra ingrepp i markeninom fornlämningen. Markingrepp inom fornlämningsområde kräveringa ytterligare tillstånd eller undersökningar. Bebyggelse inomfornlämningsområdet ska utformas med hänsyn till intilliggandefornlämning.BEGRÄNSNINGAR AV MARKENS BEBYGGANDEg 1g 2g 3g 4g 5uMarken får inte bebyggas.Marken får endast bebyggas med uthus och garage/carport.Marken ska vara tillgänglig för gemensamhetsanläggning, vägar och gång- och cykelvägar.Marken ska vara tillgänglig för gemensamhetsanläggning, naturområde.Marken ska vara tillgänglig för gemensamhetsanläggning, anlagd mark för odling, lek, infiltrationoch angränsande verksamheter.Marken ska vara tillgänglig för gemensamhetsanläggning, för garage, carport eller öppen parkering.Marken ska vara tillgänglig för gemensamhetsanläggning för underjordisk ledningMarken ska vara tillgänglig för underjordiska ledningar.MARKENS ANORDNANDEn 1 Träd med en stamdiameter överstigande 25 centimeter och 1,3 meter över mark får ej fällas utan marklov.n 2 Marken ska möjliggöra infiltration av dagvatten.n 3 Tomtmark under och runt byggnad ska lämnas som naturmark och får inte vidare exploateras.Staket eller annan markering av tomtgräns får inte uppföras.n 4 Marken får inte förändras utan föregående arkeologisk undersökning.Körbar utfart får inte anordnasPLACERING, UTFORMNING, UTFÖRANDESuterrängvåning får anordnas endast om det ej är hus på stolpar samt om byggnadsytan är högst 130 m 2 .0,01Högsta tillåtna totalhöjd till nock.0,0Högsta tillåtna totalhöjd till nock exklusive suterrängplan mätt från underkan isolerat bjälklag vid2 stolphus alternativt mätt från underkant bjälklag på våningsplan vid suterränghus.I-II Högsta antal våningar.f 1 Dominerande del av fasad ska utföras i trä. Dova kulörer som tar upp naturens färgskala på plats skaeftersträvas.f 2 Räcke får uppföras på tak i fasadliv utöver högsta tillåtna byggnadshöjd.f 3 Fasader ska utföras i trä. Kulörer ska vara varierande samstämda och inte alltför grälla eller alltför dova.f 4 Fasader ska uppföras i trä med en nedtonad färgsättning.v 1 Suterrängvåning ska anordnas.v 2v 3 Utöver angiven byggrätt får tilläggsvåning om 30 m 2 med högsta höjd om 3 meter anordnas samt enöppenarea under tak om 30 m 2 .v 4 Vindsvåning får uppföras med förhöjd takfot till max 1,4 meter.Inom hela området gäller att garage/carport ska ligga minst 6,5 meter från väg. Huvudbyggnad placeras minst 4,5 meter frånfastighetsgräns med undantag för stolphus och radhus. Uthus placeras minst 1,5 meter från fastighetsgräns.UTNYTTJANDEGRADe 1 Största byggnadsarea per bostad.e 2 Största tillåtna byggnadsarea för suterränghus/största tillåtna byggnadsarea för stolphusvarav minst 50 m 2 ska vara öppenarea.Största byggnadsarea.e 3e 4e 5e 6e 7Minsta tillåtna tomtstorlek.Största tillåtna byggnadsarea för garage/uthus.Största tillåtna antal fastigheter/huvudbyggnader.Området får endast avstyckas till två fastigheter.ADMINISTRATIVA BESTÄMMELSERGenomförandetiden är tio (10) år från den dag planen vinner laga kraftKommunen är inte huvudman för allmän plats.Till planen hör:PlanbeskrivningGenomförandebeskrivningFastighetsförteckningIllustrationsplanBilaga till detaljplanUpprättad 2012-09-27Linda AxelssonplanchefTureholm 2:277, 2:355, 2:362 och 2:363Trosa kommunBengt Smidemanarkitekt SAR/MSA, Tekn DAntagandehandling 2012-11-07BeslutsdatumSamrådSBN 2012-03-13, § 35GranskningSBN 2012-09-11, § 75UtställningGodkännandeAntagandeLaga kraftBeslutsdatum


TROSA KOMMUNSamhällsbyggnadskontoretANTAGANDEHANDLING 2012-11-07PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362 och 2:363, Trosa kommunDnr 2010/146Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post: trosa@trosa.se


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun2INNEHÅLLSFÖRTECKNING


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun3PLANBESKRIVNINGPLANHANDLINGARTill denna detaljplan hör:• Detaljplanekarta med bestämmelser• Denna planbeskrivning med genomförandebeskrivning• Illustrationsplan• Fastighetsförteckning• Arkeologisk undersökningDetaljplanen handläggs enligt nya PBL 2010:900.BAKGRUNDPlanområdet är utpekat som utvecklingsområde för tätorten Trosa. Fastighetsägarnaär intresserade av att genomföra en utbyggnad med främst bostäder.En byggnad finns relativt nyligen uppförd med ekologiska förtecken. En ambitionär att den tillkommande bebyggelsen ska vara långsiktigt ekologiskt ochsocialt hållbar.PLANENS SYFTE OCH HUVUDDRAGPlanen syftar till att möjliggöra i första hand cirka 100 bostäder men ocksåandra verksamheter i begränsad omfattning. Bebyggelsen ska i huvudsak beståav småhus i form av villor, kedjehus och radhus. En herrgårdsliknandeflerbostadsvilla ingår också. Bebyggelsen är grupperad som två bybildningarmed gemensamma ytor för odling, djurhållning, lek med mera. Bebyggelsen ärtill stor del anpassad till terrängen som är mycket varierande inom planområdet.BEHOVSBEDÖMNINGSmedstorp har i viss utsträckning redan utnyttjats för boende, såväl tidigaresom på senare tid. Delar av den tillkommande bebyggelsen ska ställas på pelareför att minska ingreppen i terrängen. Vägar och byggnader ska generelltfölja topografin för att begränsa ingreppen. Byggnaderna kommer att uppförasi material som begränsar påverkan på miljön.Vid utbyggnaden ska hänsyn tas till befintliga dagvattenflöden. I enlighet medkommunens VA-policy ska dagvatten infiltreras lokalt i största möjliga mån. Storadelar av ängsmarken kommer att behållas och delvis odlas.Planområdet är i den kommunövergripande översiktsplanen utpekat somlämpligt för utvecklingen av Trosa tätort. Det ligger på cyklingsavstånd frånstadskärnan och viss kollektivtrafik passerar området på den intilliggande Västerljungsvägen.En behovsbedömning har gjorts av kommunen, som bedömer att planen inteinnebär någon betydande miljöpåverkan som avses i miljöbalken 6 kap. En särskildmiljökonsekvensbeskrivning upprättas därmed inte.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun4PLANDATALäge, avgränsning och arealPlanområdet ligger nordväst om centrala Trosa. Det är del av en planerad förlängningav tätorten utmed Västerljungsvägen. Det är cirka två kilometer tillcentrala Trosa. En kilometer rakt söderut ligger Tureholms slott. Ytterligare enkilometer söderut ligger golfbana. Norr och väster om planområdet finns ettnaturparti som är strövområde där Sörmlandsleden passerar. Direkt öster omplanområdet går idag Hungavägen. I anslutning till den planeras en ny vägförbindelsemed direktkontakt med Ådavägen, infarten till Trosa samt med norradelen av Trosas tätort. De norra delarna av fastigheterna detaljplaneläggs inteutan behålls som naturområde. Planarealen uppgår till cirka 14 ha.Karta med planområdet och centrala TrosaMarkägoförhållandenPlanområdet är uppdelat i fyra fastigheter varav två mindre fastigheter är bebyggdamed ett fritidshus respektive en villa. De övriga två fastigheterna utgörstörre delen av planområdet och det är där den kommande exploateringen ärföreslagen. Den ena ägs av privatpersoner och den andra av ett mindre fastighetsbolag.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun5GÄLLANDE PLANER OCH TIDIGARE STÄLLNINGSTAGANDENRiksintressenDirekt söder om planområdet finns ett riksintresse som avser kulturmiljönkring Tureholms slott. Herrgårdsmiljön från övergången mellan barock- ochrokokostil är arkitektoniskt intressant. Miljön från 1730-talet är symmetrisktuppbyggd där den långa allén bildar en mittaxel. Den dominerande mangårdsbyggnadenliksom flyglar och ekonomibyggnader är i karolinsk stil efterritningar av Carl Hårleman. Även flyglar och ekonomibyggnader finns i direktanslutning. Tureholm skyddas som byggnadsminne sedan 1987.I anslutning till planområdet norrut och västerut går Sörmlandsleden. Desssträckning påverkas inte av den tillkommande bebyggelsen och är inte klassatsom riksintresse. Dessutom är området klassat som riksintresse för friluftsliv,högexploaterad kust samt det rörliga friluftslivet. Genom sin närhet till denopåverkade Sörmlandsleden samt områdets läge i förhållande till kusten bedömsdessa riksintressen inte påverkas av ett genomförande av detaljplanen.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun6ÖversiktsplanEnligt översiktsplanen för Trosa kommun, antagen juni 2010, är planområdetföreslaget som nytt boendeområde. Bebyggelsen förutsätter att Förbifart Trosabyggs.Under rubriken Smedstorp står det: ”I takt med att formerna för FörbifartTrosa börjar bli tydliga finns det nu förutsättningar att lägga ut mark för tänkbarexploatering även på den västra sidan av Trosa stad. I steg ett föreslås envidareutveckling på sydvästsluttningen i anslutning till Västra Fän i riktningmot Smedstorp. Ambitionen är att skapa ett spännande, naturanpassat boendemed huvudsakligen enfamiljshus. Avgränsningen i öster och norr är anpassadtill det fördjupningsarbete avseende Hunga strövområde som Samhällsbyggnadsnämndensedan tidigare godkänt. Spillvatten ansluts till den allmännaVA-anläggningen vid korsningen Västerljungsvägen/Malmvägen. Påsikt kan eventuellt ny bebyggelse även väster om utpekat tillväxtområde bliaktuell. All bebyggelse i området förutsätter dock att Förbifart Trosa byggs.Motiv till bebyggelse: Området bygger på ett naturligt sätt vidare på det befintligaTrosa. Områdets karaktär stämmer väl överens med ambitionen atttillskapa nya boendeområden på attraktiva platser, med hänsyn tagen tillkringliggande naturområden.”Generellt är det också möjligt med inblandning av icke störande verksamheter iboendeområden.Del av markanvändningskarta ur Översiktsplan 2010 med markering för framtida förbifart.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun7Detaljplaner och förordnandenOmrådet är inte tidigare detaljplanelagt.Kommunala beslutDen 1 juni 2010, § 74, beslutade Samhällsbyggnadsnämnden om planuppdrag förSmedstorp, dvs Tureholm 2:277, 2:355, 2:362 samt 2:363.PLANERINGSFÖRUTSÄTTNINGARLandskapskaraktärer och vegetationOmrådet är mycket kuperat med omfattande höjdskillnader i de olika delarna.Stora delar har berg i dagen eller berg under ett tunt lager av moränlera. Ettstråk från nordost till sydväst innehåller ett tjockare lager av glacial lera. Denhar varit brukad och är fortfarande öppen ängsmark. Övriga delar är bevuxetmed en blandning av löv- och barrskog. Björk och asp är vanligt förekommandesamt tall med inslag av gran och en. Ett fåtal träd är skyddsvärda menträdridåer är på flera ställen viktiga att bevara.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun8Fornlämningar/kulturmiljövärdenDet finns en viss sannolikhet för att okända fornlämningar kan förekomma sålänsstyrelsen har beslutat, med stöd av 2 kap 11 § lagen (1988:950) om kulturminnenmm KML, att en särskild arkeologisk utredning ska utföras parallelltmed detaljplanearbetet. Provgrävningar i områdets högre belägna delar har visatpå lämningar efter förmodade boplatser. Ett område har avgränsats vilket inte fårbebyggas eller förändras utan föregående arkeologisk undersökning.NaturvärdenOmrådet har inga skyddade områden, identifierade biotoper eller andra klassadenaturvärden. Det finns dock ändå naturvärden som bör bevaras vid exploatering.Dels är det de öppna ängsmarkerna och dels är det en del av trädbeståndetpå höjdpartierna. I norr och väster passerar Sörmlandsleden så det ärvärdefullt att naturen närmast den är intakt. Inom området i SÖ har arten StorBockrot påträffats, klassad som NT, nära hotad, av ArtDatabanken. Verksamhetsområdetinvid dagens Hungaväg har anpassats utifrån kända lokaliseringar avStor Bockrot. Några övriga kompensationsåtgärder bedöms inte nödvändiga.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun9Befintlig bebyggelseOmrådet har idag ett högt beläget bostadshus för åretruntboende. Det är relativtnybyggt och har en ekologisk profil med sunda material och solvärmepaneler.Inom planområdet finns också ett relativt nytt fritidshus av mer traditionelltyp på en lägre kulle. Ett mindre äldre hus finns också med enkel fritidshusstandardi områdets norra del vid en av ängsmarkerna. I anslutning tilldet finns även små uthus.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun10Närmiljö och rekreationOmrådet ligger granne med bland annat Hunga strövområde där bland annatSörmlandsleden passerar. Norrut och till viss del även öster- och västerut finnspopulära bär- och svampskogar samt även närströvområden för såväl intilliggandebostadsområden som föreningar och skolor i kommunen. Direkt söderutfinns ett stort område som är riksintressant för friluftsliv. Det är bland annatstrandområdet utmed Tureholmsviken.Vattenkvalitet, skyddsområde för vattentäkt etc.Planområdet ligger inte inom skyddsområde för vattentäkt. Den tillkommandebebyggelsen ska anslutas till det kommunala vatten- och avloppsnätet. Dagvattenska tas omhand lokalt och infiltreras i största möjliga mån.Geotekniska förhållandenStora delar av området har berg i dagen eller mycket nära till fast berg. Deöppna ängsmarkerna har glacial lera till okänt djup. Planområdet bedöms hagoda geotekniska förhållanden dock ska geoteknisk expertis konsulteras införkommande byggnation.RadonOmrådet har inga förhöjda radonvärden och är inte beläget inom högriskområdeför radon.Förorenad markDet har inte förekommit någon form av verksamhet inom planområdet somskulle kunna orsakat föroreningar i marken. Således förekommer inga kändaföroreningar.BullerOmrådet är inte utsatt för några bullerkällor förutom angränsande vägar.Bostäder får inte uppföras närmare väg än 15 meter. Det gör det möjligt attuppföra byggnader med buller vid fasad som understiger 55 dB(A) ekvivalentnivå.I anslutning till Tureholms slott finns ett mindre flygfält för lättasportflygplan. Dessa bedöms inte orsaka buller som kan anses störande förplanområdet.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun11Strålning (närhet till kraftledning, mast etc)I norra delen av området passerar ett kraftledningsstråk med flera ledningar.Säkerhetsavståndet till den södra är, för permanent bostadsbebyggelse, femmeter, medan den mittersta har ett säkerhetsavstånd på 20 meter.ÖversvämningsriskOmrådet ligger högt över havet att översvämningsrisk inte anses föreligga.Genom området strömmar en del grundvatten och dagvatten, främst frånnordost mot söder. Dagvattensystemet ska utföras så att det kan ta omhandvatten från dimensionerande 100-årsregn.ServiceOmrådet ligger två kilometer från Trosas centrala delar. Det gör att kommersielloch offentlig service finns i närheten. I Trosa finns såväl vårdcentral, förskoloroch skolor samt ett varierat utbud av kommersiell service. Redan idag är tillgänglighetengod men med en utbyggd förbifart kommer den att öka.VÄGAR OCH TRAFIKVägar, gång- och cykelvägarOmrådet har bra vägförbindelse med centrala Trosa med undantag för bronöver Trosaån. Därför förutsätter en exploatering att förbifart Trosa byggs ut.Det ger också snabbare förbindelser med Vagnhärad, dess station och E4. Parallelltmed detaljplanearbetet pågår Trafikverkets arbete med förbifart Trosa.Under våren 2011 kommer förstudien att samrådas och enligt tidplanen kommerdärefter arbetet med vägutredningen att inledas. Detaljplanen för Smedstorpkommer att anpassas till Trafikverkets arbete till exempel vad gäller anslutningtill den kommande vägen. Beroende på hur långt Trafikverkets utredningar harkommit kan delar av detaljplanen att undantas från antagande beroende på omdet finns oklarheter kring exempelvis framtida anslutningspunkter.Byggstart är planerad till 2015 om inget oförutsett tillstöter. Utbyggnaden kommerockså att ske successivt vilket gör att planeringsarbetet kan ske parallelltmed Trafikverkets utredningar kring förbifarten. Detaljplanen bygger således intepå att Hungavägen kommer att vara trafiklösningen för Smedstorps exploatering.När förbifarten är färdigställd samt Smedstorp börjar byggas ut kommer huvuddelenav trafiken mot Vagnhärad att gå via den nya vägen. Områdets läge göratt man kan förvänta sig cyklande i viss utsträckning, särskilt med tanke på attdet redan idag finns en utbyggd gång- och cykelväg i anslutning till områdetsom går mellan Trosa och Västerljung. För friliggande villor och kedjehus skadock två bilar få plats på respektive tomt. Radhus och lägenheter ska ha enbilplats per bostad. Utöver detta ska gästparkering finnas motsvarande 0,2platser per bostad.Området har, som tidigare nämnts, god standard på gång- och cykelbanor tillcentrala Trosa. Inom området planläggs gångstråk så att man kan ta sig mellanområdets olika delar och ut ur området i flera olika riktningar.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun12KollektivtrafikIdag är kollektivtrafiken begränsad i direkt anslutning till planområdet. Detfinns en hållplats för Länstrafikens bussar cirka en kilometer från planområdet.En översyn av kollektivtrafiken pågår i och med kommunernas ökade ansvar förlinjedragning mm. I centrala Trosa finns hållplatser för Trosabussen vilken vardagarhar 13 avgångar i vardera riktning till Liljeholmen i Stockholm samt ävenhelgtrafik. Vid Vagnhärads station finns regionaltågsförbindelse med såväl Södertälje-Stockholmsom Nyköping-Norrköping-Linköping.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun13PLANFÖRSLAGETBebyggelsenBebyggelsen är grupperad som två bybildningar kring var sin öppen ängsmarkdär odling, djurhållning, lek, dagvattendammar med mera ordnas. Terrängförhållandenastyr till stor del bebyggelsens placering. Ett flertal friliggande villorplaceras in på sluttningarna. Västra området får en bebyggelse som profilerasmot exklusivitet och miljöanpassning. Östra delen får en ”herrgårdsmiljö” norrom ängen och trädgårdsstadskaraktär av glesare modell. Både östra och västradelarna får en del kedjehus/radhus i de lägre delarna.Förutom bostäderna föreslås lokaler för verksamheter i begränsad utsträckning.Det kan vara café eller någon annan typ av servering, kontor och handel.Området kan på så sätt bli mer levande och en aktiv del av Trosa somman gärna besöker.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun14Utformning av bebyggelsenSmedstorp består av två områden med olika karaktär bland annat vad gällertopografi och miljö. Detta återkommer även i utformningen av husen. I områdetnärmast Västerljungsvägen, på Tureholm 2:277, kommer bebyggelsen attanpassas till natur- och kulturmiljö genom att byggnaderna smygs in i vegetationoch terräng. Färgsättningen är nedtonad för att smälta in i naturen och intepåverka den kulturmiljö riksintresset invid Tureholms slott står för. Husens arkitekturska kontrastera men också komplettera byggnadsminnet och traktenskulturmiljö. Bebyggelsen närmast de upptäckta fornlämningarna ska ha en utformningsom underordnar sig landskapet så att näromgivningen inte påverkasför dramatiskt. Topografin utgör en utmaning på fastigheten och därför kommeren del hus att placeras på stolpar för att minska intrånget i naturen. Genom sittformspråk samt dess ekologiska profil utgör bebyggelsen ett komplement tilldet utbud som finns idag på bostadsmarknaden inom Trosa kommun. Genom envarsam anpassning såväl till topografi och natur som till kulturmiljön på platsenbedöms ett genomförande av detaljplanen i riksintressets närhet möjlig att genomförautan att dess värden äventyras.Bostäderna på den intilliggande fastigheten Tureholm 2:355 kommer att ha enmer traditionell karaktär. Den här delen av planområdet är tydligt avgränsadfrån riksintresseområdet Tureholm. Genom topografi och växtlighet inom områdetär det mycket begränsade siktlinjer mellan den tänkta exploateringen ochområdet invid Tureholms grindstugor. Bebyggelsen utgår ifrån ängsmarken somär centralt belägen på fastigheten och den förstärks genom den flerfamiljsvilla iherrgårdsstil med flyglar som blir den naturliga mittpunkten i området. Övrigbebyggelse växer sedan ut i varierande täthet beroende på läge och friliggande


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun15hus blandas med par- och radhus. När terrängen så kräver ska suterränghusanordnas. Vid färgsättning av området ska särskilt omsorg visas till intilliggandemiljö. Alltför stor variation ska undvikas liksom alltför kulörstarka färger. Genomen allmänt hållen bestämmelse ges utrymme för den enskilde fastighetsägarenseller arkitektens kreativitet samtidigt som färgsättningens betydelse förområdets kvalitet som helhet betonas. En allmän rekommendation är såledesatt låta den byggnadstradition som präglat utbyggnaden i det mellansvenskalandskapet styra färgvalet och generellt ska kulörstarka färger undvikas.Lokalklimat/ljusförhållandenTräd bevaras i största möjliga utsträckning för att värna om lokalklimatet ochden uppvuxna ombonade karaktären i området. Området lutar till stor del söderutoch kan fånga upp en stor del av dygnets solljus. En del hus är sluttningshusså att tomter kan anordnas på den högre nivån där ljusförhållandenai vissa fall är bättre.Mark och vegetationOmrådet kommer att få en grön karaktär med de öppna ängsmarkerna, debevarade trädridåerna samt de tillkommande odlingslotterna och trädgårdarna.De högre belägna delarna har berg i dagen och ett visst trädbestånd. Trädenbevaras i största möjliga utsträckning. Bland annat minimeras ingreppen iterrängen genom att hus ställs på pelare.För att bevara karaktären i området ska uppfyllning och sprängning undvikas iså hög utsträckning som möjligt. I de fall terrängen kräver ska hus uppförasantingen som suterränghus eller på stolpar. Marklov krävs för att fälla träd meden större stamdiameter än 25 cm på 1,3 m höjd. Syftet med bestämmelsen ärdels att bevara de träd som ger karaktär till området samt dels har träden enviktig funktion för marken i området.Lek och rekreationInom området anläggs några mindre lekplatser och lekängar. För odlingsintresseradefinns odlingslotter och i samband med det en del vistelseytor ävenför andra. I direkt anslutning till området finns såväl Hunga strövområde medbland annat svamp- och bärmarker som hela Tureholmsområdet med dessriksintressanta kulturmiljö. I anslutning till Tureholms slott finns även Trosaridskola och Trosa flygklubb med deras verksamheter och på lite längre avståndTrosa golfklubb.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun16VattenOmrådet förses med två fördröjningsmagasin för dagvatten i form av öppnadammar.TrafikOmrådet kommer att nås via Förbifart Trosa. Från den kommer man in i områdetssydöstra delar.Vidare studier får avgöra infarternas exakta lägen samt antalet infarter. Pågrund av den kuperade terrängen kommer det att bli slingrande vägar som pådet viset får lägsta möjliga lutning och minsta möjliga påverkan på terrängen.Vägområdena görs 5,5 meter breda men breddas på vissa ställen för att möjliggöralängsgående parkering. För biltrafiken planläggs ett antal återvändsgränderoch för gående finns länkar och stråk så att områdets olika delar blirlättillgängliga samt att det är möjligt med entréer till området i olika väderstreck.Parkering sker på respektive tomt för friliggande villor och kedjehus. Radhusoch lägenheter har sin parkering ordnad i mindre grupper av parkeringsplatsereller garage.TEKNISK FÖRSÖRJNINGVatten och avlopp samt dagvattenVatten och avlopp ansluts till det kommunala nätet vid närmaste förbindelsepunkt.Dagvatten ska i största möjligas utsträckning tas omhand lokalt, i enlighet medkommunens VA-policy. Dagvatten rinner in i området från angränsande markerfrämst i öster och nordost. Dagvatten rinner också ner från de högre belägnabergsområdena. Inom planområdet skapas förutsättningar för fördröjningsmagasininom de planlagda öppna naturområdena. Dessa kan utformas så att de isig utgör en kvalitet för området. Kapacitet för dagvattensystem samt utformningav fördröjningsmagasin avgörs slutligen i den kommande projekteringen.Brand- och utrymningsfrågorVägar ska utformas med bredder och svängradier så att utryckningsfordon kan tasig fram. Brandposter kommer att anordnas i nödvändig omfattning. I den fortsattaplaneringen ska frågan om farligt gods på angränsande vägar belysas så attbebyggelsen placeras utanför riskavstånd.Värme, fjärrvärme, energieffektivitetByggnader ska vara utformade så att energiförbrukning minimeras. För att underlättakonvertering till alternativa värmekällor ska byggnaderna förses med lämpligtvärmesystem, exempelvis ett vattenburet system. Utnyttjandet av förnyelsebaraenergikällor ska eftersträvas för att möjliggöra en långsiktig ekologisk hållbaruppvärmning. I de fall fjärrvärmeanslutning är möjlig bör detta eftersträvas.Det finns idag inte något utbyggt fjärrvärmenät till planområdet. Inom ramenför planförslaget utvecklas uppvärmningsfrågan ytterligare.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun17El, tele och bredbandI samband med utbyggnad av det kommunala vatten- och avloppsnätet förberedsför framtida fibernätsanslutning. Idag finns inte fibernät utdraget till området.Planområdet ansluts till el och tele i enlighet med respektive nätägares instruktioner.AvfallTrosa kommun har en renhållningsstadga vilken reglerar avfallshanteringen iSmedstorp. Inom planområdet planläggs även två områden för lokal återvinningoch källsortering.BOENDE I SMEDSTORP I FRAMTIDENSmedstorp erbjuder en kvalitativ miljö med frisk luft och få miljöstörningar i ettljust läge. Inom området finns goda möjligheter till rekreation och friluftslivinom såväl Hunga strövområde som inom Tureholmsområdet. Inom områdetskapas förutsättningar för egna odlingslotter vilket är en del av den sociala hållbarhetenoch är enligt studier hälsobringande. Området tangeras även av Sörmlandsledenvilken gör det enkelt att ströva i det närliggande naturområdet invidHunga.Avståndet till centrala Trosa samt kommersiellt och offentligt serviceutbud ärinte längre än att det går bra att promenera eller att cykla. Trosa har, förutomströvområden och rika kulturmiljöer, också golfbanor och andra friluftsanläggningarsamt närhet till kust och hav för bad och båtliv.Området är utformat för att vara barnvänligt. Bybildningarna ger goda kontaktmöjligheterför de boende vilket gynnar barnen. Sociala nätverk lokaltökar möjligheterna för en trygg och säker omgivning. Det är också bra medvuxna i utemiljön, bland annat vid odlingslotterna, som är förebilder för barneni att umgås. Det ger en vänligare umgängesform också bland barnen. Degemensamma ytorna främjar kontakter mellan barnfamiljer så att välbefinnandethos familjerna ökar rent allmänt.Inom området finns ett antal mindre lekplatser så att de yngre barnen har lekredskap.Lekängarna kan användas för lite äldre barn men också för familjeaktiviteter.Tryggheten i området bygger bland annat på att människor har lätt för att lärakänna igen varandra men också lära känna varandra. Igenkännandet byggersociala nätverk och bryggar över generationsgränser. För barn är det en trygghetatt vuxna finns i utemiljön och har ett öga på leken. För vuxna är det entrygghet att känna de barn som är ute i näromgivningen. Området har bebyggelsensamlad utmed stråk som har god kontakt med fönster och entréer. Detska göra att man känner sig trygg när man rör sig i området, inte minstkvällstid. Belysningen utformas så att den känns trivsam och trygg. Det ärmycket av detta som även är brottsförebyggande.Planläggningen av Smedstorp syftar till att skapa långsiktigt hållbara miljöersåväl socialt som bebyggelsemässigt. Det ska finnas förutsättningar för allaatt leva, utvecklas och känna trygghet. Genom utbyggnaden av områdetskapas också förutsättningar för en utbyggd kollektivtrafik, förbättrade gångochcykelstråk samt även arbetstillfällen i närområdet.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun18Området är kuperat och har därmed i vissa delar begränsad tillgänglighet.Vägnätet är dock anpassat i största möjliga mån till tillgänglighet utan attförorsaka orimliga ingrepp i terrängen. Med bil kan alla bostäder nås så attboende eller besökare kan ha god tillgänglighet från bilen till entrén. Inomområdet finns, förutom bilvägar, också gångförbindelser så att alla delar ärtillgängliga för gående via korta passager. De är emellertid branta i flera falleftersom de utformas med hänsyn till förhållanden på platsen. Bostäderna utformasså att de viktigaste funktionerna är tillgängliga för rörelsehindrade.ADMINISTRATIVA FRÅGORHuvudmannaskapKommunen är inte huvudman för vägar och allmänna ytor inom planområdet.Planområdet är perifert beläget i anslutning till Trosa tätort. Med tanke på områdetstopografiska förutsättningar i kombination med exploatörens målsättningatt utveckla Smedstorp med minsta möjliga ingrepp i naturen är ett enskilt huvudmannaskapför vägar och allmänna ytor en god lösning för planområdet.GenomförandetidGenomförandetiden är tio (10) år från det att detaljplanen vunnit laga kraft.Genomförandetiden innebär att ändras eller upphävs planen före genomförandetidenhar fastighetsägaren rätt till ersättning för den skada denne åsamkas.Efter genomförandetiden fortsätter detaljplanen att gälla med dess byggrättermen ändras eller upphävs planen finns det ingen rätt till ersättning för debyggrätter som går förlorade.MEDVERKANDEMedverkande tjänstemänMats Gustafsson, samhällsbyggnadschefLinda Axelsson, planchefMedverkande konsulterBengt Smideman, Smideman Arkitekter ABYvonne Ekedahl, Smideman Arkitekter AB


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun19GENOMFÖRANDEBESKRIVNINGORGANISATORISKA FRÅGORTidplanBeslut om samråd februari 2012Samrådstid mars 2012 – april 2012Beslut om utställning juni 2012Granskning september–oktober 2012Utställning hösten 2012Antagande vintern 2013Laga kraft våren 2013Planarbetet bedrivs med normalt planförfarande enligt ovanstående tidplan. Denär preliminär och kan komma att justeras under arbetets gång.GenomförandetidGenomförandetiden är 10 år från det att detaljplanen vunnit laga kraft. Genomförandetideninnebär att ändras eller upphävs planen före genomförandetidenhar fastighetsägaren rätt till ersättning för den skada denne åsamkas. Eftergenomförandetiden fortsätter detaljplanen att gälla med dess byggrätter menändras eller upphävs planen finns det ingen rätt till ersättning för de byggrättersom går förlorade.Ansvarsfördelning och huvudmannaskapKommunen är inte huvudman för vägar och gemensamma ytor inom planområdet.Planområdet är perifert beläget i anslutning till Trosa tätort. Med tankepå områdets topografiska förutsättningar i kombination med exploatörens målsättningatt utveckla Smedstorp med minsta möjliga ingrepp i naturen är ett enskilthuvudmannaskap för vägar och allmänna ytor en god lösning för planområdet.Mark-, exploaterings- och avtalsfrågor, bygglovansökan och därmed enligt Planochbygglagen förenliga moment handläggs av Samhällsbyggnadskontoret påTrosa kommunVatten- och avloppVatten och avlopp ansluts vid den områdets södra del. Anslutande ledningarutanför planområdet samt ledningsnätet inom området byggs ut i enlighet medkommunens standard av fastighetsägaren och exploatören samt lämnas sedanöver till kommunen respektive den gemensamhetsanläggning som därefter taröver drift och underhåll av nätet utanför respektive inom planområdet. Frågorsom rör utbyggnad av vatten- och avloppsnätet handläggs av Tekniska enhetenvid Trosa kommun.DagvattenDagvatten ska i huvudsak omhändertas lokalt. Inom planområdet ges möjlighettill infiltration samt fördröjningsmagasin bland annat på de öppna naturytorna.Dagvattnet ska inte ansluta till ett kommunalt dagvattennät utan löses enskiltinom planområdet.


PLANBESKRIVNINGDetaljplan för Tureholm 2:277, 2:355, 2:362och 2:363, Trosa kommun20ElVattenfall Eldistribution AB ansvarar för elnätet och planområdet ansluts i enlighetmed nätägarens instruktion. Telia Sonera AB ansvarar för telenätet.Fastighetsägare och exploatör ansvarar för alla byggnader och anläggningarinom kvartersmark.El ansluts vid anslutningspunkt i enlighet med nätägarens instruktioner. Kostnadenoch ansvar för genomförandet åvilar exploatören.Tele, DataI samband med utbyggnad av det kommunala vatten- och avloppsnätet förberedsför framtida fibernätsanslutning. Planområdet ansluts till tele i enlighet mednätägares instruktioner. Kostnad och ansvar för genomförandet åvilar exploatören.FASTIGHETSRÄTTSLIGA FRÅGORDet är respektive fastighetsägare som initierar och bekostar de fastighetsrättsligaåtgärder som detaljplanen redovisar. Inom planområdet finns idagservitut och ledningsrätter dessa kommer att utredas i samband med övrigalantmäteriförrättningar inom planområdet.Lantmäteriförrättningar föranledda av aktuell detaljplan hanteras av LantmäterimyndighetenSödermanlands län.Nybyggnadskarta beställs av Metria, Katrineholm, eller den som för tillfälletär kommunens mät- och kartentreprenör.EKONOMISKA FRÅGORKostnader för upprättande och genomförande av detaljplanen åvilar berördafastighetsägare. Planavgift ska ej tas ut vid bygglov. Kostnader för bygglovdebiteras enligt taxa. En exploateringsersättning per avstyckad fastighet kommeratt debiteras exploatören med anledning av utbyggnaden av FörbifartTrosa.I samband med planens antagande tecknas ett exploateringsavtal mellan Trosakommun och respektive fastighetsägare och exploatör.MEDVERKANDEMedverkande tjänstemänMats Gustafsson, samhällsbyggnadschefLinda Axelsson, planchefMedverkande konsulterBengt Smideman, Smideman Arkitekter AB


SammanträdesprotokollTeknik- och servicenämndenTrosa KommunSammanträdesdatum2013-02-14§ 5 Dnr TSN 2012/21Utvidgat verksamhetsområde för vatten och spillvatten,HagstuganTeknik- och servicenämnden beslutaratt anta förslag till utvidgat verksamhetsområde, omfattande område förHagstugans fritidshusområde, för vatten och spillvatten och att gälla från ochmed det att anslutning till Trosa allmänna va-system är upprättad och i funktion.Teknik- och servicenämnden beslutar föreslåkommunfullmäktige beslutaatt anta förslag till utvidgat verksamhetsområde för vatten och spillvattenomfattande område för Hagstugans fritidshusområde.ÄrendetHagstugans fritidshusområde gränsar till Lagnövikens villa- ochfritidshusområde, vilket ingår i kommunens verksamhetsområde för allmän vaanläggning.Inom Hagstugan finns 15 fastigheter, tre av fastigheterna harpermanentboende och en fastighet är obebyggd.Samtliga fastigheter har enskilda va-anläggningar. Enligt inventering sommiljökontoret utfört under år 2011, har samtliga avloppsanläggningar utom en,bristande funktion och är därmed inte godkända. Fastighetsägare inomHagstugans fritidshusområde har anmält intresse för anslutning till allmän vaanläggning.Lagen om allmänna vattentjänster anger att kommunen är skyldig att ordnavattentjänster om det behövs med hänsyn till skydd för människors hälsa ellermiljö.Ärendets beredningTjänsteskrivelse från produktionschef Claes-Urban Boström och teknisk chef StigTördahl, 2013-02-04.Kopia tillKommunstyrelsenAktenJusterandes signaturUtdragsbestyrkande4


TjänsteskrivelseTeknik- och servicenämndenDnr TSN 2012/212013-02-04Tekniska enhetenStig TördahlTel. 0156-523 31Fax. 0156-522 03stig.tordahl@trosa.seAntagande av utvidgat verksamhetsområde för vattenoch spillvatten, Hagstugan i Trosa kommunFörslag till beslutattanta förslag till utvidgat verksamhetsområde, omfattande område förHagstugans fritidshusområde, för vatten och spillvatten och att gälla from det attanslutning till Trosa allmänna va-system är upprättad och i funktion.attföreslå Ks / Kf anta förslag till utvidgat verksamhetsområde för vatten ochspillvatten omfattande område för Hagstugans fritidshusområde.ÄrendetHagstugans fritidshusområde (tomtkarta bif.) gränsar till Lagnövikens villa- ochfritidshusområde, vilket ingår i kommunens verksamhetsområde för allmän vaanläggning.Inom Hagstugan finns 15 fastigheter, tre av fastigheterna harpermanentboende och en fastighet är obebyggd (2:244).Samtliga fastigheter har enskilda va-anläggningar. Enligt inventering somMiljökontoret utfört under år 2011, har samtliga avloppsanläggningar utom en,bristande funktion och är därmed inte godkända. Fastighetsägare inomHagstugans fritidshusområde har anmält intresse för anslutning till allmän vaanläggning.Allmänt intresse hos fastighetsägarna föreligger, förteckning överintresserade fastighetsägare bifogas.Lagen om allmänna vattentjänster anger att kommunen är skyldig att ordnavattentjänster om det behövs med hänsyn till skydd för människors hälsa ellermiljö.Vid antagande av utvidgat verksamhetsområde, kommer kommunen att anslutava-anläggningen med vatten- och spillvatten system vid pumpstation förLagnöviken.LTA- avloppssystem inom Hagstugans fritidshusområde förutsätts, då dettabedöms ge lägsta anläggningskostnaden samt ger stor flexibilitet för anslutningav befintliga byggnationer. Va-plan för Hagstugans fritidshusområde bifogas.


Varje fastighet som ansluts skall vid tiden för anslutning erlägga gällande taxaför anläggningsavgift. Fastighetsägaren är därefter skyldig att följa det somanges i Lagen om allmänna vattentjänster och ABVA för Trosa kommun.Kostnad för anläggande av va-anläggning i området bekostas avanläggningsavgifter.Claes-Urban BoströmProduktionschefStig TördahlTeknisk chefBilagor1. Karta verksamhetsområde vatten och spillvatten för Hagstugansfritidshusområde.2. Intresseanmälan för anslutning till kommunal va-anläggning3. Va-plan Hagstugans fritidshusområde.


TjänsteskrivelseKommunstyrelsenDnrTSN2013/102013-02-19EkonomichefMargareta SmithTel. 0156-520 92Fax. 0156-520 32margareta.smith@trosa.seBegäran om utökad investeringsram 2013 för om- ochtillbyggnad av SkärlagsskolanFörslag till beslutKommunstyrelsen föreslår kommunfullmäktige beslutaattutöka Teknik- och servicenämndens investeringsram 2013 med 7 mkr för omochtillbyggnad av Skärlagsskolan.ÄrendetElevantalet i Skärlagsskolan har ökat och förväntas öka även framöver.Matsalen har byggts ut och två slöjdsalar har byggts om till klasrum. Frånhöstterminen 2013 behöver fritidshemmets lokaler i skolan användas förförskoleklass och fritidshemmet flytta till nya paviljonger. Investeringsmedlen äravsedda för paviljonger motsvarande fem moduler.Avskrivningstiden för en paviljong är 20 år, vilket är en kostnad på 350 tkr/år.Internräntan är lika stor, 350 tkr, första året, men minskar för varje år. Ökadekapitaltjänstkostnader påverkar såväl Teknik- och servicenämndens ram sominternhyran för 2014. Enligt budgetanvisningarna justeras budget 2014 medaktuella belopp för avskrivning och ränta, samt internhyra av ekonomienheten.Bilagor1. Teknisk och servicenämndens begäran om utökad investeringsram2. Humanistiska nämndens beslut om utbyggnad av SkärlagsskolanMargareta SmithEkonomichef


SammanträdesprotokollTeknik- och servicenämndenTrosa KommunSammanträdesdatum2013-02-14§ 8 Dnr TSN 2013/10Om- och tillbyggnad av SkärlagskolanTeknik- och servicenämnden beslutar föreslåkommunstyrelsen beslutaatt avsätta 7 mkr i investeringsmedel för den tänkta om- och tillbyggnaden avSkärlagskolan.ÄrendetSkolkontoret har skrivit fram ett ärende till kommunstyrelesn om behovet av enom- och tillbyggnad av Skärlagskolan då skolan växer. Skolan genomgår just nuen etappvis ombyggnation och anpassning med utökad kapacitet men det räckerändå inte för att ta emot det fortsatt antal barn som förväntas börja i skolan.Förslaget bygger på att den fritidsdel som idag finns inne i skolan byggs om tillförskola och fritidsdelen flyttas ut till byggnaden på gården som byggs ut medytterligare fem moduler.För att klara detta behövs en upphandling göras omedelbart så att leverans avde fem modulerna kan ske så tidigt som möjligt så att skolan står färdigt tillhöststart 2013.Ärendets beredningTjänsteskrivelse från produktionschef Claes-Urban Boström och teknisk chef StigTördahl, 2013-02-04.Kopia tillKommunstyrelsenAktenJusterandes signaturUtdragsbestyrkande7


TjänsteskrivelseTeknik- och servicenämndenDnr TSN 2013/102013-02-04Kultur, fritids, teknik- ochservicekontoretClaes-Urban BoströmTel. 0156-520 66Fax. 0156-523 03claes-urban.bostrom@trosa.seOm- och tillbyggnad av SkärlagskolanTeknik- och servicenämnden föreslås besluta:att föreslå KS avsätta 7 mkr i investeringsmedel för den tänkta om- ochtillbyggnaden av Skärlagskolan.Utbyggnad av SkärlagsskolanSkolkontoret har skrivit fram ett ärende till KS om behovet av en om- ochtillbyggnad av Skärlagskolan då skolan växer.Skolan genomgår just nu en etappvis ombyggnation och anpassning med utökadkapacitet men det räcker ändå inte för att ta emot det fortsatt antal barn somförväntas börja i skolan.Förslaget bygger på att den fritidsdel som idag finns inne i skolan byggs om tillförskola och fritidsdelen flyttas ut till byggnaden på gården som byggs ut medytterligare fem moduler.För att klara detta behövs en upphandling göras omedelbart så att leverans avde fem modulerna kan ske så tidigt som möjligt så att skolan står färdigt tillhöststart 2013. Normal leveranstid av moduler av detta slag är ca 6 månader såvi måste ha en ordentlig tur om detta ska hålla tidsmässigt. Upphandlingenkommer att ta några veckor och när väl modulerna kommer så ska de dockasihop med befintlig byggnad vilket också tar en liten stund.Vi lovar således inte att det går att få till detta tidsmässigt men vi lovar attförsöka.Claes-Urban BoströmProduktionschefStig TördahlTeknisk chefBilagor1. Humanistiska nämndens beslut om utbyggnad av Skärlagsskolan,2013-01-29, § 11.


SammanträdesprotokollHumanistiska nämndenTrosa kommunSammanträdesdatum2013-01-29§ 11 HN 2013/9Utbyggnad av SkärlagskolanHumanistiska nämnden beslutarattföreslå Kommunstyrelsen att besluta om en investeringsram för utökning ochanpassning av skollokaler på Skärlagskolan enligt beskrivet ärende för möjligdrift i augusti 2013 och därmed uppdra till Teknik och servicenämnden attförbereda och genomföra utbyggnaden.__________ÄrendetSkärlagskolan var läsåret 2010-2011 en skola med en klass per årskurs. Skolanväxer nu stadigt till en två parallellig skolenhet F-6 med fritidshem. Prognosenvisar på fortsatt stadigt ökat elevantal med ca 15-25 elever per år och därmedfinns ett behov om utökade lokaler.Skolan genomgår nu etappvis fram till skolstart hösten 2013 en anpassning ochmodernisering av skollokaler. Detta har ökat kapaciteten från hösten 2012 medtvå klassrum och ger en större matsal 2013. Den ökade kapaciteten är fulltutnyttjad från skolstart hösten 2012.För optimalt lokalutnyttjande och tillräcklig kapacitet inför skolstart hösten 2013bör före detta fritidslokaler i Skärlagskolan anpassas till förskoleklass. Dettagenomförs genom att fritidshemmet flyttar ut till paviljongen. Därmed behöverpaviljongen utökas motsvarande fem moduler.Ärendets beredning: Tjänsteskrivelse från Mats Larsson, skolchef 2013-01-29Kopia tillKommunstyrelsenTeknik- och servicenämndenMats Larsson, skolchefAktenJusterandes signaturUtdragsbestyrkande18


TjänsteskrivelseHumanistiska nämndenDnr HN 2013/52013-01-22SkolkontoretTor-Erik Lillsebbas0156-520 50072-730 63 19tor-erik.lillsebbas@trosa.seBidrag 2013 till fristående skolor, enskiltdrivna förskolor, fritidshem ochförskoleklasserFörslag till beslutHumanistiska nämnden föreslås besluta:att föreslå kommunstyrelsen att föreslå kommunfullmäktige att fastställa nyabidragsbelopp enligt bilaga 1 till enskilt drivna förskolor och skolor att gälla frånoch med den 1 januari 2013.BakgrundKommunens ersättning till fristående skolor, enskilt drivna förskolor, fritidshemoch förskoleklasser ska beräknas efter samma grunder som kommunentillämpar vid fördelning av resurser till den egna verksamheten. Ersättningenska bestå av ett grundbelopp, en ersättning för administrativa kostnader på 3% av grundbeloppet och momskompensation med 6 % på grundbelopp ochadministrativt påslag. Efter särskild utredning kan även tilläggsbelopp utbetalasför barn med särskilda rättigheter.Ny ersättning 2013Skolkontoret har tillsammans med ekonomikontoret beräknat ersättningen tillenskilt driven verksamhet.Utgångspunkten för beräkningarna är de belopp som beslutats i Trosakommuns budget 2013. Till dessa elevpengsbelopp som fastställts i budget avkommunfullmäktige skall tillföras eventuella särskilda satsningar som görs påförskolan eller skolan.GrundbeloppDessa belopp utgör grundbelopp och har justerats med administrativt påslag på3 % och momskompensation på 6 % och justeras också beroende på om denenskilda verksamheten debiterar föräldraavgifter eller inte. Beloppen justerasockså för avdrag med hänsyn till maxtaxa för de enskilt drivnaverksamheterna, där den statliga ersättningen för maxtaxa inte bruttoredovisasoch betalas till de enskilt drivna förskolorna utan istället reducerar avdraget förföräldraavgifterna för förskolor och för skolbarnsomsorg.


Särskilda satsningar utom grundbeloppFörutom bidragsbelopp för drift skall den enskilt drivna verksamheten ocksåkompenseras för särskilda satsningar som kommer Trosa kommuns barntillgodo och som tilldelats utanför det kommunala grundbeloppet. För Trosasdel finns inga särskilda satsningar som skall räknas in i bidragsbeloppet för2012. I Trosas fall utgör de särskilda satsningarna 1 Mkr i kvalitetsmiljonen och1 Mkr i IKT-miljonen. Båda satsningarna är riktade mot skolan och skall därförpåverka den elevpengen.HyrespengHyrespengen utgår till enskilt drivna förskolor skolor med utgångspunkt i debelopp som tilldelas kommunens egna förskolor och skolor kompletterat medkompensation för moms omfattande ett momspålägg på 6 %.Tilldelningen till enskilt drivna förskolor och skolor framgår av bilaga 1.TilläggsbeloppVid behov kan ersättning för barn i behov av särskilt stöd utgå i form av etttilläggsbelopp. Tilläggsbeloppet kan även innehålla ersättning för Svenska 2och modersmålsundervisning.Besked om beslutEfter KF:s fastställande av bidragsbelopp meddelas varje enskilt drivenverksamhet vilka bidragsbelopp som gäller för Trosa kommuns barn och elever,med angivande av ett unikt diarienummer och anvisningar för överklagande avbeslutet.Bilaga 1 – Bidragsbelopp till förskola och skola 2013…………………………………………………….Mats Larsson, Skolchef…………………………………………………….Tor-Erik Lillsebbas


Ingångsvärden Bilaga 1 till HN 2013/5Förskola och skolbarnsomsorgPeng kr/år/barn Kommunal Privat peng 2013Grundbelopp Adm 3% + moms 6%Avdrag föräldraavgifternetto mhtmaxtaxan Kr/barn/årPeng kr per år och barn i förskola och skolbarnsomsorg 2013Kommunal barnomsorg Enskilt driven barnomsorgInom kommunen Utanför kommunen Hyra Inom kommunen Utanför kommunen HyraTrosa tar Trosa tar Kommunen Trosa tar Enskild tar Trosa tar Enskild tarut avgift ut avgift tar ut avgift ut avgift ut avgift ut avgift ut avgiftFörskola 1-2 år Förskola 1-2 år- 20 tim/vecka 87 890 8 068 -6 123 89 835 - 20 tim/vecka 87 890 97 629 87 890 15 797 93 451 89 835 93 451 89 835 16 74521-40 tim/vecka 114 988 10 556 -6 123 119 421 21-40 tim/vecka 114 988 124 727 118 604 15 797 123 037 119 421 123 037 119 421 16 74541- tim/vecka 155 149 14 243 -6 123 163 269 41- tim/vecka 155 149 164 888 158 765 15 797 166 885 163 269 166 885 163 269 16 745Förskola 3-5 år Förskola 3-5 år- 20 tim/vecka 50 335 4 621 -6 123 48 833 - 20 tim/vecka 50 335 60 074 53 951 15 797 52 449 48 833 52 449 48 833 16 74521-40 tim/vecka 65 829 6 043 -6 123 65 749 21-40 tim/vecka 65 829 75 568 69 445 15 797 69 365 65 749 69 365 65 749 16 74541- tim/vecka 88 771 8 149 -6 123 90 797 41- tim/vecka 88 771 98 510 92 387 15 797 94 413 90 797 94 413 90 797 16 745Skolbarnomsorg 6-12 år Skolbarnomsorg 6-12 år6 år 35 968 3 302 -3 443 35 827 6 år 35 968 43 027 39 584 42 123 35 827 42 123 35 8277-12 år 28 821 2 646 -3 443 28 024 7-12 år 28 821 35 880 32 437 34 320 28 024 34 320 28 024Trosa kommuns föräldraavgifter 2013 Per år per månadFör 1-5 år 9 739 812Peng kr per månad och barn i förskola och skolbarnsomsorg 2013Kommunal barnomsorg Enskilt driven barnomsorgFör 6-12 år 7 059 588 Inom kommunen Utanför kommunen Hyra Inom kommunen Utanför kommunen HyraTrosa tar Trosa tar Kommunen Trosa tar Enskild tar Trosa tar Enskild tarHyrespeng förskola 2013 Kr per år Fördelning Momspålägg Till enskilda ut avgift ut avgift tar ut avgift ut avgift ut avgift ut avgift ut avgiftFörskola 236 954 till förskola per 15-grupp 14 217 251 171Förskola 1-2 årSärskilda satsningar 2013 i förskolan 0 - 20 tim/vecka 7 324 8 136 7 324 1 316 7 788 7 486 7 788 7 486 1 39521-40 tim/vecka 9 582 10 394 9 884 1 316 10 253 9 952 10 253 9 952 1 39541- tim/vecka 12 929 13 741 13 230 1 316 13 907 13 606 13 907 13 606 1 395Förskola 3-5 år- 20 tim/vecka 4 195 5 006 4 496 1 316 4 371 4 069 4 371 4 069 1 39521-40 tim/vecka 5 486 6 297 5 787 1 316 5 780 5 479 5 780 5 479 1 39541- tim/vecka 7 398 8 209 7 699 1 316 7 868 7 566 7 868 7 566 1 395Skolbarnomsorg 6-12 år6 år 2 997 3 586 3 299 3 510 2 986 3 510 2 9867-12 år 2 402 2 990 2 703 2 860 2 335 2 860 2 335SkolorPeng kr/år/barn Kommunal Privat peng 2013 Peng kr per år och barn i skola 2013Grundbelopp Adm 3% + moms 6% Kr/elev/årTrosas skolor Interkommunalt Enskilt drivna skolorGrundskolepeng Grund Hyra Grund Hyra Grund HyraFörskoleklass 29 186 2 679 31 865 Förskoleklass 29 186 30 634 15 990 33 314 16 949Skolår 1-5 46 680 4 285 50 965 Skolår 1-5 46 680 48 128 15 990 52 413 16 949Skolår 6-9 54 867 5 037 59 904 Skolår 6-9 54 867 56 315 15 990 61 352 16 949Hyrespeng skola 2013 Kr per år Fördelning Momspålägg Till enskilda Peng kr per månad och barn i skola 2013Skola 319 794 till skola per 20-grupp 19 188 338 982Trosas skolor Interkommunalt Enskilt drivna skolorGrund Hyra Grund Hyra Grund HyraSärskilda satsningar 2013 i skolan. IT-miljon o kvalitetsmiljon 2 000 000 Förskoleklass 2 432 2 553 1 332 2 776 1 412Skolår 1-5 3 890 4 011 1 332 4 368 1 412Skolår 6-9 4 572 4 693 1 332 5 113 1 412Särskilda satsningar på skolan 2013 Totalt Antal barn Per elev/år Per mån Pålägg på pengIT-miljon o kvalitetsmiljon ####### 1 381 1 448 121 Inräknat i beloppen till fristående ovan


DelegationsbeslutHumanistiska nämndenDnr HN 2012/612013-02-05Helena KochBidragsbelopp till fristående gymnasiekolor enligt Gy 94 och Gy 11från och med kalenderåret 2013BeslutHumanistiska nämndens ordförande beslutar föreslåKommunfullmäktige beslutaatt anta nya bidragsbelopp till fristående gymnasieskolor avseende programinom ramen för Gy 94 och Gy 11 för kalenderåret 2013._________ÄrendetHumanistiska nämnden tog den 4 december 2012, § 76 beslut om att uppdra åthumanistiska nämndens ordförande att på delegation lämna förslag tillbidragsbelopp för fristående gymnasieskolor avseende kalenderåret 2013.Bifogat förslag omfattar nya bidragsbelopp till fristående gymnasieskoloravseende program inom ramen för Gy 94 och Gy 11 för kalenderåret 2013.Helena KochHumanistiska nämndens ordförandeBilagor1. Trosas prislista gymnasiet 2013, bilaga 12. Protokollsutdrag från humanistiska nämnden 2012-12-04, § 76Beslut tillKommunstyrelsen1


KSL:s länsprislista 2013 - Gy 94Bilaga2 till beslut om Gy peng i HN 2012-12-04 Dnr 2012-61KSL:s pris inkl momspålägg Gy 11Program Belopp 2013 varav mat varav adm 3% varav moms 6% Grundbelopp ex momsBarn- och fritidsprogrammet 78 334 6 331 2 152 4 434 Barn- och fritidsprogrammet 78 334 73 900Byggprogrammet 111 692 6 331 3 069 6 322 Byggprogrammet 111 692 105 370Byggprogrammet - Salem Plåtslager 132 704 6 331 3 646 7 512 Byggprogrammet - Salem Plåtslager 132 704 125 192Elprogrammet 102 741 6 331 2 823 5 816 Elprogrammet 102 741 96 925Energiprogrammet 109 156 6 331 2 999 6 179 Energiprogrammet 109 156 102 977Estetiska programmet, exkl musik 100 210 6 331 2 754 5 672 Estetiska programmet, exkl musik 100 210 94 538Estetiska programmet, musik 114 076 6 331 3 135 6 457 Estetiska programmet, musik 114 076 107 619Fordonsprogrammet, exkl transport och logistik 128 735 6 331 3 537 7 287 Fordonsprogrammet, exkl transport och logistik 128 735 121 448Fordonsprogrammet, transport och logistik 172 876 6 331 4 750 9 785 Fordonsprogrammet, transport och logistik 172 876 163 091Fordonsprogrammet, flygteknik - Fordonsprogrammet, flygteknik -Handels- och administrativa programmet 83 223 6 331 2 287 4 711 Handels- och administrativa programmet 83 223 78 512Hantverksprogrammet 101 987 6 331 2 802 5 773 Hantverksprogrammet 101 987 96 214Hotell- och restaurangprogrammet 117 490 6 331 3 228 6 650 Hotell- och restaurangprogrammet 117 490 110 840Industriprogrammet 109 774 6 331 3 016 6 214 Industriprogrammet 109 774 103 560Livsmedelsprogrammet 129 363 6 331 3 555 7 322 Livsmedelsprogrammet 129 363 122 041Medieprogrammet 109 322 6 331 3 004 6 188 Medieprogrammet 109 322 103 134Naturvetenskapsprogrammet 81 790 6 331 2 247 4 630 Naturvetenskapsprogrammet 81 790 77 160Omvårdnadsprogrammet 82 431 6 331 2 265 4 666 Omvårdnadsprogrammet 82 431 77 765Samhällsvetenskapsprogrammet 74 370 6 331 2 043 4 210 Samhällsvetenskapsprogrammet 74 370 70 160Teknikprogrammet 89 574 6 331 2 461 5 070 Teknikprogrammet 89 574 84 504Nationellt godkänd idrottsutbildning - tillägg lagidrptt 16 316 0 448 924 Nationellt godkänd idrottsutbildning - tillägg lagidrptt 16 316 15 392Nationellt godkänd idrottsutbildning - tillägg individuell idrott 19 579 0 538 1 108 Nationellt godkänd idrottsutbildning - tillägg individuell idrott 19 579 18 471Nyköpings kommun prislista 2013 - Gy 94Nyköpings/Öknas pris inkl momspåläggProgram Belopp 2013 varav mat varav adm 3% varav moms 6% Grundbelopp ex momsBarn- och fritidsprogrammet 86 072 4 600 2 365 4 872 Barn- och fritidsprogrammet 86 072 81 200Byggprogrammet 111 936 4 600 3 076 6 336 Byggprogrammet 111 936 105 600Byggprogrammet - Plåtslager - Byggprogrammet - Plåtslager - -Elprogrammet 117 Elprogrammet 117 236 110 236 4 600 3 221 6 636 600Energiprogrammet - Energiprogrammet - -Estetiska programmet, exkl musik 100 276 4 600 2 755 5 676 Estetiska programmet, exkl musik 100 276 94 600Estetiska programmet, musik 119 144 4 600 3 274 6 744 Estetiska programmet, musik 119 144 112 400Fordonsprogrammet, exkl transport och logistik 129 744 4 600 3 565 7 344 Fordonsprogrammet, exkl transport och logistik 129 744 122 400Fordonsprogrammet, transport och logistik 166 420 4 600 4 573 9 420 Fordonsprogrammet, transport och logistik 166 420 157 000Fordonsprogrammet, flygteknik 224 720 4 600 6 175 12 720 Fordonsprogrammet, flygteknik 224 720 212 000Handels- och administrativa programmet 85 224 4 600 2 342 4 824 Handels- och administrativa programmet 85 224 80 400Hantverksprogrammet 112 784 4 600 3 099 6 384 Hantverksprogrammet 112 784 106 400Hotell- och restaurangprogrammet - Hotell- och restaurangprogrammet - -Industriprogrammet - Industriprogrammet - -Livsmedelsprogrammet - Livsmedelsprogrammet - -Medieprogrammet - Medieprogrammet - -Naturbruksprogrammet - snittkostnad 161 Naturbruksprogrammet - snittkostnad 161 220 152 för alla inriktnignar Ökna 220 6 375 4 430 9 126 för alla inriktnignar Ökna 094Naturvetenskapsprogrammet 83 316 4 600 2 289 4 716 Naturvetenskapsprogrammet 83 316 78 600Omvårdnadsprogrammet 93 916 4 600 2 581 5 316 Omvårdnadsprogrammet 93 916 88 600Samhällsvetenskapsprogrammet 81 408 4 600 2 237 4 608 Samhällsvetenskapsprogrammet 81 408 76 800Teknikprogrammet 89 888 4 600 2 470 5 088 Teknikprogrammet 89 888 84 800Nationellt godkänd idrottsutbildning - tillägg lagidrptt 13 568 0 373 768 Nationellt godkänd idrottsutbildning - tillägg lagidrptt 13 568 12 800Nationellt godkänd idrottsutbildning - tillägg individuell idrott 16 218 0 446 918 Nationellt godkänd idrottsutbildning - tillägg individuell idrott 16 218 15 300Trosa kommuns prislista 2013 - Gy 94 (Årskurs 3 vt 13) Gäller VT 2013 !!!!Program Belopp till fristående varav mat varav adm 3% varav moms 6%Barn- och fritidsprogrammet 82 203 5 466 2 259 4 653 SNByggprogrammet 111 814 5 466 3 072 6 329 SNByggprogrammet - Salem Plåtslager 132 704 6 331 3 646 7 512 SElprogrammet 109 988 5 466 3 022 6 226 SNEnergiprogrammet 109 156 6 331 2 999 6 179 SEstetiska programmet, 100 243 5 466 2 754 5 674 SNexkl musikEstetiska programmet, musik 116 610 5 466 3 204 6 601 SNFordonsprogrammet, exkl transport och logistik 129 239 5 466 3 551 7 315 SNFordonsprogrammet, transport och logistik 169 648 5 466 4 662 9 603 SNFordonsprogrammet, flygteknik 224 720 4 600 6 175 12 720 NHandels- och administrativa programmet 84 223 5 466 2 314 4 767 SNHantverksprogrammet 107 385 5 466 2 951 6 078 SNHotell- och restaurangprogrammet 117 490 6 331 3 228 6 650 SIndustriprogrammet 109 774 6 331 3 016 6 214 SLivsmedelsprogrammet 129 363 6 331 3 555 7 322 SMedieprogrammet 109 322 6 331 3 004 6 188 SNaturbruksprogrammet 161 220 6 375 4 430 9 126 ÖNaturvetenskapsprogrammet 82 553 5 466 2 268 4 673 SNOmvårdnadsprogrammet 88 173 5 466 2 423 4 991 SNSamhällsvetenskapsprogrammet 77 889 5 466 2 140 4 409 SNTeknikprogrammet 89 731 5 466 2 466 5 079 SNNationellt godkänd idrottsutbildning - tillägg lagidrptt 14 942 0 411 846 SNNationellt godkänd idrottsutbildning - tillägg individuell idrott 17 899 0 492 1 013 SNGul post = Baseras på genomsnitt av KSLoch NyköpingGrön post = Baseras på antingen KSL:s eller Nyköpings prislistaBeige post = Baseras på avtal med Ökna/Östergötland o Nyköping


KSL:s och Riksprislistan för Södertäljes program 2013 - Gy 11Bilaga 1 till beslut om Gy peng i HN 2012-12-04 Dnr 2012-61Program Belopp till fristående varav mat varav adm 3% varav moms 6% KSL:s eller R-prislistans pris inkl momspålägg Gy 11 Belopp exkl momsBarn- och fritidsprog. 78 334 6 331 2 152 4 434 Barn- och fritidsprog. 78 334 73 900Bygg och anläggningsprogrammet 111 692 6 331 3 069 6 322 Bygg och anläggningsprogrammet 111 692 105 370Bygg och anläggningsprogrammet - Anläggningsfordon 137 700 4 300 3 784 7 794 RP Bygg och anläggningsprogrammet - Anläggningsfordon 137 700 129 906 RPEl- och energiprogrammet 102 741 6 331 2 823 5 816 El- och energiprogrammet 102 741 96 925VVS och fastighetsprogrammet 109 156 6 331 2 999 6 179 VVS och fastighetsprogrammet 109 156 102 977Estetiska programmet 100 210 6 331 2 754 5 672 Estetiska programmet 100 210 94 538Estetiska programmet - Estetik och Media 104 423 6 331 2 869 5 911 Estetiska programmet - Estetik och Media 104 423 98 512Estetiska programmet - Musik 114 076 6 331 3 135 6 457 Estetiska programmet - Musik 114 076 107 619Fordons- och transportprogrammet 128 735 6 331 3 537 7 287 Fordons- och transportprogrammet 128 735 121 448Fordons och transportprogrammet - Transport 172 876 6 331 4 750 9 785 Fordons och transportprogrammet - Transport 172 876 163 091Fordons och transportprogrammet Flyg (RXFLY) - Fordons och transportprogrammet Flyg (RXFLY) - -Handels- och administrationsprogrammet 83 223 6 331 2 287 4 711 Handels- och administrationsprogrammet 83 223 78 512Hantverksprogrammet - Hantverksprogrammet - -Hotell- och turismprogrammet 91 600 4 500 2 517 5 185 RP Hotell- och turismprogrammet 91 600 86 415 RPIndustritekniska programmet 133 000 6 400 3 655 7 528 RP Industritekniska programmet 133 000 125 472 RPRestaurang och livsmedelsprogrammet 129 363 6 331 3 555 7 322 Restaurang och livsmedelsprogrammet 129 363 122 041Naturbruksprogrammet - Naturbruksprogrammet - -Naturvetenskapsprogrammet 81 790 6 331 2 247 4 630 Naturvetenskapsprogrammet 81 790 77 160Vård- och omsorgsprogrammet 82 431 6 331 2 265 4 666 Vård- och omsorgsprogrammet 82 431 77 765Samhällsvetenskapsprogrammet 74 370 6 331 2 043 4 210 Samhällsvetenskapsprogrammet 74 370 70 160Samhällsvetenskapsprogrammet Media (SAMED) 93 110 6 331 2 558 5 270 Samhällsvetenskapsprogrammet Media (SAMED) 93 110 87 840Ekonomiprogrammet 74 370 6 331 2 043 4 210 Ekonomiprogrammet 74 370 70 160Humanistiska programmet 74 370 6 331 2 043 4 210 Humanistiska programmet 74 370 70 160Teknikprogrammet 89 574 6 331 2 461 5 070 Teknikprogrammet 89 574 84 504Nationellt godkänd idrottsutbildning - tillägg lagidrott 16 316 0 448 924 Nationellt godkänd idrottsutbildning - tillägg lagidrott 16 316 15 392Nationellt godkänd idrottsutbildning - tillägg individuell idrott 19 579 0 538 1 108 Nationellt godkänd idrottsutbildning - tillägg individuell idrott 19 579 18 471Nyköpings kommun prislista 2013 - Gy 11Program Belopp till fristående varav mat varav adm 3% varav moms 6% Nyköpings/Öknas pris inkl momspålägg Belopp exkl momsBarn- och fritidsprog. 86 072 4 600 2 365 4 872 Barn- och fritidsprog. 86 072 81 200Bygg- och anläggningsprogrammet 111 936 4 600 3 076 6 336 Bygg- och anläggningsprogrammet 111 936 105 600El- och energiprogrammet - El- och energiprogrammet 0 0VVS och fastighetsprogrammet - VVS och fastighetsprogrammet 0 0Estetiska programmet - Estetiska programmet 0 0Estetiska programmet Estetik och Media - Estetiska programmet Estetik och Media 0 0Estetiska programmet Musik 119 144 4 600 3 274 6 744 Estetiska programmet Musik 119 144 112 400Fordons- och transportprogrammet 129 744 4 600 3 565 7 344 Fordons- och transportprogrammet 129 744 122 400Fordons och transportprogrammet Transport (FTTRA) 166 420 4 600 4 573 9 420 Fordons och transportprogrammet Transport (FTTRA) 166 420 157 000Fordons och transportprogrammet Flyg (RXFLY) 224 720 4 600 6 175 12 720 Fordons och transportprogrammet Flyg (RXFLY) 224 720 212 000Handels- och administrationsprogrammet 85 224 4 600 2 342 4 824 Handels- och administrationsprogrammet 85 224 80 400Hantverksprogrammet 112 784 4 600 3 099 6 384 Hantverksprogrammet 112 784 106 400Hotell- och turismprogrammet - Hotell- och turismprogrammet 0 0Industritekniska programmet - Industritekniska programmet 0 0Restaurang och livsmedelsprogrammet - Restaurang och livsmedelsprogrammet 0 0Naturbruksprogrammet - Djur 140 100 5 900 3 850 7 930 Naturbruksprogrammet - Djur 140 100 132 170Naturbruksprogrammet - Skog 172 032 7 500 4 727 9 738 Naturbruksprogrammet - Skog 172 032 162 294Naturbruksprogrammet - Lantbruk 170 653 6 700 4 689 9 660 Naturbruksprogrammet - Lantbruk 170 653 160 993Naturbruksprogrammet - Trädgård 162 094 5 400 4 454 9 175 Naturbruksprogrammet - Trädgård 162 094 152 919Naturvetenskapsprogrammet 83 316 4 600 2 289 4 716 Naturvetenskapsprogrammet 83 316 78 600Vård- och omsorgsprogrammet 93 916 4 600 2 581 5 316 Vård- och omsorgsprogrammet 93 916 88 600Samhällsvetenskapsprogrammet 81 408 4 600 2 237 4 608 Samhällsvetenskapsprogrammet 81 408 76 800Samhällsvetenskapsprogrammet Media (SAMED) - Samhällsvetenskapsprogrammet Media (SAMED) 0 0Ekonomiprogrammet 81 408 4 600 4 608 Ekonomiprogrammet 81 408 76 800Humanistiska programmet - Humanistiska programmet 0 0Teknikprogrammet 89 888 4 600 2 470 5 088 Teknikprogrammet 89 888 84 800Nationellt godkänd idrottsutbildning - tillägg lagidrptt 13 568 0 373 768 Nationellt godkänd idrottsutbildning - tillägg lagidrptt 13 568 12 800Nationellt godkänd idrottsutbildning - tillägg individuell idrott 16 218 0 446 918 Nationellt godkänd idrottsutbildning - tillägg individuell idrott 16 218 15 300Trosa kommuns prislista 2013 - Gy 11Program Belopp till fristående varav mat varav adm 3% varav moms 6%Barn- och fritidsprog. 82 203 5 466 2 259 4 653 SNBygg- och anläggningsprogrammet 111 814 5 466 3 072 6 329 SNBygg och anläggningsprogrammet - Anläggningsfordon 137 700 4 300 3 784 7 794 RPEl- och energiprogrammet 102 741 6 331 2 823 5 816 SVVS och fastighetsprogrammet 109 156 6 331 2 999 6 179 SEstetiska programmet 100 210 6 331 2 754 5 672 SEstetiska programmet Estetik och Media 104 423 6 331 2 869 5 911 SEstetiska programmet Musik 116 610 5 466 3 204 6 601 SNFordons- och transportprogrammet 129 239 5 466 3 551 7 315 SNFordons och transportprogrammet Transport (FTTRA) 169 648 5 466 4 662 9 603 SNFordons och transportprogrammet Flyg (RXFLY) 224 720 4 600 6 175 12 720 NHandels- och administrationsprogrammet 84 223 5 466 2 314 4 767 SNHantverksprogrammet 112 784 4 600 3 099 6 384 NHotell- och turismprogrammet 91 600 4 500 2 517 5 185 RPIndustritekniska programmet 133 000 6 400 3 655 7 528 RPRestaurang och livsmedelsprogrammet 129 363 6 331 3 555 7 322 SNaturbruksprogrammet - Djur 140 100 5 900 3 850 7 930 ÖNaturbruksprogrammet - Skog 172 032 7 500 4 727 9 738 ÖNaturbruksprogrammet - Lantbruk 170 653 6 700 4 689 9 660 ÖNaturbruksprogrammet - Trädgård 162 094 5 400 4 454 9 175 ÖNaturvetenskapsprogrammet 82 553 5 466 2 268 4 673 SNVård- och omsorgsprogrammet 88 173 5 466 2 423 4 991 SNSamhällsvetenskapsprogrammet 77 889 5 466 2 140 4 409 SNSamhällsvetenskapsprogrammet Media (SAMED) 93 110 6 331 2 558 5 270 SEkonomiprogrammet 77 889 5 466 2 140 4 409 SNHumanistiska programmet 74 370 6 331 2 043 4 210 STeknikprogrammet 89 731 5 466 2 466 5 079 SNNationellt godkänd idrottsutbildning - tillägg lagidrott 14 942 0 411 846 SNNationellt godkänd idrottsutbildning - tillägg individuell idrott 17 899 0 492 1 013 SNGul post = Baseras på genomsnitt av flera samverkansavtalGrön post = Baseras på enstaka samverkansavtal med Nyköping, Södertälje eller SalemBeige post = Baseras på avtal med Ökna/Östergötland/NyköpingFör program med Riksprislista och för Ökna har Riksprislistans matbelopp använts


TjänsteskrivelseKommunstyrelsenDnr KS 2012/1242013-02-18KommunkontoretJakob EtaatTel. 0156-520 06Fax. 0156-520 17jakob.etaat@trosa.seAnsökan om indelningsändring avseende läns- ochlandstingsbyte för Trosa kommunFörslag till beslutKommunstyrelsen föreslårKommunfullmäktige beslutaatt ansöka hos regeringen om en indelningsändring innebärandes byte av länoch landsting för Trosa kommun från Södermanlands län och landsting tillStockholms län och landsting.att begära hos kammarkollegiet och regeringen att indelningsändringen träder ikraft från och med den 1 januari år 2015._________ÄrendetBakgrundTrosa kommun har sedan våren 2012 kartlagt förutsättningarna för en s.k.indelningsändring innebärandes att kommunen övergår från Södermanlands länoch landsting till Stockholms län och landsting. Som ett led i denna process harkommunen tillsatt Björn Sundström och Derk de Beer att genom SverigesKommuner och Landsting, SKL, utreda förutsättningarna för ett läns- ochlandstingsbyte. Kommunen har även uppdragit åt utvecklingskonsult SuneEriksson att genomföra en ingående konsekvensbeskrivning av den eventuellaindelningsändringen.Kommunfullmäktige gavs den 5 december 2012, § 98 en återrapportering avovan angivna utredningar och uppdrog i samband med detta kommunstyrelsen1


att vidare utreda frågan inför ett slutligt ställningstagande i fullmäktige den 13mars 2013. Kommunstyrelsens har i den vidare utredningen remitterat ärendettill berörda nämnder och utskott inom Trosa kommun. Genom remissen harnämnder och utskott givits möjlighet att yttra sig i frågan och ingående redogöraför hur respektive verksamhet bedöms påverkas av ändringen.Parallellt med remissen har kommunen, efter beslut i fullmäktige, uppdragit åtStatistiska centralbyrån, SCB, att genomföra en opinionsundersökning i ärendet.Undersökningen genomfördes under januari till februari månad år 2013 ochsyftade till att ge fullmäktige en uppfattning av invånarnas inställning i frågan.Förvaltningen föreslår genom föreliggande skrivelse att fullmäktige fattar beslutom att ansöka hos regeringen om ett läns- och landstingsbyte. Förvaltningensförslag grundar sig i en samlad bedömning med utgångspunkt i genomfördopinionsundersökning, utlåtanden från ovan angivna utredningar samt yttrandenfrån berörda nämnder och utskott i Trosa kommun.Lagstiftningen rörande läns- och landstingsbytenKommunallagens portalparagraf fastslår att Sverige är indelat i kommuner ochlandsting och att varje landsting i regel motsvarar ett län. Utöver detta saknarkommunallagen tillämplighet i frågor rörande kommunala läns- ochlandstingsändringar. Bestämmelser om sådana s.k. indelningsändringar återfinnsistället i Lag om ändringar i Sveriges indelning i kommuner och landsting(1979:411), den s.k. indelningslagen. Enligt denna lagstiftning kan ett ärendeom ändring i den läns- och landstingskommunala indelningen bl.a. väckas av enmedlem av ett landsting som skulle beröras av förändringen. Trosa kommun är idet aktuella fallet en sådan medlem. Initiativet sker i praktiken genom attmedlemmen riktar en ansökan om indelningsändring till Kammarkollegiet, sompå regeringens uppdrag utreder förutsättningarna för ändringen.Kammarkollegiet ska i sin utredning bl.a. förvissa sig om att ändringen kan antasmedföra en bestående fördel för ett landsting, en del av ett landsting eller andrafördelar från allmän synpunkt. I lagens förarbeten (prop. 1978/79:157) beskrivsvad som avses med begreppet bestående fördel och vilka frågor som måstebeaktas vid prövning av ändringar i kommun- och landstingsindelningen.Kammarkollegiet har i sina tidigare tolkningar av förarbetet särskilt betonatvikten av förbättringar inom kollektivtrafik, infrastruktur, arbetsmarknad ochsysselsättning. I det fall en eller flera bestående fördelar kan identifieras ochövriga förutsättningar bedöms gynnsamma, lämnas ansökan och utredningvidare till regeringen för vidare beslut avseende landstingsindelningsändringenoch till riksdagen för beslut rörande länsindelningsändringen.2


Opinionsundersökning genom Statistiska centralbyrån, SCBI enlighet med kommunallagen kap 5 § 34 får fullmäktige besluta att:”[…] det som ett led i beredningen av ett ärende som fullmäktige skall handlägga skallinhämtas synpunkter från medlemmar i kommunen eller landstinget. Detta kan ske genomfolkomröstning, opinionsundersökning eller något liknande förfarande […]” 1Fullmäktige beslutade den 5 december 2012 att i enlighet med kommunallagensangivelser inhämta Trosa kommuns invånares synpunkter i frågan genom enopinionsundersökning. Undersökning genomfördes av Statistiska centralbyrån,SCB, under januari till februari månad år 2013 och bestod i enenkätundersökning som riktade sig till 1000 slumpvis utvalda invånare ikommunen i åldern 18 år och uppåt. 2Resultatet av undersökningen visar att en klar majoritet av Trosa kommunsinvånare anser att kommunen bör ansöka om att övergå till Stockholms län ochlandsting. Utifrån en svarsfrekvens på 65,9 procent angav 63,0 procent (+- 3,6procent) att de anser att Trosa kommun bör övergå till Stockholms län ochlandsting och 37,0 procent (+- 3,6 procent) att de anser att Trosa kommun börvara kvar i Södermanlands län och landsting eller ingå i annan region som ävenomfattar Södermanlands län. 3 (En uppdelning av resultatet visar att allaurvalsgrupper, män och kvinnor, samt samtliga ålderskategorier förespråkar ettbyte till Stockholms län och landsting.)För att kompensera för skevheter i urvalet knutna till bortfallet tillämpadeStatistiska centralbyrån kalibrering av vikter. Det kalibrerade resultatet visar, omän marginellt, på tydligare skillnader i resultatet än vid en raka uppräkning(63,8 procent förespråkar Stockholms län och landsting (+- 3,7 procent) och36,2 procent förespråkar Södermanlands län och landsting eller annanregiontillhörighet (+- 3,7 procent)).Opinionsundersökningen visar således, med hänsyn tagen till felmarginal ochbortfall, att en majoritet av Trosa kommuns invånare är positivt inställda till ettbyte till Stockholms län och landsting. 41 Sveriges kommuner och landsting, Kommunallagen med kommentarer och praxis, femte upplagan(Stockholm 2011) sid. 3642 Statistiska centralbyrån. Teknisk rapport. En beskrivning av genomförande och metoder.Opinionsundersökning Trosa kommun, (Stockholm 2013-02-14) sid 2.3 Ibid. Tabeller4 Ibid. Tabeller3


Utredning genom Björn Sundström och Derk de Beer (SKL)Trosa kommun tillsatte under våren 2012 Björn Sundström och Derk de Beer attgenom Sveriges kommuner och landsting, SKL, utreda förutsättningarna för denaktuella indelningsändringen. Sundström har tidigare, bland annat viaUtjämningskommittén, medverkat i en översyn av det kommunalautjämningssystemet, samt på uppdrag av Kammarkollegiet utrettförutsättningarna för ett länsbyte för Heby kommun, från Västmanlands län tillUppsala län. 5 I samband med länsbytet för Heby kommun uppdrogs Sundströmäven att bistå berörda länsstyrelser i att upprätta en ekonomisk reglering förhanteringen av övergångskostnaderna vid indelningsändringen. 6I utredningsrapporten Trosa kommun till Stockholm län och landsting? –Förutsättningar och konsekvenser, 2012-02-28 (bilaga) presenterar Sundströmoch de Beer en redogörelse över indelningsändringens ekonomiska konsekvenserför Trosa kommun, de båda berörda landstingen, samt ur ettskattebetalarperspektiv. Utredarna undersöker även indelningsändringenseffekter på landstingens och de statliga verksamheterna, samt granskar länsochlandstingsbytet ur ett demokratiskt och näringsgeografiskt perspektiv.De ekonomiska och verksamhetsmässiga effekterna för landstingen beskrivs avSundström och de Beer enligt nedan:”En indelningsändring som innebär att endast Trosa kommun överförs till Stockholms länoch landsting bedöms ha liten inverkan på sjukvårdsstrukturen i de båda landstingen ochdärmed också på hälso- och sjukvården i stort. Detsamma gäller kollektivtrafiken i bådeStockholms och Södermanlands län.” 7”En indelningsändring som innebär att Trosa kommun överförs till Stockholms län ochlandsting bör således inte strida mot indelningslagens intentioner om acceptablaförändringar vad beträffar landstingens verksamhet.” 8”En indelningsändring som innebär att Trosa kommun överförs från Södermanlands länoch landsting till Stockholms län och landsting strider således inte mot indelningslagensintentioner om acceptabla förändringar vad beträffar landstingens ekonomi.” 9Utredarna ser inte heller några hinder för en indelningsändring avseendeförändringar inom den statliga verksamheten:5 Sundström Björn. Heby kommun till Uppsala läns landsting? Förutsättningar och konsekvenser(Stockholm 1999-11-22)6 Sundström Björn. Hur hantera övergångskostnaderna om Heby byter län? (Stockholm 2005-09-23)7 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid 188 Ibid. sid. 189 Ibid. sid 264


”Utredningen har inte funnit några starka skäl som talar för att en effektiv statligförvaltning skulle försvåras om Trosa kommun överförs från Södermanland till Stockholmslän” 10En indelningsändring bedöms få positiva effekter ur näringsgeografiskt ochdemokratiskt hänseende:”[…] vad beträffar näringsgeografin så skulle en indelningsändring innebära att Trosakommun också administrativt hänförs till den arbetsmarknadsregion där kommun redanbefinner sig” 11”inget [finns] som talar för att kommunaldemokratin skulle påverkas negativt av enindelningsändring, snarare tvärtom” 12Utredarna visar på positiva näringsgeografiska och demokratiska effekterförenade med indelningsändringen och betonar även att inga formella hinderföreligger för att genomföra ändringen. Samtidigt noterar man den negativ effektsom läns- och landstingsbytet skulle medföra för Trosa kommunsförvärvsarbetande befolkningen i form av en trolig skattehöjning, till följd av enhögre skattesats i Stockholms län jämfört med i Södermanlands län. 13Granskningen föranleder dock Sundström och de Beer att komma till slutsatsenatt övervägande skäl talar för ett läns- och landstingsbyte och att: ”[…] samtligakriterier som indelningslagen ställer upp som villkor för en indelningsändring äruppfyllda” 14Utredning genom utvecklingskonsult Sune ErikssonTrosa kommun uppdrog under hösten 2012 utvecklingskonsult Sune Eriksson attgöra en detaljerad konsekvensbeskrivning av en eventuell indelningsändring.Utredningen genomfördes bland annat genom kartläggning och förteckning avavtal, överenskommelser och samverkansformer inom Stockholms län samtgenom kontakter och intervjuer med tjänstemän inom berörda myndigheter.Eriksson presenterade den 31 oktober 2012 resultatet av sin utredning i10 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid. 2311 Ibid. sid 2612 Ibid. sid 2613 Utredarna gör dock bedömningen att de inkomsttagare som dagligen pendlar med buss tillStockholm får en sammantagen ekonomisk effekt på plus minus noll med anledning av lägreresekostnader genom SL-kort.14 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid 265


apporten Länstillhörighetsutredning Trosa kommun. Konsekvensbeskrivning förTrosa kommun vid byte till Stockholms län. 15 (bilaga)Eriksson gör, i likhet med Sundström och de Beer, bedömningen att ett läns- ochlandstingsbyte skulle få en sammantaget positiv effekt för Trosa kommun ochdess invånare. En indelningsändring bedöms möjliggöra en närmare koppling tillkommunens naturliga näringsgeografiska område och samtidigt underlätta för dekommuninvånare som dagligen pendlar till Stockholm. 16Vid en indelningsändring skulle kommunens ansvar för kollektivtrafik överförastill Stockholms läns landsting. I det fall Trosabussen omfattas av den allmännatrafikplikten och tågtrafiken till Vagnhärad ingår i stomtrafiken skulle dettakunna innebära att båda trafikslagen ingår i SL-kortets taxa. Det skulle blandannat reducera resekostnaderna för de invånare som idag pendlar till Stockholm.Eriksson tydliggör dock att Trosabussen, som är en privatdriven direktbusslinje,inte garanderas att omfattas av den allmänna trafikplikten. Beslut om dettafattas av Stockholms läns landstings regionala kollektivtrafikmyndighet.Trosabussen bedöms dock sannolikt ingå i kollektivtrafikens utbudsstandard ochomfattas av trafikplikten. 17 Skulle så inte bli fallet kan en särlösning, i likhet mednuvarande lösning, komma att bli aktuell.Regionala planeringen är en viktig aspekt av indelningsändringen som Erikssonlyfter fram i sin utredning. I Stockholms län har länsstyrelsen ansvar för denregionala utvecklingen och Stockholms läns landsting ansvar förregionplaneringen. Regionplanen RUFS 2010 ligger till grund för den regionalautvecklingen och arbetet med en kommande plan förväntas påbörjas inom någotår. Genom en indelningsändring år 2015 bedöms Trosa kommun kunna ingå iarbetet med framtida RUFS och på så sätt få en möjlighet att i störreutsträckning kunna delta i den regionala utvecklingen. 18Eriksson gör samma bedömning som Sundström och de Beer avseende hälsoochsjukvården och menar att en indelningsändring inte bör medföra någrasvårigheter för hälso- och sjukvårdsverksamheten. Sjukvården i Stockholms länbedöms kunna klara det extratillskott som Trosa kommuns befolkning skullemedföra och genom ett länsövergripande sjukvårdsavtal med Stockholms länslandsting skulle invånarna i Trosa kommun dessutom kunna söka sjukvård isåväl Södermanlands län som i Stockholms län. Det skulle innebära att invånarei Trosa kommun som har upparbetade vårdkontakter i Södermanland kanbibehålla dessa samtidigt som Södermanlands läns landsting har möjlighet attupprätthålla ett patientunderlag från Trosa kommun.15 Eriksson Sune Länstillhörighetsutredning Trosa kommun. Konsekvensbeskrivning för Trosakommun vid byte till Stockholms län (2012-10-31)16 Ibid. sid 1717 Ibid. sid 1118 Ibid. sid 56


Med indelningsändringens effekter avseende förbättrad kollektivtrafik, hälso- ochsjukvård samt förbättrade möjligheter till regionalt inflytande gör Eriksson densamlade bedömningen att ett läns- och landstingsbyte skulle tillföra ett tydligtvärde för Trosa kommun och dess invånare. 19RemissyttrandenKommunstyrelsen beslutade den 21 november 2012, § 108 att som ett led iberedningen av ärendet remittera befintligt underlag till kommunens nämnderoch utskott för yttrande. Remissen syftade till att ge nämnderna möjlighet attyttra sig i ärendet och redovisa hur berörda verksamhetsområden skullepåverkas av ett läns- och landstingsbyte. Yttranden har inkommit frånekoutskottet, humanistiska nämnden, kultur- och fritidsnämnden, miljönämnden,teknik- och servicenämnden, samhällsbyggnadsnämnden och vård- ochomsorgsnämnden (bilaga).Nämnderna och utskottet är genomgående positiva till en indelningsändring ochsamtliga remissinstanser biträder ett byte av län och landsting.Indelningsändringens inverkan på verksamheterna bedöms dock till stor delvariera mellan olika nämnder och även mellan olika verksamhetsområden inomsamma nämnd.Humanistiska nämnden, miljönämnden och ekoutskottet gör bedömningen att enindelningsändring skulle ha en begränsad inverkan på berördaverksamhetsområden. Humanistiska nämnden anger att en indelningsändringsannolikt kommer innebära att Trosa kommun får tillgång till ett ökatkompetensnätverk med regional närhet till högre utbildning och utveckling. 20Kompetensförsörjning är en effekt som belyses även i miljönämndens ochekoutskottets yttranden. Genom en indelningsändring hoppas miljönämnden fåen utökad kompetensförsörjning och samtidigt reducera den personellasårbarheten. 21 Även ekoutskottet lyfter fram kompetensförsörjningen som enviktig positiv faktor och bedömer att en indelningsändring skulle innebära nyautvecklings- och samarbetsmöjligheter. 22Humanistiska nämnden, miljönämnden och ekoutskottet gör bedömningen att enindelningsändring har viss men begränsad inverkan för nämndernasverksamheter. Nämnderna anger att ett byte kommer att innebära att vissaetablerade samarbetsformer kommer att behöva upprättas på nytt i Stockholmslän. Detta betraktar man dock i första hand som en möjlighet tillkompetensutveckling.19 Eriksson Sune Länstillhörighetsutredning Trosa kommun. Konsekvensbeskrivning för Trosakommun vid byte till Stockholms län (2012-10-31) sid. 1720 Yttrande från humanistiska nämnden 2013-01-1021 Yttrande från miljönämnden 2012-12-2822 Yttrande från ekoutskottet 2013-01-167


Teknik- och servicenämnden bedömer att stora delar av nämndensverksamhetsområde, däribland upphandlingsverksamheten, förblir oförändrad aven indelningsändring. Inom kost- och städverksamheten kommer nyasamarbetsformer behöva etableras kring nutritionsfrågor. Nämnden bedömerdock att detta inte medför några negativa konsekvenser för berördverksamhet. 23Kultur- och fritidsnämnden ställer sig bakom en indelningsändring och anser attett byte av län och landsting skulle kunna erbjuda större kontaktytor inom såvälfritids- som kulturområdet. Nämnden anger dock att effekter för vissaverksamheterna är svårbedömda. Nätverk och samarbetsformer som etableratspå tjänstemannanivå kommer troligtvis kunna bibehållas även efter ett byte.Vissa samverkansformer kopplade till den politiska organisationen kommer dockbehöva upphöra till förmån för motsvarande samarbeten i Stockholms län.Effekterna av detta är enligt nämnden svåra att uppskatta. 24Samhällsbyggnadsnämnden anger i sitt yttrande att en indelningsändring skulleinnebära stora fördelar för nämndens verksamhetsområden. Fördelarna är delskopplade till tillväxtfrågor i stort men också till förbättrad tillgång till planeringsochkunskapsunderlag. Länsstyrelsen i Stockholms län bedöms genom en mindresårbar organisation ha bättre förutsättningar att uppnå kortarehandläggningstider vid handläggningen av enskilda ärenden. Bland de negativaeffekterna anges att länsstyrelsen i Stockholms län historiskt sett har haft längrehandläggningstider vid behandling av bygglov. 25Vård- och omsorgsnämnden bedömer i sitt yttrande att ett läns- ochlandstingsbyte skulle ha större inverkan på nämnden än för den enskildeinvånaren och brukaren. Inom hälso- och sjukvården skulle den störstaförändringen bli inom hemsjukvården som skatteväxlats i Södermanland. IStockholm föreslås en eventuell skatteväxling ske år 2015. I det fall denna inteblir aktuell så skulle en lösning kunna bli att Trosa kommun får utförahemsjukvården på uppdrag av landstinget i Stockholms län. 26Ett läns- och landstingsbyte skulle innebära att invånarna i Trosa kommunkommer att tillhöra ett annat huvudsjukhus. En dialog pågår emellertid omlänsöverskridande vård genom ett avtal mellan Södermanlands län ochStockholms län. Om ett sådant avtal upprättas skulle invånarna i Trosa kommunfå ett utökat vårdutbud genom att ha möjlighet att söka vård i såväl Stockholmsom Södermanland. 2723 Yttrande från teknik- och servicenämnden 2013-01-1424 Yttrande från kultur- och fritidsnämnden 2013-01-1425 Yttrande från samhällsbyggnadsnämnden 2013-01-1626 Yttrande från vård- och omsorgsnämnden 2013-01-0827 Ibid.8


Verksamheterna inom äldreomsorg och funktionshinderområdet bedöms intepåverkas nämnvärt av en indelningsändring. Ett läns- och landstingsbyte bördock kunna möjliggöra vidgade kontaktytor, nya möjligheter tillerfarenhetsutbyte samt tillgång till ny kompetens inom dettaverksamhetsområde. 28Nämnden gör vidare bedömningen att en indelningsändring skulle kunnamedföra fördelar inom arbetsmarknadsområdet då en tillhörighet till Stockholmslän, med dess utbud, skulle underlätta för de kommuninvånare som söker arbeteoch inte minst för de som har svårt att komma ut på den reguljäraarbetsmarknaden. Tillgången till de allmänna kommunikationerna inomStockholms län bör därtill ge en ökad möjlighet till lönearbete, särskilt förpersoner utan tillgång till eget fordon.Samlad bedömningEkonomiska effekterEffekter för landstingenDe ekonomiska effekterna av ett läns- och landstingsbyte påverkas av en radfaktorer. Sundström och de Beer redovisar i sin utredning en beräkning avförväntade effekter baserad på inkomster från skatter och bidrag, fördelning avnettodriftkostnader, fördelning av övriga kostnader och intäkter, samtekonomiskt utfall. 29 Sundström och de Beer gör utifrån sin beräkningbedömningen att en indelningsändring har mycket liten inverkan på de bådalandstingens ekonomier och troligtvis rör sig om motsvarande +- 1 öre påskatten. Orsakerna till detta går enligt Sundström och de Beer till stor del atthärleda till utjämningssystemets effekter. 30Indelningslagen anger att en preliminär ekonomisk reglering upprättas införregeringens beslut om en indelningsändring. Enligt Sundström och de Beer bören ekonomisk reglering göras om Trosa kommun överförs till Stockholms län ochlandsting. Denna reglering bedöms dock endast behöva omfattaöverföringsområdets lokaliserade tillgångar och skulder och bör ske genom attStockholms läns landsting övertar följande delar 31 :1. Tillgångar och skulder samt byggnader och anläggningar hänförliga tilllandstingsverksamheten i Trosa kommun.28 Yttrande från vård- och omsorgsnämnden 2013-01-0829 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid. 1030 Ibid. sid 1631 Ibid. sid. 249


2. Fordon, maskiner och inventarier hänförliga till sjukvården samt tandvården iTrosa kommun.3. Ansvaret för de borgens- och ansvarsförbindelser som tecknats föreindelningsändringen och som är hänförliga till landstingsverksamheten i Trosakommun.4. Förpliktelser gentemot anställda som vid indelningsändringen har sinarbetsplats helt knuten till landstingsverksamheten i Trosa kommun samtförpliktelserna mot avgångna landstingsanställda som tidigare haft sinarbetsplats i kommunen.En ekonomisk reglering, förenad med ett läns- och landstingsbyte för Trosakommun, bör mot bakgrund av detta förhålla sig okomplicerad. Detta medanledning av att samtliga fastigheter som är hänförliga tilllandstingsverksamheten redan ägs av Trosa kommun.Effekter för Trosa kommun och dess invånareFör Trosa kommuns del kommer en indelningsändring innebära att kostnader fördelar av kollektivtrafiken, färdtjänsten och hemsjukvården, som kommunen idagfinansierar, övergår till Stockholms läns landsting. Detta kommer enligtSundström och de Beer möjliggöra en sänkning av kommunalskatten med 60 örei Trosa kommun. 32En faktor som ytterligare bedöms kunna inverka på Trosa kommuns ekonomiskautfall är det nya förslag till utjämningssystem som föreslås träda i kraft den 1januari 2014. 33 Utjämningssystemet grundar sig delvis på länstillhörighet vilketåterspeglas i kostnadsutjämningen. En jämförelse med Stockholms länskommuner visar tydliga skillnader i kostnadsutjämningens utfall. Med det nyautjämningssystemet beräknas utfallet för Trosa kommuns del bli - 89 kronor perinvånare för kostnadsutjämningens delmodell för löner. Detta går att jämföramed utfallet för t ex Nykvarns kommun som är + 356 kronor per invånare ellerför Salems kommun som är + 387 kronor per invånare. Ett liknande förhållandegäller vid utjämningen av kollektivtrafikkostnaderna. Där får Trosa kommun meddet nya utjämningssystemet ett utfall på - 339 kronor per invånare samtidigtsom samtliga kommuner i Stockholms län får ett utfall på + 402 kronor perinvånare.En beräkningsgrund motsvarande t ex Nykvarns kommuns bedöms ge Trosakommun en positiv ekonomisk effekt motsvarande ca 50 öre på skatten.Samtidigt medför övergången från det nuvarande utjämningssystem till detförslag som förväntas träda i kraft från år 2014 en negativ effekt för Trosakommuns del på motsvarande 13 öre på skatten. Sammantaget uppskattas32 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid. 1533 Finansdepartementet. Förslag till ändringar i inkomstutjämningen för kommuner och landsting(Promemoria, Dnr Fi 20012/4726)10


nettoeffekten av en indelningsändring, parallellt med en övergång frånnuvarande utjämningssystem till det förslag som förväntas träda i kraft år 2014,möjliggöra en skattesänkning på 37 öre (+- 4 öre).Med landstinget Södermanlands, sedan årsskiftet genomförda, skattehöjningmed 60 öre bedöms den ekonomiska effekten av en indelningsändring idagsläget bli en skattehöjning med motsvarande 36 öre (+ - 4 öre) för Trosakommuns invånare.Ett läns- och landstingsbyte innebär en övergång till nya samarbetsorgan ochsamverkansformer. Kommunen kommer i och med detta också betala avgifter tillde samverkansformer man går in i och upphör att betala avgift till desamverkansformer man lämnar. Förändringen medför en viss ekonomisk effektför Trosa kommun. Denna bedöms dock bli begränsad, inte minst med anledningav att Trosa kommun kvarstår i ett flertal samverkansformer även efter ett länsochlandstingsbyte och att avgifterna för dessa i regel är kopplade tillinvånarantal och inte till länstillhörighet (t ex Mälardalsrådet, SKL, Stockholmbusiness alliance, Europakorridoren mm). Skillnaden i avgiftsnivå mellanbefintliga avtal och nya avtal är dessutom i flera fall marginell. Kommunenbetalar idag exempelvis ca 280 tkr per år till Regionförbundet Sörmland, vilketmotsvarar 0,58 promille av kommunens samlade skatter och statsbidrag.Stockholms motsvarighet till regionförbundet är Kommunförbundet Stockholmslän (KSL). Avgiften för detta medlemskap är max 0,5 promille av kommunenssamlade skatter och statsbidrag men uppgick år 2012 till 0,41 promille avmotsvarande del. 34Initialt kan vissa omställningskostnader uppkomma vid anslutning till nyasamarbetsorganisationer. Med aktuella uppsägningstider kommer vissasamverkansavtal även behöva överlappa nya avtal som sluts i Stockholms län.Den ekonomiska totaleffekten härledd till detta är svår att fastställa, inte minstmed anledning av att Trosa kommun inte beslutat om vilka samverkansformerman avser ingå i vid en indelningsändring. Bedömning görs dock attomställningskostnaderna, oberoende av vilka samverkansformer man ingår i, blirbegränsade.34 I Stockholms län finns även Södertörnskommunernas samarbetskommitté som är ett formelltsamrådsorgan mellan Södertörnkommunerna. Ett medlemskap i denna bedöms för Trosa kommunsdel bli ca 20 tkr per år.11


Kommunikationer och näringsgeografiska effekterEnligt Sundström och de Beer illustreras näringsgeografiska samband vanligtvisgenom arbetspendling. 35 För att indela och definiera lokala näringsgeografiskasamband används bland annat begreppet Lokala arbetsmarknader (LA). LA ärregionala indelningar som fastställs utifrån statistik över arbetspendling. 36Enligt Statistiska centralbyrån omfattar Mälardalen fem lokala arbetsmarknadervarav Stockholm är den största med 36 kommuner. Trosa kommun är en avdessa 36 kommuner. 52 procent av Trosa kommuns förvärvsarbetandebefolkning pendlar dagligen ut från kommunen och av dessa pendlar 82 procenttill Stockholms län och 13 procent till Södermanlands läns övriga kommuner.Arbetspendlingen skildrar den nära koppling som finns till Stockholms län vilketföranleder Sundström och de Beer att konstatera att en indelningsändring skulleföra kommunen närmare sin naturliga regiontillhörighet. 37Vid ett läns- och landstingsbyte övertar Stockholms läns landsting överkommunens kostnader och ansvar för kollektivtrafiken, vilket bland annatomfattar underskottstäckning och borgensåtaganden för framtida fordonsinköp.Genom att landstinget tar över ansvaret för trafiken kommer de regler somtillämpas på övrig trafik i Stockholms län även att tillämpas på Trosa kommun. 38Indelningsändringen innebär även att Stockholms läns landsting som regionalkollektivtrafikmyndighet kommer att ta ställning till om Trosabussen skagaranteras för allmän trafikplikt. 39 I det fall Trosabussen omfattas av allmännatrafikplikten och tågtrafiken ingår i stomtrafiken skulle resekostnadernareduceras och resandet underlättas för de invånare som idag pendlar tillStockholm. Med gällande utbudsstandarder, angivna i det regionalatrafikförsörjningsprogrammet för Stockholms län, skulle tillgängligheten förresenärer med kollektivtrafiken kunna öka genom bland annat tätare avståndmellan hållplatser mm. Genom att ingå som en del i stomtrafiken skulledessutom utbudet för tågtrafiken kunna öka genom fler avgångar. 40Genom en indelningsändring och de förbättringar inom kollektivtrafiken somdenna för med sig underlättas resandet för de invånare i Trosa kommun somdagligen pendlar till Stockholms län. Ytterligare en effekt som bedöms kunnafölja av förbättrade och billigare kommunikationer är att företag i Trosa kommunfår lättare att rekrytera arbetskraft från Stockholms län. Turismverksamhetenoch besöksnäringen skulle gynnas av billigare och bättre kommunikationer ochmed Stockholms läns landsting ambitioner om utökad båtpendling och båttrafikskulle ytterligare möjligheter kunna öppnas för Trosa kommun att ta emotbesökare, något som på sikt kan skapa fler arbetstillfällen och en positivekonomisk utveckling för hela Trosa kommun.35 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid 2136 Ibid. sid 2237 Ibid. sid 2238 Eriksson Sune Länstillhörighetsutredning Trosa kommun. Konsekvensbeskrivning för Trosakommun vid byte till Stockholms län (2012-10-31) sid 1039 Ibid. sid 1140 Ibid. sid 8ff12


Effekter avseende hälso- och sjukvårdEn indelningsändring innebär givetvis vissa förändringar inom hälso- ochsjukvården. En tydlig förändring är att Trosa kommuns invånare kommer atttillhöra ett annat huvudsjukhus. För kommunens del kommer övergångentroligtvis innebära att man kommer att behöva övergå till ett nytt IT-system förinformationsöverföring. För invånarna i Trosa kommun innebärindelningsändringen att vård primärt kommer att sökas i Stockholms län(sjukvård som omfattas av riksavtalet kan sökas i hela landet). Trosa kommunhar tillsammans med Södermanlands läns landsting bjudit in Stockholm länslandsting till dialog i syfte att upprätta ett avtal om länsövergripande vård. Ettsådant avtal finns idag mellan Stockholms läns landsting och Uppsala länslandsting och ett motsvarande avtal mellan Stockholm och Södermanland skulleinnebära att medborgarna i Trosa kommer skulle kunna välja i vilket län ochlandsting man vill ha sin vård. 41Den myndighetsutövning som kommunen idag har till uppgift att utföra, blandannat enligt Socialtjänstlagen (SoL) och lagen om stöd och service till vissafunktionshindrade (LSS) är likställd för hela landet och påverkas inte av enindelningsändring. En indelningsändring bedöms dock innebära attkostnadsfördelningen avseende tekniska hjälpmedel förändras. Som del iSödermanlands län står Trosa kommun idag för merparten av kostnaderna förhjälpmedel både i särskilt och ordinärt boende. I Stockholms län bekostas iställetalla hjälpmedel i ordinärt boende av landstinget medan hjälpmedelskostnaden isärskilt boende bekostas av kommunerna. 42Hemsjukvården är ytterligare en verksamhet inom hälso- och sjukvården somkan komma beröras av en indelningsändring. Idag ansvarar Trosa kommun förhemsjukvården genom skatteväxling. Även i Stockholms län planerar man attskatteväxla hemsjukvården. Detta kommer eventuellt ske år 2015, men skulle såinte bli fallet så kan en möjlighet för Trosa kommun vara att söka en särlösningför verksamheten.Äldreomsorgen bedöms beröras i mindre utsträckning av en ändring. Vissa av desamverkansformer som idag finns kommer sannolikt behöva upphöra till förmånför nya motsvarigheter i Stockholms län. Vissa samverkansformer som sker medTrosa kommuns grannkommuner bedöms dock kunna bibehållas även efter ettläns- och landstingsbyte.41 Yttrande från vård- och omsorgsnämnden sid 342 Ibid. sid 313


Demokratiska effekterSundström och de Beer för i sin utredning ett resonemang om demokratisklegitimitet härledd till: demos, det offentliga rummet och demokratiskaprocedurer. Enligt Sundström och de Beer behöver en bedömning avdemokratisk legitimitet bygga på samtliga dessa delar.DemosRepresentativa demokratier består i regel av mindre geografiska enheter medlokal och regional anknytning. Den territoriella identiteten härrör till såvälnationalstaterna som till dessa lokala och regionala enheter.Legitimitetsaspekten är komplex dels för att enheterna överlappar varandra menockså för att överlappningen ofta resulterar i olika politiska viljeriktningar inomsamma enhet. Regionala och lokala gränser har under senare år varit föremål förförändringar genom nya gränsdragningar. Parallellt med detta har äldreterritoriella indelningar, som tidigare varit viktiga för människor att identifiera sigmed, fått en minskad betydelse. Detta talar enligt Sundström och de Beer för atten demos kopplad till lokala och regionala gränser ofta saknas. 43Identitet och samhörighet är generellt sett svårt att mäta. Det sätt för vilketmänniskor bor och arbetar har förändrats och med detta även vad vi identifieraross med och känner samhörighet till. Stora delar av Trosa kommuns befolkningarbetar och vistas regelbundet i Stockholm och många har även andraanknytningar till länet. Den folkliga identiteten kopplad till Stockholms län ärdärför uppenbar och tydliggörs även genom den opinionsundersökning som SCBgenomfört. Genom undersökningens tydliga resultat skildras den anknytning somfinns till Stockholm och den medborgerliga och demokratiska vilja som finns föratt byta län och landsting.Det offentliga rummetGenom det offentliga rummet möjliggörs åsiktsutbyte och informationsspridningvilket är en förutsättning för den representativa demokratin och väl avvägdademokratiska val. Media såväl som politiska partier är väsentliga aktörer i detoffentliga rummet och för att en öppen debatt ska komma till stånd krävs attdessa aktörer får lämpliga forum att yttra sig i. I Sverige finns dessa forum bådenationellt genom rikstäckande radio, TV och press men också på regional ochlokal nivå genom lokal-TV, lokal radio och lokala dagstidningar. 44Med nya sätt att söka information har det offentliga rummet expanderat och idagkan människor ta del av lokal, regional, nationell och internationell informationgenom mer lättillgängliga medel. Det offentliga rummet i Trosa kommundomineras dessutom enligt Sundström och de Beer av media från Stockholm. 4543 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid. 2044 Ibid. sid 2045 Ibid. sid 2614


En övergång till Stockholms län och landsting skulle för Trosa kommuns delinnebära att man i större utsträckning ges möjlighet att ta del av informationsom har en naturlig anknytning till kommunen och medborgarna. Detta bedömsenligt Sundström och de Beer knappast påverka kommunaldemokratin negativtutan snarare tvärtom. 46Demokratiska procedurerPolitiska procedurer präglas i regel av politiska spänningar. Dessa kan enligtSundström och de Beer vara kopplade till partipolitiska motsättningar men ocksåtill politiska motsättningar mellan olika delar i en viss region. 47 Partipolitiskamotsättningar är en del i det politiska beslutsfattandet och hanteras i regelgenom majoritetsprincipen. Spänningar som går att härleda till geografiskamotsättningar inom en region bör enligt Sundström och de Beer dock hanterasmer varsamt. Dessa motsättningar tenderar annars att underminera denregionala politiken som helhet. 48 Med Trosa kommuns politiska ochmedborgerliga ambition om att byta län och landsting har en tydlig viljeriktninguppstått som är knuten till den geografiska indelningen snarare än tillpartipolitik. Med en indelningsändring hanteras denna viljeriktning genom attskapa en mer naturlig regional tillhörighet för Trosa kommun.De demokratiska procedurerna utgår till stor del genom de politiskaförsamlingarna och landstingsfullmäktige är den högsta beslutande församlingeni landstinget. Landstingsfullmäktige i Stockholm utgörs av ett större organ änlandstingsfullmäktige i Södermanland. Varje enskilt mandat i Södermanlandsläns landstingsfullmäktige ger därför en proportionellt sett större beslutanderättän mandaten i Stockholms läns landstingsfullmäktige. Stockholms län har ävenfler röstberättigade medborgare vilket gör att det krävs fler röster för att väljavarje enskilt mandat i landstingsfullmäktige.Samtidig bör man beakta att det inom ett län finns ett antal olika politiskaförsamlingar som medborgare och förtroendevalda kan vända sig till för att förafram sina åsikter. Trosa kommun kommer vid ett läns- och landstingsbyte gesmöjlighet att ingå i dessa församlingar och därigenom ges möjlighet att påverka.Som en del i Stockholms län och landsting blir denna påverkan dessutom än merrelevant för kommunen och dess medborgare.Johan SandlundKommunchefJakob EtaatKanslichef46 Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län och landsting? – Förutsättningaroch konsekvenser (Stockholm 2012-02-28) sid.2647 Ibid. sid 2048 Ibid. sid 2015


Bilagor1. Remissyttranden från nämnder och utskott i Trosa kommun: ekoutskottet(2013-01-16), humanistiska nämnden (2013-01-10), kultur- ochfritidsnämnden (2013-01-14), miljönämnden (2012-12-28), teknik- ochservicenämnden (2013-01-14), samhällsbyggnadsnämnden (2013-01-16)och vård- och omsorgsnämnden (2013-01-08)2. Sundström Björn, Beer de Derk. Trosa kommun till Stockholm län ochlandsting? – Förutsättningar och konsekvenser (Stockholm 2012-02-28)3. Eriksson Sune. Länstillhörighetsutredning Trosa kommun.Konsekvensbeskrivning för Trosa kommun vid byte till Stockholms län(2012-10-31)16


KommunkontoretElin Jansson van DoorenTel. 0156-520 24Fax. 0156-520 88elin.jansson@trosa.se2013-01-16Yttrande från ekoutskottet avseende utredning gällande läns- ochlandstingsbyte för Trosa kommunÄrendeKommunstyrelsen har 2012-11-21 beslutat att remittera utredning gällande läns- ochlandstingsbyte för Trosa kommun till ekoutskottet för yttrande.Ekoutskottets yttrandeTrosa kommun har sedan lång tid tillbaka starka kopplingar till Stockholm, inte minst somarbetsmarknadsregion. Det är viktigt att ta hänsyn till hur människors vardag ser ut och attlänstillhörigheten överensstämmer med de mönster och kontakter som finns i samhället. Mångainvånare i Trosa kommun arbetspendlar bl.a. dagligen till Stockholms län och för dessa skulleett länsbyte sannolikt innebära bättre kommunikationsmöjligheter mot Stockholmsområdet,vilket skulle vara positivt ur inte minst miljöhänseende.Ekoutskottet hanterar ingen myndighetsutövning men det är viktigt för verksamheten att ha ennära och bra kontakt med länsstyrelsen. Den kontakt som idag finns med länsstyrelsen iSörmlands län fungerar till övervägande del bra, och upprätthålls bl.a. genom deltagande i fleragemensamma nätverk. Kontakten med landstinget i Sörmland består även den i nätverksform.Trosa kommuns deltagande i de nätverk som finns idag bör kunna bibehållas eller ersättas avliknande kontaktnät i Stockholms län. Inom Södertörn finns etablerade nätverk som skulle varamöjliga att ansluta sig till. Nya kontaktytor kan vara utvecklande och leda till nya möjligheterinom verksamheten. Samarbeten med grannkommuner är även fortsättningsvis möjliga.Energirådgivningen i Trosa kommun är kopplad till Energikontoret i Mälardalen, där kommunenockså är delägare. Ett länsbyte innebär inte att Trosa måste byta energikontor och den kontaktsom finns med energikontoret idag fungerar mycket bra.Ekoutskottet gör bedömningen att ett länsbyte i dagsläget har förhållandevis liten betydelse förutskottets ansvarsområden. Det kan vara en nackdel att länsstyrelsen i Stockholm är större än iSörmland eftersom det kan innebära att den personliga kontakten blir mindre. Men den störreorganisationen innebär också mer specialkompetens vilket kan vara värdefullt inom specifikaprojektområden.SammanfattningEkoutskottet gör sammantaget bedömningen att länstillhörigheten har begränsad betydelse förutskottets ansvarsområden, men att ett länsbyte kan innebära nya utvecklings- ochsamarbetsmöjligheter.


Ekoutskottet förordar att kommunstyrelsen/kommunfullmäktige arbetar vidare med frågan medmålsättningen att byta län år 2015, förutsatt att den planerade opinionsundersökningen visarpå ett stöd från befolkningen.Elin Jansson van DoorenKommunekolog


2013-01-10Humanistiska nämndens yttrande gällande läns- ochlandstingsbyte för Trosa kommunHumanistiska nämnden ansvarar för förskoleverksamhet, skolbarnomsorg, kommunens utbildningför barn, ungdom och vuxen samt för kommunens uppgifter inom socialtjänstensindivid- och familjeomsorg. Synpunkterna lämnas utifrån nämndens olika ansvarsområden.FörskolaEtt läns- och landstingsbyte bedöms inte ge några direkta konsekvenser för förskolan, annatän att Trosa kommun får tillgång till kompetensnätverk inom Stockholms län som troligen ärbredare och djupare.SkolaEtt läns- och landstingsbyte bedöms inte ge några direkta konsekvenser för skolan, annat änatt Trosa kommun får tillgång till kompetensnätverk inom Stockholms län som troligen ärbredare och djupare.GymnasiumEftersom Trosa inte har några egna gymnasieskolor, så erbjuds gymnasieutbildning i Nyköpingoch Södertälje genom tecknande av samverkansavtal som innebär att Trosa kommunselever tas emot som förstahandssökande och därigenom konkurrerar på samma villkor somkommunernas egna elever.Det finns inget som hindrar att Trosa – även om samverkansavtal skulle slutas med helaStockholmsregionen – fortsättningsvis också har ett gymnasieavtal med Nyköpings kommun.Eftersom dessa antagningsprocesser också i Stockholm är webbaserade torde det inte varanågon större skillnad i funktion, kvalitet eller återkoppling, mellan att ha antagningskansliet iNyköping eller i Stockholm.VuxenutbildningMerparten (73 %) av de vuxenstuderande studerar idag i Nyköping. Diskussioner pågår förnärvarande om att Campus Nyköping skall kunna erbjuda en förmedlingsfunktion för alla vuxenstuderandeni analogi med gymnasieavtalet. SFI-verksamheten bedrivs framgångsrikt iegen regi och vår bedömning är att det, utifrån kvalitetsaspekter, finns särskilda skäl att fortsättabedriva SFI i egen regi även fortsättningsvis.Inom Sörmland har det funnits en samordning inför ansökning av statliga medel för YrkesVuxoch Lärlings-Vux. Någon sådan organisation finns för närvarande inte inom Stockholms län,och ett länsbyte kan troligen medföra att Trosa behöver administrera dessa ansökningar avegen kraft eller i samarbete med lämpliga samarbetspartners.HögskolaKontakterna med högskolan består idag av etablerade kontakter med Campus Telge, CampusNyköping, Södertörns högskola och Lärarhögskolan, men vi har också kontakter med andrauniversitet såsom Linköpings Tekniska Högskola och Karlstad universitet. Främst genom attlärarstudenter bedriver VFU (Verksamhetsförlagd utbildning) i Trosa.


Ett länsbyte skulle medföra att Trosa organisatoriskt skulle ingå som en mera naturlig partnerinom det RUC (Regionalt Utvecklings Centrum) som finns vid t ex Södertörns högskola. Kommunenskulle då också kunna få en annan regional närhet till övriga högskolor i länet.IntegrationsfrågorEtt läns- och landstingsbyte innebär inte några direkta konsekvenser för Trosa kommuns arbetemed integrationsfrågorSkolresorIdag studerar cirka 65 % av gymnasieeleverna i Nyköping. Införandet av Trosabussen harmedfört ett ökat antal elever som studerar i Stockholm. Denna utveckling förstärks troligenom resandet möjliggörs genom SL-kort. Trosa kommun kommer fortsättningsvis att köpabusskort till gymnasieelever som studerar i såväl Nyköping som Stockholm.Med anledning av det fria gymnasievalet kommer resealternativen för gymnasister till bådeNyköping och Stockholms läns kommuner att säkras vid ett eventuellt länsbyte.ElevhälsaEtt läns- och landstingsbyte innebär inga direkta konsekvenser för elevhälsan annat än attTrosa kommun får tillgång till ett bredare och djupare kompetensnätverk inom elevhälsansansvarsområde.Individ- och familjeomsorgNär det gäller Individ- och familjeomsorgens verksamheter så finns idag en rad olika formerav samverkan såväl inom som utanför länet. Socialjour utförs av Södertälje kommun. Vi haravtal med kvinnojouren Annfrid som bistår Trosa, Södertälje och Salems kommuner. Familjerådgivningkan erbjudas i Nyköping och i Stockholm genom avtal, såväl nu som efter etteventuellt länsbyte. När det gäller rehabsamverkan med landstinget så finns det idag en länsnärvårdsamverkan.Detta finns även i Stockholms län genom samverkan mellan Stockholmsstad och Stockholms läns landsting avseende rehabiliteringsinsatser. Barn- och ungdomspsykiatrinär en viktig resurs för nämndens verksamheter, den är väl utbyggd i Stockholms länoch har hög tillgänglighet vilket gagnar invånarna. Även missbuksinsatser är viktiga frågor förHumanistiska nämnden. Stockholms läns landsting har inom detta område ett väl utvecklatsamarbete med kommunerna, med bland annat beroendemottagning för unga vuxna. OmTrosa kommun kommer att ingå i södertörnkommunernas samarbete om social välfärd såinnebär det sannolikt en kvalitetsökning som kommer att gagna kommuninvånarna. När detgäller samverkan med arbetsförmedlingen så tillhör Trosa kommun redan i dag arbetsmarknadsområdeSödertälje. Den polissamverkan som finns idag ersätts av motsvarande i Stockholmslän vid ett eventuellt länsbyte. Inom detta finns även Barnahus (som är en samlingspunktför utredning och stöd till barn som utsatts för våld) att tillgå vid behov.SammanfattningHumanistiska nämnden gör den sammantagna bedömningen att ett läns- och landstingsbyteharbegränsad betydelse för nämndens ansvarsområden, samt att det inte föreligger någranegativa konsekvenser för våra verksamhetsområden. En indelningsändring innebär sannoliktatt Trosa kommun får tillgång till ett ökat kompetensnätverk med regional närhet till högreutbildning och utveckling inom nämndens verksamhetsområden, vilket bör gynna kommuninvånarna.


TjänsteskrivelseKultur- och fritidsnämndenDnr KFN 2013/32013-01-14Kultur, fritids, teknik- ochservicekontoretClaes-Urban BoströmTel. 0156-520 66Fax. 0156-523 03claes-urban.bostrom@trosa.seYttrande gällande länsbyteKultur- och fritidsnämnden föreslås besluta:att anta förvaltningens förslag till yttrande som sitt eget.______________Yttrande gällande effekter på kultur- och fritidsnämndensverksamheter vid ett länsbyteKultur- och fritidsnämnden har beretts möjlighet att yttra sig gällande ärendetläns- och landstingsbyte som just nu bereds i Trosa kommun.Ett länsbyte bedöms ha en övervägande positiv inverkan på kultur- ochfritidsområdet inom Trosa kommun. Vissa förändringar är dock svårbedömda ochskulle kunna innebära såväl positiva som negativa effekter på berördverksamhet.Kultur och fritidIdag har vi kommunövergripande nätverk som kretsar kring samverkan inom ettflertal områden så som kulturkonsulentområdet med arrangemang mm. Vi harsamverkan inom fritidsområdet för fritidskonsulenter och samverkan gällandebidrag och utbildningar/kurser. Inom bibliotek och kulturskola finns ett närasamarbete mellan de olika biblioteken och kulturskolorna i länet i gemensammaprojekt och utbildningar. Inom fritidsgårdsverksamheten samarbetar vi mellanfritidsgårdarna i länet för att lära av varandra och för att i viss mån delta ivarandras aktiviteter.


Samverkan och samarbeten på tjänstemannanivå mellan kommunerna iSödermanlands län bedöms kunna bibehållas även efter ett länsbyte. Med ettlänsbyte kommer vi dessutom ges möjlighet att delta i de olika nätverk somStockholms län har.De samverkansprojekt landstinget ingår i och det utbud vi idag utnyttjar genomlandstingets försorg övergår efter ett länsbyte till motsvarande i Stockholms län.Viss samverkan bör dock kunna bibehållas genom samverkansavtal medlandstinget Sörmland.Efter kontakt med landstinget i denna fråga ser vi gemensamma lösningar somskapar goda möjligheter för Trosa kommuns invånare och kulturliv. Vissverksamhet är dessutom kopplad till landskapet Sörmland och lär förblioförändrade vid ett länsbyte. Bland dessa kan nämnas Sörmlands museum.Den principiella hållningen är att länstillhörigheten inte ska hindra delaktighetoch deltagande i kulturaktiviteter. Allt publikt kan Trosa kommuns invånaresjälvklart ta del av även vid ett länsbyte, det är öppet för alla.Olika former av samarbetsavtal kan självklart tecknas om vi vill ta del av utbudetsom exempelvis Scenkonst Sörmland erbjuder. Idag finns sådana avtal mellanScenkonst Sörmland och vissa Stockholmskommuner.Goda möjligheter finns för att vid ett länsbyte finna samverkansformer ochpraktiska lösningar för verksamheterna. Då vi i dagsläget saknar upparbetadekontaktytor mot det nya länet kan vi inte fastställa vilka samverkansformer vi iframtiden kommer att delta i. Vi gör dock bedömningen att vi i och med ettlänsbyte kommer att beredas möjlighet att delta i de nätverk som finnsupprättade och ta del av det utbud som finns att tillgå. Trosa bör om önskvärtkunna välja att bibehålla anknytning till den Sörmlandsmodell som idag finnsmellan landstinget och Sörmlands kommuner, eller fullständigt övergå till detsamarbete som finns inom Stockholms län.FöreningslivFörvaltningen har haft kontakt med bl.a. Sörmlandsidrotten och görbedömningen att man inom föreningsidrotten har en pragmatisk inställning tillfrågan om länstillhörighet. Man visar en tydlig ambition om att föreningslivet iTrosa ska få vara kvar i länets samverkan och seriesystem om man så önskar.Det kan dock underlätta för alla inblandade parter om föreningarna inom Trosakommun enas och väljer samma länsserie inom samma idrottsgren.Redan idag är Södertälje och Nykvarn tillhörande Sörmlandsidrotten trots att detillhör ett annat län, så om Trosas föreningsliv har likande önskemål så finns ingahinder för en sådan lösning.För kulturföreningar finns inte samma uppbyggda samverkan via specialförbund irespektive län, utan här är samverkan mer flytande. Det innebär att ett länsbytebör medföra bredare kontaktvägar och ytterligare möjligheter att utövakulturintressen på fler orter. Redan idag finns stora möjligheter att röra sigmellan länen. Samverkansavtal måste dock upprättas om Trosa kommun villdelta i projekt och arrangemang som ett annat landsting är med och finansierar.Allmänna friluftsspår såsom Sörmlandsleden och liknande bedöms inte påverkasav ett länsbyte.


SammanfattningSammantaget ser vi positivt på ett byte av län då det inte begränsar våramöjligheter utan snarare ger oss fler möjligheter och större kontaktytor inomsåväl fritids- som kulturområdet.Viktigt i sammanhanget är också det faktum att valet vi står inför förmodligeninte är ett mellan Sörmlands län och Stockholms län utan istället mellanStockholms län och det län eller den region som Sörmland skulle kunna bli delav.Claes-Urban BoströmProduktionschef


Samhällsbyggnadskontoret 2012-12-28Mats Gustafsson, samhällsbyggnadschefTel. 0156-520 27Fax. 0156-520 88mats.gustafsson@trosa.seYttrande från miljönämnden avseende utredning gällande läns- ochlandstingsbyte för Trosa kommunÄrendeKommunstyrelsen har 2012-11-21 beslutat remittera utredningen gällande länsochlandstingsbyte för Trosa kommun till miljönämnden för yttrande.Miljönämndens synpunkterTrosa kommun är sedan lång tid tillbaka en del av Stockholmsarbetsmarknadsregion. Många av kommunens invånare har sin bakgrund iStockholms län och arbetar också i Södertälje/Stockholm. Kopplingarna motStockholm är starka och det finns en logik i en länstillhörighet som stämmeröverens med människors vardag.I dagsläget sköter Trosa kommun helt och hållet myndighetsutövningen inommiljö- och hälsoskyddsområdet. Under perioder där det varit svårt attupprätthålla en hög kompetens på kontoret har diskussioner tidigare förts mednågra sörmländska grannkommuner om ett gemensamt miljökontor. Om dennasituation åter skulle bli aktuell finns inom Stockholms län Södertörns miljö- ochhälsoskyddsförbund (Haninge, Nynäshamn och Tyresö) som skötermyndighetsutövningen inom området samt utövar tillsyn och handläggeranmälningar och ansökningar av olika slag. Miljönämnden ser det som en styrkaatt det inom Södertörnssamarbetet redan finns formaliserade samarbetsformersom skulle kunna vara möjliga att ansluta sig till omkompetensförsörjningsfrågan åter skulle bli problematisk.Miljönämnden gör bedömningen att ett länsbyte i dagsläget har liten betydelseför nämndens ansvarsområden. Det finns dock ett projektinriktat samarbeteinom Miljösamverkan Sörmland där länets kommuner varje år enas om ett antalprojekt som man arbetar gemensamt kring. Om Trosa kommun byter län är detsannolikt inte gångbart att fortsätta detta samarbete men nämnden görbedömningen att det inom ramen för Stockholms län finns goda förutsättningarför liknande samarbetsformer.Utöver Miljösamverkan Sörmland finns egentligen inga ytterligare formaliseradesamarbeten inom Södermanlands län. De frivilliga nätverk som finns bör kunnafortsätta eller ersättas av liknande nätverk i Stockholms län. Nämnden ser detockså som en stor fördel att tillhöra ett större län med en mer omfattandeLänsstyrelseorganisation. Detta bedöms ge en mindre sårbarhet såväl ihandläggningen av enskilda ärenden som vid rådgivning i komplexafrågeställningar.Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post:trosa@trosa.sewww.trosa.se


Samhällsbyggnadskontoret 2012-12-28Mats Gustafsson, samhällsbyggnadschefTel. 0156-520 27Fax. 0156-520 88mats.gustafsson@trosa.seSammanfattningMiljönämnden gör sammantaget bedömningen att länstillhörigheten harbegränsad betydelse för nämndens ansvarsområden men anser attkompetensförsörjningsfrågor och personell sårbarhet kan minska vid etteventuellt länsbyte.Förutsatt att den planerade opinionsundersökningen visar på ett stöd frånbefolkningen förordar Miljönämnden att Kommunstyrelsen/Kommunfullmäktigearbetar vidare med frågan med målsättningen att byta län 2015.Med vänliga hälsningarMats GustafssonSamhällsbyggnadschefPostadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post:trosa@trosa.sewww.trosa.se


TjänsteskrivelseTeknik- och servicenämndenDnr TSN 2012/522013-01-14Kultur, fritids, teknik- ochservicekontoretClaes-Urban BoströmTel. 0156-520 66Fax. 0156-523 03claes-urban.bostrom@trosa.seYttrande gällande remiss om länsbyteTeknik- och servicenämnden föreslås besluta:att anta förvaltningens förslag till yttrande som sitt eget.___________Yttrande gällande effekter på teknik- och servicenämndensverksamheter vid ett länsbyteTeknik- och servicenämnden har beretts möjlighet att yttra sig gällande ärendetläns- och landstingsbyte som just nu bereds i Trosa kommun.UpphandlingarTeknik- och servicenämndens verksamheter omfattas idag av en rad olika formerav samverkan inom länet. Vi har gemensamma upphandlingar med Nyköping,Oxelösund och Gnesta. I vissa fall gör vi även gemensamma upphandlingar medsamtliga kommuner i länet. Detta sker dock mer sällan.Båda formerna av upphandlingssamverkan bedöms kunna bibehållas även efterett länsbyte. Gemensamma upphandlingar sker av pragmatiska skäl och haringen koppling till länstillhörigheten.TekniskaGenom ett länsbyte öppnas möjligheter inom nämndens samtligaverksamhetsområden. Dessa möjligheter består i utökade nätverk ochsamverkansformer även med kommunerna i Stockholms län.Stockholmsområdets erfarenheter gällande teknisk försörjning skulle exempelviskunna bli något som även vårt kontor och nämnd kan komma till del.


Kost och städInom kost- och städverksamheten har vi ett länsövergripande nutritionsråd somarbetar med ett gemensamt uppdrag från Länsstyrgruppen, landsting ochkommuner i Sörmland. Inom detta samarbete arbetar vi med nutritionsfrågor,framförallt riktade mot vård och omsorg. Syftet är att förebygga undernäring föräldre och rutiner kring kost mm. Ett sådant samarbete skulle möjligen kunnapåverkas av ett länsbyte även om det bör kunna bibehållas i någon form. Genomett länsbyte bör vi dock kunna ingå i liknande och andra givande projekt inomkost- och städverksamheten i Stockholms län.SammanfattningEtt läns- och landstingsbyte bedöms sammantaget inte medföra några negativakonsekvenser för nämndens verksamhetsområden. Ett byte bedöms snararekunna erbjuda spännande utvecklingsmöjligheter genom större nätverk och flersamverkansmöjligheter.Att få möjlighet att ta del av Stockholms läns kommuners erfarenheter inomvåra verksamhetsområden skapar förmodligen en kompetensutveckling somTrosa kommun kommer att ha mycket nytta av.Det bör också nämnas att valet vi står inför förmodligen inte är ett mellanSörmlands län och Stockholms län utan istället mellan Stockholms län och detlän eller den region som Sörmland skulle kunna bli del av.Claes-Urban BoströmProduktionschef


Samhällsbyggnadskontoret 2013-01-16Mats Gustafsson, samhällsbyggnadschefTel. 0156-520 27Fax. 0156-520 88mats.gustafsson@trosa.seYttrande från samhällsbyggnadsnämnden avseende utredning gällandeläns- och landstingsbyte för Trosa kommunÄrendeKommunstyrelsen har 2012-11-21 beslutat remittera utredningen gällande länsochlandstingsbyte för Trosa kommun till samhällsbyggnadsnämnden föryttrande.Samhällsbyggnadsnämnden har i sitt yttrande gällande länstillhörighet valt attförst hantera frågan övergripande utifrån ett tillväxtperspektiv för att sedanbryta ner frågan för nämndens respektive ansvarsområde.Samhällsbyggnadsnämndens övergripande synpunkterTrosa kommun är sedan lång tid tillbaka en del av Stockholmsarbetsmarknadsregion. Många av kommunens invånare har sin bakgrund iStockholms län och arbetar också i Södertälje/Stockholm. Kopplingarna motStockholm är starka och det finns en logik i en länstillhörighet som stämmeröverens med människors vardag. Utöver dessa viktiga grundparametrar menarsamhällsbyggnadsnämnden att länstillhörigheten är av stor betydelse utifrån etttillväxtperspektiv. Även om kommunens invånare i hög utsträckning ser Trosasom en integrerad del i storstadsregionen är det inte självklart att man somboende i Stockholm överväger ett boende utanför länet även om det rentgeografiskt är närmre till regionens centrum än från många delar av Stockholmsläns norra delar. Nämnden menar att nuvarande länstillhörighet är hämmandeför kommunens tillväxtmöjligheter och att det finns en stor outnyttjad potential iatt synliggöra Trosa kommun som ett lika självklart boendealternativ somStockholms läns nuvarande yttre delar.Synpunkter utifrån nämndens respektive ansvarsområdeMät- och kartverksamhetMät- och kartverksamheten är idag upphandlad och sköts av Metria. Etteventuellt länsbyte påverkar inte detta förhållande.Mark och exploateringEtt länsbyte innebär inget tillskott av mark eller liknande, däremot gör nämndenbedömningen att exploateringstrycket sannolikt kommer att öka vilket bedömspositivt med avseende på Kommunfullmäktiges mål gällande befolkningstillväxt.Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post:trosa@trosa.sewww.trosa.se


Samhällsbyggnadskontoret 2013-01-16Mats Gustafsson, samhällsbyggnadschefTel. 0156-520 27Fax. 0156-520 88mats.gustafsson@trosa.seBostadsanpassningIntyg för bostadsanpassningsbidrag kommer i huvudsak från kommunensarbetsterapeuter men också i viss utsträckning från Landstinget iSödermanland. Ett länsbyte innebär sannolikt fler intyg från Stockholms länslandsting men detta bedöms ej nämnvärt påverka verksamheten.RäddningstjänstRäddningstjänsten är idag upphandlad och sköts av SörmlandskustensRäddningstjänst med bas i Nyköping. Ett eventuellt länsbyte påverkar inte dettaförhållande.ÖversiktsplaneringKommunen bedriver sedan länge en aktiv översiktsplanering med fokus påfunktionella regioner snarare än administrativa. Ett länsbyte ger sannoliktförvaltningen bättre förutsättningar till relevanta kunskapsunderlag ochbefolkningsprognoser genom den omfattande kunskap som finns i ämnet viaStockholms läns landsting.DetaljplaneringGenom det kommunala planmonopolet är detaljplaneringen främst eninomkommunal angelägenhet som i begränsad omfattning påverkas avlänstillhörigheten. En viktig aspekt är dock hur Stockholms länsstyrelse ärorganiserad för att hantera överklagade detaljplaner. Här visar statistiken attStockholms länsstyrelse historiskt har avgjort överklagade detaljplaner påungefär halva tiden jämfört med länsstyrelsen i Södermanland.BygglovBygglovhanteringen berörs i detta sammanhang främst genom hanteringen avöverklagade bygglov. Här visar länsstyrelsen i Södermanland en betydligt bättrestatistik än Stockholm gällande handläggningstid.Däremot har samhällsbyggnadsnämnden förhoppningen att den störreorganisationen i Stockholms länsstyrelse ska ge en minskad sårbarhet ihandläggningen av enskilda ärenden.StrandskyddKommunerna har uppdraget att hantera strandskyddsdispenser, däremot harrespektive länsstyrelse möjlighet att pröva varje enskilt dispensbeslut. Utifrånen grov jämförelse finns det inga stora skillnader mellan Stockholm ochSödermanland vare sig i benägenheten att överpröva beslut eller gällandehandläggningstid av överklagade beslut. Likt gällande bygglov gör nämndendock bedömningen att den större organisationen i Stockholms länsstyrelse börkunna ge en minskad sårbarhet i handläggningen av enskilda ärenden.Postadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post:trosa@trosa.sewww.trosa.se


Samhällsbyggnadskontoret 2013-01-16Mats Gustafsson, samhällsbyggnadschefTel. 0156-520 27Fax. 0156-520 88mats.gustafsson@trosa.seGIS/befolkningsprognoserEtt länsbyte ger sannolikt förvaltningen bättre förutsättningar till relevantakartunderlag och befolkningsprognoser genom den omfattande kunskap somfinns i ämnet via Stockholms läns landsting och samarbetsorgan iStockholmsområdet.SammanfattningSamhällsbyggnadsnämnden gör sammantaget bedömningen att det förnämndens verksamhetsområden skulle innebära stora fördelar att byta län tillStockholms län. Fördelarna handlar i första hand om att länstillhörigheten tydligtbedöms påverka möjligheterna att även framgent vara en tillväxtkommun vilketär ett av samhällsbyggnadsnämndens tydligaste mål. Även förbättrad tillgång tillmer utförligt och för Trosa kommun relevant planerings- och kunskapsunderlagbedöms som en viktig förbättringsmöjlighet. I handläggningen av enskildaärenden gör nämnden bedömningen att Stockholms länsstyrelse har bättreförutsättningar att vara mindre sårbara och på så vis undvika oskäligt långhandläggningstid av enskilda ärenden. På den negativa sidan noteras attLänsstyrelsen i Stockholms län historiskt haft längre handläggningstidergällande bygglov än Södermanlands Länsstyrelse.Förutsatt att den planerade opinionsundersökningen visar på ett stöd frånbefolkningen förordar Samhällsbyggnadsnämnden attKommunstyrelsen/Kommunfullmäktige arbetar vidare med frågan medmålsättningen att byta län 2015.Med vänliga hälsningarMats GustafssonSamhällsbyggnadschefPostadress: 619 80 Trosa • Besöksadress: Västra Långgatan 4-5 • Tel: 0156-520 00 Fax: 0156-520 17 • E-post:trosa@trosa.sewww.trosa.se


YttrandeVård- och omsorgsnämndenDnr VON 2012/352013-01-08Vård – och omsorgsnämndens yttrande avseende länsochlandstingsbyte för Trosa KommunVård- och omsorgsnämnden ansvarar för alla kommuninvånare som har behovav stöd, service och omvårdnad. Inom verksamhetsområdena ges insatser tillenskild utifrån Socialtjänstlagen (SoL), Lag om stöd och service till vissafunktionshinder (LSS) samt Hälso- och sjukvårdslagen (HSL). Yttrandet lämnasutifrån vård- och omsorgsnämndens olika ansvarsområde: Myndighetsutövning,Hälso- och sjukvård, Äldreomsorg samt Stöd och service.MyndighetsutövningMyndighetskontorets primära uppgift är att ta emot, utreda och besluta ombistånd enligt Socialtjänstlagen (SoL) samt om rätten till insatser enligt lag omstöd och service till vissa funktionshindrade (LSS). Ett eventuellt länsbytepåverkar inte detta arbete, då lagstiftning samt de prejudikat som kommer viaförvaltningsdomstolarna gäller för hela riket oavsett läns- ellerkommuntillhörighet.FörsäkringskassanFörsäkringskassan är en viktig aktör främst i utredningar avseende personligassistans och handläggningen i dessa ärenden. Idag fungerar det upparbetadesamarbetet mycket väl, och mot bakgrund av att det regelverk som styr kassansarbete är lika oavsett kontor förväntas detta goda samarbete fortsätta även vidett länsbyte.SamverkansparterI myndighetsutövningen finns det idag en mängd samverkansparter, ex. inomsjukvården och habiliteringen i landstinget. Detta kan initialt leda till att vikommer att få samverka med två huvudsjukhus om kommuninnevånarna kanvälja vilket sjukhus de vill tillhöra.Vad avser inriktning psykiatri har Södertälje sjukhus en väl fungerandepsykiatrisk verksamhet och ett nära samarbete med kommunerna iupptagningsområdet. Denna verksamhet har ett gott renommé gällandesamverkan med kommunala verksamheter.


Habiliteringsverksamheten, som finns i varje län, tar emot personer medutvecklingsstörning, rörelsehinder, motoriska utvecklingsavvikelser,flerfunktionshinder samt syn- och hörselskador. Inom Stockholms län ärhabiliteringsverksamheten väl utbyggd och det finns, förutom de ordinarieverksamheterna, även specialistenheter. Bland dessa kan nämnasAspergercenter som är ett stöd- och kunskapscenter som syftar till att stödjafamiljer med barn och ungdomar med Aspergerssyndrom/autismspektrumdiagnos med normal begåvning och vuxna med egenfunktionsnedsättning.Forskning och utveckling (FOU)Den samverkan som finns mellan kommunerna samt regionalt i länet kommeratt ändras, men inom vissa områden finns det redan utbyggda verksamheter.Exempel på verksamheter är t.ex. FOU Södertörn, vars verksamhetsområdenomfattar individ- och familjeomsorgen, funktionshinder samt socialpsykiatrin.Där finns även FOU Nestor med inriktning mot äldreomsorg. Målet för Nestor äratt bidra till en bättre kvalitet inom vården och omsorgen om äldre människor,och därmed ge högre livskvalitet för de äldre och deras anhöriga. Arbetet utgårfrån ägarorganisationernas mål och riktlinjer, men även utifrån behov ochintresse hos de äldre och deras anhöriga. Fungerande kollegieutbyten kommeratt kunna fortsätta men även mellan Södertörnkommunerna finns ett väl utbyggtkollegialt nätverk på olika nivåer för erfarenhetsutbyte.Hälso- och sjukvårdDen kommunala hälso- och sjukvården i Trosa ansvarar för sjukvård hospersoner i särskilt boende samt personer över 18 år i ordinärt boende inskrivna ihemsjukvård.HemsjukvårdenEn skillnad vid ett länsbyte är att hemsjukvården inte skatteväxlats i Stockholm.Enligt nuvarande planering ska det ske 2015. För personer som inte är skrivna iTrosa kommun och söker hemsjukvård här blir läget oförändrat.Betalningsansvaret ligger på hemkommunen enligt Riksavtalet.Avtalet för läkarmedverkan i särskilt boendeLäkartillgången styrs genom ett avtal för läkarmedverkan med landstingetSörmland, där läkare från Trosa vårdcentral är utförare. Enligt avtalet får dekommunala äldreboenden i Sörmland 10 läkartimmar/vecka/100 boendeplatser.Därtill kommer läkartid för hemsjukvård. Vid ett länsbyte ska ett avtal medStockholms län upprättas, det kan innebära att läkartillgången på de särskildaboendena kan komma att se annorlunda ut i jämförelse med idag. I Stockholmslän är det på flera ställen privata vårdbolag som utför läkaruppdraget åtlandstinget.


Nytt sjukhus, nya samarbetspartners och nya system förinformationsöverföringEtt eventuellt länsbyte innebär att medborgarna kommer att tillhöra ett annatlandsting och därmed också ett annat huvudsjukhus. Informationsöverföringenmellan vårdgivare i vårdkedjan är viktig för patientsäkerheten. I Sörmland finnsen överenskommelse om samverkan vid in- och utskrivning i slutenvården samten överenskommelse om gemensam IT-lösning för informationsöverföring(Prator). I Trosa har vi tillgång till en sammanhållen journal via NPÖ, NationellaPatientöversikten, där Sörmlands landsting producerar information.Stockholms län har ett annat IT-system för informationsöverföring (WebCare)och delar av vårdgivarna i Stockholm har gått med i NPÖ.Kommunalrådet i Trosa Kommun har tillsammans med Finanslandstingsrådet iSörmland bjudit in Stockholm läns landsting till dialog med mål att upprätta ettavtal om länsöverskridande vård. Ett sådant avtal finns idag mellan Stockholmsläns landsting och Uppsala läns landsting. Om ett sådant avtal kommer till ståndkommer medborgaren att kunna välja i vilket län/landsting hon/han vill ha sinvård. Det kommer i sin tur att innebära att personal inom framförallt hälso- ochsjukvården kommer att behöva ha upparbetade rutiner med flera sjukhus.För övrigt finns i Sörmland avtal gällande gemensam patientnämnd ochgemensam hygiensjuksköterska. Det finns överenskommelser om samverkanoch stöd till förbättringsarbetet för de mest sjuka äldre, överenskommelse omsamordning av insatser för habilitering och rehabilitering m.m. Motsvarandeavtal och överenskommelser finns även i Stockholm.De nätverk och arbetsgrupper som vi idag ingår i kan med största sannolikhetbytas till motsvarande i Stockholms län vid ett länsbyte.Ny hjälpmedelsadministrationKostnaderna för tekniska hjälpmedel delas idag mellan kommunen ochlandstinget där kommunen står för merparten av alla hjälpmedel både i särskiltoch ordinärt boende. I nuläget är fördelningen av kostnaderna mellan kommunoch landsting för hjälpmedelsverksamheten i Stockholm något annorlunda. Därstår landstinget för alla hjälpmedel i ordinärt boende medan kommunen står förmerparten i de särskilda boendena.ÄldreomsorgenÄldreomsorgens verksamheter ligger under vård- och omsorgsnämnden ochinnefattar hemtjänst och tre särskilda boenden, Trosagården och Ängsgården iTrosa samt Häradsgården i Vagnhärad. Hälso- och sjukvårdsinsatser kanpåverkas i viss mån, men verksamheterna som sådana kommer inte att berörasav ett län- och landstingsbyte.


SamverkanInom äldreomsorgens verksamheter finns idag åtskilligasamverkansformer/grupper inom länet. Sörmland har arbetat upp enorganisation för närvård, vilket betyder att alla vårdproducenter i lokalsamhället(primärvård, sjukhus, vård & omsorg, skola och socialtjänst) samverkar förindividens bästa. Det finns en gemensam nämnd för vård, omsorg ochhjälpmedel (VOHJS) som följs utav samarbete på olika nivåer. Dennasamverkansstruktur kommer med all sannolikhet att upphöra (för Trosakommuns del) vid ett länsbyte, och istället ersättas av samverkansformer iStockholms län. Emellertid samverkar Trosa kommun med landstinget ochgrannkommuner även utifrån ett geografiskt perspektiv. Det betyder attupparbetade samverkansformer kommer att fortgå om syftet ochfunktionaliteten är god och gagnar Trosa kommuns medborgare.FärdtjänstenI Stockholms län hanteras färdtjänst övervägande av landstinget. Det skullekunna innebära en förbättring för den enskilde då organisationen förhandläggning av färdtjänst kommer att bli påtagligt större, vilket kan underlättahanteringen och minska sårbarheten.Vård- och omsorgscollegeTrosa Kommun ingår i Vård- och omsorgscollege, som är ett samverkansforumför utbildningsanordnare och arbetsgivare i syfte att utveckla grundutbildningoch kompetensutveckling inom omvårdnadsområdet. Ett länsbyte skulleeventuellt kunna innebära att nya samverkansformer inom området börupprättas. I Stockholms län finns väl utarbetade samverkansfora som har somsyfte att öka kompetensen för idag yrkesverksamma och framtida anställda. Ettsådant är Forum Carpe, en kommungemensam funktion för verksamhets- ochyrkesutveckling i Stockholms län.Stöd och serviceStöd och service omfattar verksamheter som är riktade till personer med någonform av funktionsnedsättning (enligt LSS eller SoL). Stöd och service inbegriperockså arbetsmarknadsenheten (AME).SamverkanVerksamheterna som sådana kommer inte att beröras vid ett läns-/landstingsbyte. Precis som inom äldreomsorgens verksamheter finns ett antalsamverkansformer inom länet. Ett samarbete inom psykiatrin är Arbetsgruppsödra psykiatri (ASP), (som utfår ifrån organisationen för närvård) men somtidigare nämnts finns motsvarande arbetsgrupper och strukturer inomStockholms län (med särskild hänvisning till Södertälje sjukhus). Ingen negativkonsekvens förväntas för den enskilde, tvärtom kan ett byte av län medföra


tillgång till välutbyggda kompetensnätverk och fler specialistenheter inomområdet. Detsamma gäller för habiliteringsverksamheten, vilken står omnämndunder Myndighetsutövning/ Samverkansparter.AMEDet finns idag inga kända negativa konsekvenser för AME vid ett ev. länsbyte.Trosa Kommun är en del av Stockholms arbetsmarknadsregion och många avkommunens invånare har ett förflutet i Stockholms län och arbetar också där.Trosa Kommun tillhör arbetsmarknadsområde Södertälje, vilket innebär attsamverkan med arbetsförmedlingen inte heller kommer att påverkas.Då kopplingarna till Stockholm är starka och arbetsutbudet i Stockholm är störrekan ett byte av län få positiva effekter genom ökade chanser för arbetssökandeatt komma ut i arbete. En större möjlighet till lönearbete för personer medfunktionsnedsättningar torde också finnas, då tillgången till allmännakommunikationer ökar chanserna till anställning i Stockholms län även förpersoner utan tillgång till eget fordon.Sammanfattande bedömningUtifrån ovanstående görs bedömningen att ett läns- och landstingsbyte i vissmån skulle påverka verksamheterna inom vård och omsorg men inte denenskilde medborgaren i särskilt stor utsträckning.Myndighetsutövningen kommer inte att påverkas, då lagar samt de prejudikatsom kommer via förvaltningsdomstolarna gäller hela riket oavsett läns- ellerkommuntillhörighet.När det gäller hälso- och sjukvården består skillnaden främst i atthemsjukvården inte skatteväxlats i Stockholm. Emellertid pågår en diskussion iStockholms läns landsting och preliminärt kan en skatteväxling genomföras2015. Skulle så inte ske kan en lösning vara att Trosa Kommun utförhemsjukvård på uppdrag av landstinget i Stockholms län.Ett läns- och landstingsbyte innebär att kommuninvånarna kommer att tillhöraett annat huvudsjukhus. En dialog pågår emellertid avseende avtal omlänsöverskridande vård. Ett sådant avtal skulle kunna innebära en stor fördel denenskilde i Trosa Kommun har möjlighet att själv välja var hon/han vill ha sinvård. De verksamheter som bedrivs inom äldreomsorg ochfunktionshinderområdet berörs inte nämnvärt, men utifrån att det finns välutarbetade kompetensnätverk i Stockholms län är det sannolikt att Trosakommun i och med länsbyte får vidgade kontaktytor och därmed möjlighet till ettutökat erfarenhetsutbyte samt tillgång till kompetens och specialistenheter.Inom arbetsmarknadsområdet görs bedömningen att en tillhörighet i Stockholmslän skulle underlätta för de kommuninvånare som söker arbete i allmänhet, och isynnerhet för de som har svårt att komma ut på den reguljära arbetsmarknaden.Kopplingarna till Stockholm är starka och arbetsutbudet är större. Tillgången påde allmänna kommunikationerna inom Stockholms län bör därtill ge en ökadmöjlighet till lönearbete, särskild för personer utan tillgång till eget fordon.


Den sammantagna bedömningen är att ett byte av län och landsting kan ge enrad goda effekter mot bakgrund av de ökade möjligheter som Stockholms länerbjuder inom ett flertal områden. Dessa positiva effekter skulle vid ett läns- ochlandstingsbyte komma invånarna i Trosa kommun till del.Kajsa FiskProduktionschefPer-Uno NilssonMyndighetschefLena GernandtHälso- och sjukvårdschefMia KihlstrandÄldreomsorgschef


PM 1 (29)Trosa kommun till Stockholmlän och landsting?– Förutsättningar och konsekvenser –Björn SundströmDerk de Beer2012-02-28


PM 2 (29)FörordTrosa kommun har uppdragit åt undertecknad på Sveriges Kommuner och Landstingatt utreda förutsättningarna för ett läns- och landstingsbyte för kommunen.Den indelningsändring som är aktuell i sammanhanget innebär att Trosa kommunöverförs från Södermanlands län och landsting till Stockholms län och landsting.I denna rapport redovisas utredningens analyser och slutsatser. Utredningen hargenomförts av undertecknad i egenskap av särskild utredningsman med biträde avekonomen Derk de Beer.Sveriges Kommuner och Landsting har som organisation inte tagit ställning tillutredningens innehåll och slutsatser.Stockholm den 28 februari 2012Björn Sundström


2012-02-28 3 (29)Innehåll1 Inledning ......................................................................................................... 51.1 Uppdraget ................................................................................................. 51.2 Utredningen uppläggning ......................................................................... 52Vad krävs för en indelningsändring? ........................................................... 52.1 Regler om kommunal indelning ............................................................... 52.2 Kommunallagen ....................................................................................... 62.3 Indelningslagen ........................................................................................ 62.4 Bedömningsfaktorer ................................................................................. 63 Ekonomiska konsekvenser ............................................................................ 73.1 Allmänt ..................................................................................................... 73.2 Utmaningar som följer av en indelningsändring ...................................... 73.3 Utjämningssystemet ................................................................................. 83.3.1 Allmänt ..................................................................................................... 83.3.2 Inkomstutjämning ..................................................................................... 83.3.3 Kostnadsutjämning ................................................................................... 93.3.4 Strukturbidrag ........................................................................................... 93.3.5 Införandebidrag ........................................................................................ 93.3.6 Regleringsbidrag och regleringsavgift ..................................................... 93.3.7 Aktuella förändringar i utjämningssystemet ............................................ 93.4 Kostnader, intäkter och ekonomiskt utfall.............................................. 103.4.1 Beräkningsmetod .................................................................................... 103.4.2 Inkomster från skatter och bidrag ........................................................... 103.4.3 Kostnadsutjämningen ............................................................................. 113.4.4 Landstingens övriga intäkter .................................................................. 123.4.5 Gränssnitten mellan kommunerna och landstingen ................................ 133.4.6 Landstingens kostnader .......................................................................... 13Korrigering för skillnader i huvudmannaskap ............................................... 133.4.7 Landstingens resultaträkningar ............................................................... 143.4.8 Effekter för Trosa kommun .................................................................... 153.4.9 Skattebetalarperspektivet ........................................................................ 153.5 Slutsatser – ekonomiska konsekvenser .................................................. 164Övriga konsekvenser för landstingens verksamhet ................................. 174.1 Allmänt ................................................................................................... 174.2 Hälso- och sjukvården ............................................................................ 174.3 Kollektivtrafiken..................................................................................... 174.4 Övriga verksamheter .............................................................................. 184.5 Slutsatser beträffande den landstingskommunala verksamheten ........... 18


2012-02-28 4 (29)56Demokratisk legitimitet ............................................................................... 185.1 Allmänt ................................................................................................... 185.2 Demos ..................................................................................................... 195.3 Det offentliga rummet ............................................................................ 205.4 Demokratiska procedurer ....................................................................... 205.4 Slutsatser – den demokratiska aspekten ................................................. 21Näringsgeografiska konsekvenser .............................................................. 216.1 De näringsgeografiska sambanden ......................................................... 216.2 Slutsatser – näringsgeografin ................................................................. 2278Statlig verksamhet........................................................................................ 23Preliminär ekonomisk reglering ................................................................. 239Sammanfattande slutsatser och utlåtande ................................................. 249.1 Slutsatser ................................................................................................ 24Landstingens ekonomi ................................................................................... 24Kommunens ekonomi .................................................................................... 25Skattebetalarperspektivet ............................................................................... 25Landstingens verksamhet i stort ..................................................................... 25Demografi och demokrati .............................................................................. 25Näringsgeografiska samband ......................................................................... 25Statlig verksamhet m.m.................................................................................. 26Hinder mot en ändrad länsindelning .............................................................. 26Personalfrågor ................................................................................................ 269.2 Utlåtande................................................................................................. 26Bilaga 1 Konsekvenser om både Gnesta och Trosa byter län ......................... 28Bilaga 2 Konsekvenser om såväl Gnesta och Trosa som Håbo byter län ...... 29


2012-02-28 5 (29)1 Inledning1.1 UppdragetI december 2012 uppdrog Trosa kommun via kommunchefen åt undertecknad påSveriges Kommuner och Landsting att utreda förutsättningarna för och konsekvensernaav ett läns- och landstingsbyte för kommunen.Den indelningsändring som är aktuell i sammanhanget innebär att kommunenöverförs till Stockholms län och landsting.1.2 Utredningen uppläggningI föreliggande rapport redovisas utredningens analyser och slutsatser.Utredningen är disponerad enligt gängse praxis för liknande utredningar, som bl.a.innebär en genomgång av de kriterier som skall vara uppfyllda för att en indelningsändringska komma ifråga.Förutsättningarna för en ändring av rikets indelning i landsting, enligt den kommunalaindelningslagen, redovisas i kapitel 2.Kapitel 3 ger en bild av de ekonomiska konsekvenser som följer av en indelningsändringoch i kapitel 4 redovisas konsekvenserna för landstingens verksamhet istort.I kapitel 5-7 ges en beskrivning av de konsekvenser som följer av en indelningsändringmed avseende på de övriga faktorer som indelningslagen tillmäter särskiltstor betydelse i sammanhanget, dvs. de demokratiska, demografiska och näringsgeografiskaaspekterna samt konsekvenserna för annan verksamhet än den kommunalasom berörs av indelningsändringen ifråga.Kapitel 8 redovisar principerna för den ekonomiska reglering som skall göras isamband med en indelningsändring och i kapitel 9 sammanfattas utredningensslutsatser.I bilaga 1 redovisar utredningens analys av de konsekvenser som följer av att bådeTrosa och Gnesta överför till Stockholms län och landsting och i bilaga 2 redovisaskonsekvenserna av att även Håbo kommun, som ligger i Uppsala län, överförstill Stockholms län och landsting tillsammans med Gnesta och Trosa.2 Vad krävs för en indelningsändring?2.1 Regler om kommunal indelningRikets indelning i län, som härstammar från 1634 års regeringsreform, saknar författningsbestämmelser.Däremot finns bestämmelser om rikets indelning i kommuneroch landsting (kommunallagen) samt en lag om ändring i rikets indelning ikommuner och landsting och (indelningslagen).


2012-02-28 6 (29)2.2 KommunallagenEnligt 1 § kommunallagen är Sverige indelat i kommuner och landsting. I 2 § sägsatt varje landsting omfattare ett län, om inte något annat är särskilt föreskrivet.Varje län utom Gotland, som är en s.k. landstingsfri kommun, utgör ett landsting.Malmö kommun tillhörde tidigare (fram till 1999) inte något landsting men ingårnumera i Skåne läns landsting. Detsamma gäller för Göteborgs kommun som numeraingår i Västra Götalands läns landsting.2.3 IndelningslagenI indelningslagens 2 kapitel, som handlar om ändringar i landstingsindelningen,sägs i 1 § att”Regeringen får besluta om ändring i rikets indelning i landstingskommuner omhinder inte möter i länsindelningen. En ändring i den landstingskommunala indelningenfår dock ske endast om ändringen kan antas medföra bestående fördelför en landstingskommun eller en del av en landstingskommun eller andra fördelarfrån allmän synpunkt”.Det har inte ansetts nödvändigt att ta in uttryckliga bestämmelser i lagen om verkanav att en landstingskommun motsätter sig en indelningsändring eller om särskildhänsyn till önskemål och synpunkter från den eller de landstingskommunersom närmast skulle beröras av en ändring. Detsamma gäller befolkningens inställningi frågan. Detta hindrar dock inte att sådana hänsyn bör tas när en ändring ilandstingsindelningen ska beslutas.I fråga om den utredning som ska göras inför regeringens beslut om en ändradlandstingsindelning säger indelningslagen (2 kap 12 §) att paragraferna 22, 23, 25och 26 i 1 kapitlet (som handlar om ändringar i den kommunala indelningen) skatillämpas på motsvarande sätt.Det innebär attutredningen ska vara allsidig och omfatta alla omständigheter som inverkarpå frågan,samråd ska ske med dem som har intresse av frågan,förslag till ekonomisk reglering ska upprättas om utredningen visar att detfinns förutsättningar för en indelningsändring inför regeringens beslut ifrågan.Det är ovan nämnda bestämmelser som ligger till grund för såväl utredningensuppläggning som analyser och slutsatser.2.4 BedömningsfaktorerSom ovan nämnts säger indelningslagen att beslut om en indelningsändring endastfår fattas om ändringen efter prövning väntas medföra fördel för en landstingskommun,en del av en landstingskommun, eller andra fördelar från allmän syn-


2012-02-28 7 (29)punkt.Eftersom lagen är allmänt skriven får man läsa lagtextens kommentarer för att fåreda på vilka faktorer som tillmäts särskilt stor betydelse i sammanhanget. Enligtkommentarerna till lagtexten ska följande kriterier vara uppfyllda för att en störreindelningsändring ska komma i fråga. bättre villkor för kommunaldemokratin, bättre anpassning till demografiska och näringsgeografiska förhållanden, acceptabla förändringar beträffande landstingens ekonomi och den landstingskommunalaverksamheten.Med fördel för en del av en landstingskommun avses främst fördelar för befolkningeninom aktuellt överföringsområde. Sådana fördelar kan bl.a. handla om förbättradlandstingskommunal- eller annan service, mindre avstånd till regioncentrumeller bättre förhållanden vad beträffar kollektivtrafiken.De fördelar ur allmän synpunkt som kan komma att spela in vid regeringens bedömninghar enligt kommentarerna till lagtexten att göra med den regionala utvecklingen(näringsliv och arbetsmarknad).3 Ekonomiska konsekvenser3.1 AllmäntI detta kapitel redovisas en bedömning av de ekonomiska effekter som beräknasfölja av en indelningsändring som innebär att Trosa kommun överförs från Sörmlandslän och landsting till Stockholms län och landsting.Till grund för redovisningen ligger bl.a.Statistiska Centralbyråns (SCB:s) beräkning av landstingens inkomster förperioden 2010–2012 utifrån gällande utjämningssystem,de båda landstingens bokslut för 2010 (de senast tillgängliga boksluten), Trosa kommuns räkenskapssammandrag för 2010,3.2 Utmaningar som följer av en indelningsändringTanken bakom det kommunalekonomiska utjämningssystemet är att alla landstingrespektive kommuner ska ha likvärdiga ekonomiska förutsättningar. Således bordedet inte spela någon roll hur den framtida landstingsindelningen ser ut.Det är dock inte alltid som teori och praktik stämmer överens. I Mälardalen är detframför allt tre stora utmaningar som politiken ställs inför om den nuvarandelandstingsindelningen ska ändras.Den första utmaningen handlar om historiska överenskommelser samt skillnader ikostnadsnivåer och uppgiftsfördelning mellan kommuner och landsting i respektivelän. Dessa skillnader har varit styrande för tidigare skatteväxlingar och nivån


2012-02-28 8 (29)på de länsvisa skattesatserna, som i sin tur påverkar bidragen/avgifterna i inkomstutjämningen.Den andra utmaningen handlar om kvarstående skillnader i uppgiftsfördelning ochkostnadsnivåer. Stockholms läns landsting har ett ensamt ansvar för kollektivtrafikeni länet och har heller inte växlat över hemsjukvården till kommunerna, vilketman gjort i Sörmland. Vidare är kostnadsskillnaderna betydande.Den tredje utmaningen handlar om de ekonomiska konsekvenserna sett i ett skattebetalarperspektiv.Landstingsskatten i Stockholms län är för närvarande 12,10procent medan motsvarande skattesats för Sörmland är 10,17 procent.Den som främst förklarar en potentiell skattehöjning för invånarna i Trosa efter ettlänsbyte är höga sjukvårdskostnader på grund av en hög sjukvårdskonsumtion iStockholms län.3.3 Utjämningssystemet3.3.1 AllmäntDet nuvarande systemet för kommunalekonomisk utjämning infördes den 1 januari2005 efter förslag från regeringen i prop. 2003/04:155. Syftet är detsamma somför det tidigare systemet (perioden 1996–204), dvs. att skapa likvärdiga ekonomiskaförutsättningar för alla kommuner och landsting i landet att kunna tillhandahållasina invånare likvärdig service oberoende av kommuninvånarnas inkomsteroch andra strukturella förhållanden.Det nu gällande utjämningssystemet består av fem olika delar:inkomstutjämningkostnadsutjämningstrukturbidraginförandebidrag (t.o.m. 2010) ochregleringsbidrag/regleringsavgift.3.3.2 InkomstutjämningI inkomstutjämningen sker en utjämning av skattekraft som garanterar alla kommunerrespektive landsting ett i stort sett lika stort skatteunderlag per invånare.Utjämning avseende skillnader i skattekraft har i någon form funnits sedan 1917.Den nuvarande inkomstutjämningen, som tillämpats sedan 2005, innebär att stateni huvudsak finansierar utjämningen.År 2012 får 279 av 290 kommuner och 19 av 20 landsting ett inkomstutjämningsbidragsom beräknas utifrån skillnaden mellan den egna beskattningsbara inkomstenoch ett skatteutjämningsunderlag som motsvarar 115 procent av den genomsnittligaskattekraften i riket. Kommuner och landsting vars beskattningsbara inkomsteröverstiger den garanterade nivån betalar i stället en inkomstutjämnings-


2012-02-28 9 (29)avgift till staten. För närvarande är det bara Stockholms läns landsting som betalaren inkomstutjämningsavgift till staten. Av de 11 kommuner som betalar inkomstutjämningsavgiftligger 9 i Stockholms län och 2 i Skåne.Perioden 2005–2011 uppgick den garanterade skattekraften för landstingen till110 procent vilket innebar att utfallet vid skatteväxlingar till följd av huvudmannaskapsförändringarmellan kommuner och landsting inte blev neutralt.3.3.3 KostnadsutjämningI kostnadsutjämningen utjämnas för opåverkbara strukturella kostnadsskillnader.Dessa kan vara av två slag. Det ena är att behovet av kommunal verksamhet ärolika. Det andra är att kostnaden för att producera en viss service varierar.Kommuner och landsting med en ogynnsam kostnadsstruktur får ett bidrag avstaten. De som har en gynnsam struktur får i stället betala en avgift till staten.Kostnadsutjämningen är statsfinansiellt neutral, eftersom summan av bidrag ochavgifter är lika stora och därför tar ut varandra.Huvuddragen i 2005 års kostnadsutjämning kvarstår, men har förenklats genomatt vissa delar tagits bort. Ett nytt inslag sedan 2008 är att kostnadsutjämningen nuockså delvis beaktar strukturella skillnader i lön som påverkar kostnaden för attbedriva verksamhet i olika delar av landet.3.3.4 StrukturbidragDe delar av kostnadsutjämningen som före 2005 var av regionalpolitisk karaktäråterfinns i nuvarande system i form av ett strukturbidrag som finns vid sidan avkostnadsutjämningen. Strukturbidrag utgår inte till alla kommuner och landstingutan endast till de som tidigare fick tillägg i vissa delmodeller och/eller fick störreintäktsminskningar genom den systemförändring som skedde 2005.3.3.5 InförandebidragNär systemet ändrades 2005 förändrades intäkterna för många kommuner ochlandsting. För att mildra omfördelningseffekterna av regeländringarna för de somfick kraftiga intäktsminskningar tillämpades särskilda införandebidrag under perioden2005–2010 i syfte att fördela intäktsbortfallet på grund av det nya systemetöver flera år.3.3.6 Regleringsbidrag och regleringsavgiftRegleringsbidraget eller regleringsavgiften utgör skillnaden mellan de av riksdagenanvisade medlen på anslaget för kommunalekonomisk utjämning och summanav ovan beskrivna bidrag och avgifter. Regleringsbidraget eller regleringsavgiftenfördelas mellan kommunerna respektive landstingen med ett enhetligt belopp perinvånare.3.3.7 Aktuella förändringar i utjämningssystemetI april 2011 presenterade Utjämningskommittén.08 ett antal förslag till förändringari utjämningssystemet i betänkandet Likvärdiga förutsättningar – Översyn av


2012-02-28 10 (29)den kommunala utjämningen (SOU 2011:39).Förslagen har ännu inte riksdagsbehandlats varför det är osäkert hur det blir meddessa. Men om förslagen går igenom i sin helhet kommer Trosa kommuns intäkteratt försämras med 230 kronor per invånare eller drygt 2,6 miljoner kronor. Motsvarandeutfall för Sörmlands läns landsting blir plus 950 kronor per invånareeller cirka 260 miljoner kronor. För landstinget i Stockholms län blir utfallet plus29 kronor per invånare eller cirka 60 miljoner kronor.I sammanhanget bör nämnas att ett av kommitténs förslag – höjningen av landstingensgarantinivå i inkomstutjämningen från 110 till 115 procent – redan harträtt i kraft (fr.o.m. 2012).3.4 Kostnader, intäkter och ekonomiskt utfall3.4.1 BeräkningsmetodDe samlade effekterna för de berörda landstingen av en indelningsändring redovisasi form av förväntad förändring av årets resultat. Redovisade effekter har stegvisberäknats enligt följande.1. Inkomster från skatter och bidrag2. Fördelning av 2010 års nettodriftskostnader (enligt bokslut)3. Fördelning av övriga kostnader och intäkter4. Ekonomiskt utfallEffekterna för Trosa kommun, liksom för kommunens skattebetalare, redovisasseparat.3.4.2 Inkomster från skatter och bidragI tabell 3.1 redovisas hur landstingens intäkter från skatter och bidrag skulle haförändrats om en indelningsändring skett per den 1 januari 2011 och om 2012 årsgarantinivå i inkomstutjämningen redan hade varit genomförd.


2012-02-28 11 (29)Tabell 3.1 Landstingens intäkter från skatter och bidrag i inkomstutjämningenföre och efter en eventuell indelningsändringFöre ändringEfter ändringTrosa Sörmland Stockholm Sörmland StockholmAntal inv. den 1/11 11 469 270 455 2 050 192 258 986 2 061 6612010Utdebitering 2011 10,17 12,10 10,17 12,10Länsvis skattesats 9,15 9,53 9,15 9,53Uppräknat skatteunderlag45 533 422 882 43 312 425 103(mkr)Garanterat skatteunderlag55 526 418 917 52 919 421 261(mkr)Underlag för utjämning9 729 – 3 964 9 607 – 3 842(mkr)Skatteintäkter, exkl.4 631 51 169 4 405 51 437avräkning (mkr)Inkomstutjämning890 – 377 879 – 367(mkr)Summa skatt & inkomstutj.(mkr)5 521 50 791 5 284 51 070Intäktsförändring– 237 279(mkr)Summa skatt & inkomstutj.(kr/inv)20 413 24 774 20 402 24 772Intäktsförändring– 11 – 2(kr/inv))Källa: SCB och egna beräkningarSom framgår av tabell 3.1 har en eventuell indelningsändring liten inverkan pålandstingens ekonomiska förutsättningar, åtminstone så länge förutsättningarnamäts i termer av intäkter per invånare. Att utfallet blir som det blir kan helt ochhållet tillskrivas utjämningssystemet.3.4.3 KostnadsutjämningenNär det gäller kostnadsutjämningen är beräkningen i det följande något osäker,vilket beror på att alla uppgifter som krävs för en korrekt beräkning inte finns tillgängliga(gäller den del som berör Trosa kommun). Detta gäller såväl den nuvarandekostnadsutjämningen som den som tidigast kan träda i kraft den 1 januari2013.Utredningens bedömning av hur de osäkra variablerna skulle kunna påverka utfalletär att det högst handlar om några tiondels procent av de totala intäkterna.


2012-02-28 12 (29)Tabell 3.2 Landstingens bidrag respektive avgifter i kostnadsutjämningen2011, dels i dagens system, dels enligt Utjämningskommittén.08:s förslagLandsting Folkmängd31/122009HälsoochsjukvårdBefolkningsförän.Löner KollektivtrafikStrukturkostnadTillägg/avdrag(kr/inv)NuvarandeSörmland 269 053 18 596 0 – 37 557 19 116 – 539Stockholm 2 019 182 18 103 107 107 1 733 20 050 395Sörml.exkl. 257 607 18 596 0 – 37 546 19 105 – 550TrosaSthlm + 2 030 628 18 106 107 107 1 731 20 051 396TrosaFörslagSörmland 269 053 19 579 0 – 73 580 20 086 431Stockholm 2 019 182 17 947 107 212 1 729 19 995 340Sörml.exkl. 257 607 19 579 0 – 73 566 20 072 417TrosaSthlm + 2 030 628 17956 107 212 1 729 20 004 349TrosaKälla: SCB och egna beräkningarSom framgår av tabell 3.2 leder en eventuell indelningsändring inte till några störreeffekter beträffande kostnadsutjämningen. Sörmlands läns landsting beräknasförlorar cirka 11 kronor per invånare i kollektivtrafikmodellen men å andra sidanblir landstinget av med kostnader om Trosa kommun byter län. Av tabellen framgårvidare att Utjämningskommitténs förslag ger en betydande inkomstförstärkningför Sörmlands läns landsting i kostnadsutjämningen, 970 kronor per invånareeller cirka 260 miljoner kronor.3.4.4 Landstingens övriga intäkterSom ovan redovisats har en eventuell indelningsändring liten inverkan på landstingensekonomiska förutsättningar om man enbart ser till intäkter från skatter ochbidrag i landstingens resultaträkningar.För att få en komplett bild av de ekonomiska effekterna vid en indelningsändringbör man även beakta vad som händer med landstingens övriga intäkter.Det som finansierar landstingens kostnader, bortsett från skatter och statsbidrag,är i huvudsak vårdintäkter från andra landsting och kommuner, försäljning av varoroch tjänster samt patientavgifter.Utredningens bedömning är att en indelningsändring har mycket liten inverkan påpatientintäkterna. När det gäller patientavgifterna för läkarbesök är avgifternanågot högre i Stockholms läns landsting. Vid en eventuell indelningsändringkommer Trosa kommuns invånare att få anpassa sig till den högre avgiftsnivån.


2012-02-28 13 (29)3.4.5 Gränssnitten mellan kommunerna och landstingenSkillnader i uppgiftsfördelningen mellan kommunerna och landstinget irespektive län kommer också att påverka det ekonomiska utfallet.I Stockholms län har landstinget det finansiella ansvaret för all kollektivtrafik ilänet medan ansvaret i Sörmlands län är delat mellan landstinget och kommunerna.Stockholms läns landsting här även ansvaret för hemsjukvården och färdtjänsten,ett ansvar som ligger på kommunerna i Sörmlands län.Summerar man alla skillnader i huvudmannaskap mellan landstingen finner manatt en indelningsändring skulle innebära ett minskat åtagande för Trosa kommunsom svarar mot cirka 60 öre på skatten, se vidare avsnitt 3.4.8.3.4.6 Landstingens kostnaderI tabell 3.3 redovisas hur landstingens kostnader fördelar sig på olika verksamhetsområdenföre och efter en eventuell indelningsändring om fördelningen görsefter befolkningsandelen i respektive län och under förutsättning att Sörmlandsläns landsting förmår att anpassa kostnaderna efter antalet invånare.Tabell 3.3 Landstingens kostnader för olika verksamheter före och efter enindelningsändring (kr/inv., efter befolkningsandelen)FöreEfterStockholm Sörmland Stockholm SörmlandPrimärvård 3 777 3 328 3 756 3 328Specialiserad somatisk vård 11 458 11 424 11 458 11 424Specialiserad psykiatrisk vård 2 425 1 843 2 421 1 843Övrig hälso- och sjukvård 1 668 1 141 1 665 1 141Politisk verksamhet 91 140 91 140Tandvård 383 542 384 542Läkemedel inom förmånen 2 238 2 235 2 238 2 235SUMMA HÄLSO- OCH SJUK-VÅRDEXKL TANDVÅRD21 657 20 112 21 648 20 112REGIONAL UTVECKLING,TOTALT3 839 958 3 823 958Därav Trafik 3 497 528 3 481 528Utanför verksamheten 61 395 63 395NETTOKOSTNAD TOTALT EF- 25 940 22 007 25 918 22 007TER BEFOLKNINGSANDELKälla: Landstingens resultaträkningar och egen beräkningKorrigering för skillnader i huvudmannaskapDet som ovan redovisas i tabell 3.3 speglar hur kostnaderna skulle förändras i deberörda landstingen efter en indelningsändring om landstingens åtagande var identiska.Som tidigare redovisats har Stockholms läns landsting ett ensamt finansieringsansvarför kollektivtrafiken, färdtjänsten och hemsjukvården. I Sörmlands länär huvudmannaskapet delat mellan kommunerna och landstinget vad beträffar


2012-02-28 14 (29)kollektivtrafiken medan kommunerna har ansvaret för färdtjänsten och hemsjukvården.I tabell 3.4 redovisas hur landstingens nettokostnader skulle förändras om Trosakommun överförs till Stockholms län och landsting. Beräkningen förutsätter attSörmlands läns landsting förmår att anpassa sina kostnader efter invånarantalet.Tabell 3.4 Landstingens nettokostnader 2010 justerat för skillnader ihuvudmannaskap (kr/inv.)Sörmlands länslandstingStockholms länslandstingNETTOKOSTNAD TOTALT EFTER22 007 25 918BEFOLKNINGSANDELJustering kollektivtrafik 0 – 14Justering färdtjänst 0 – 2Justering hemsjukvård 0 – 1JUSTERAD NETTOKOSTNAD 22 007 25 901Nettokostnad före indelningsändring 22 007 25 940Förändring 0 – 39Utdebiteringseffekt (kr/skkr) 0 – 0,01Källa: Landstingens resultaträkningar och egen beräkningSom framgår av tabell 3.4 sjunker Stockholms läns kostnader per invånare förbåde kollektivtrafik, färdtjänst och hemsjukvård om Trosa kommun överförs tillStockholms län och landsting. Skälet härtill är att invånarna i Trosa kommun genererarlägre kostnader per invånare för verksamheterna i fråga jämfört med invånarnai Stockholms län.3.4.7 Landstingens resultaträkningarI tabell 3.5 redovisas hur de berörda landstingens resultaträkningar skulle förändrasom kostnaderna följer invånarna.Tabell 3.5 Landstingens resultaträkningar 2010 före respektive efter en indelningsändring(kr/inv.)FöreEfterStockholm Sörmland Stockholm SörmlandNettokostnad – 25 940 – 22 007 – 25 902 – 22 007Skatteintäkter 24 376 17 053 24 368 16 939Generella statsbidrag och utjämning – 187 2 254 – 180 2 346Övriga generella bidrag 2 625 3 016 2 627 3 016Finansnetto – 162 118 – 162 118Resultat före extraordinära poster 712 434 751 412Resultatförändring 39 – 23Utdebiteringseffekt (kr/skkr) – 0,02 0,01Källa: Landstingens resultaträkningar och egen beräkningSom framgår av tabell 3.5 blir den resultatmässiga effekten för de båda landsting-


2012-02-28 15 (29)en ytterst liten om Trosa kommun överförs till Stockholms län och landsting, vilketvisar att utjämningssystemet fungerar som det är tänkt. I sammanhanget bördock påpekas att kalkylen förutsätter att Sörmlands läns landsting förmår att anpassaverksamhetens kostnader efter antalet invånare. Anpassningsbetinget uppgårtill cirka 250 miljoner kronor.3.4.8 Effekter för Trosa kommunI tabell 3.6 redovisas beräknade effekter för Trosa kommun efter en eventuell indelningsändring.Som framgår av tabellen uppstår en effekt som innebär att kommunenfår ett potentiellt utrymme för att sänka skatten med 0,xx procentenhetereftersom ansvaret för kollektivtrafiken, färdtjänsten och hemsjukvården ligger pålandstinget i Stockholms län.Tabell 3.6 Trosa kommuns resultaträkning 2010 före och efter en eventuellindelningsändring (kr/inv.)Före en ev. indelningsändring Kr/inv.Verksamhetens intäkter 9 052Verksamhetens kostnader – 50 011Avskrivningar – 1 945Verksamhetens nettokostnad – 42 904Skatteintäkter 40 394Bidrag/avgifter utjämningen 3 251Övriga generella bidrag 0Finansnetto 4Resultat före extraordinära poster 746Extraordinära poster 0ÅRETS RESULTAT 746Efter en ev. indelningsändringJustering kollektivtrafik 1 014Justering färdtjänst 217Justering hemsjukvård – 396Justering kostnadsutjämning 541Justerat resultat 2 108Resultat skillnad 1 159Utdebiteringseffekt – 0,60Källa: Kommunens resultaträkning och egen beräkning3.4.9 SkattebetalarperspektivetSom ovan redovisats blir de ekonomiska effekterna för landstingen tämligen småom Trosa kommun överförs till Stockholms län och landsting. För Trosa kommunuppstår ett potentiellt utrymme för att sänka skatten med 0,60 procentenheter.För skattebetalarna i Trosa kommun blir dock den eventuella indelningsändringenmera kännbar eftersom det handlar om en skattehöjning på minst 1,33 procentenheter.Om Trosa kommun avstår från att sänka skatten handlar det om en höjningpå 1,93 procentenheter, se tabell 3.7. Den totala kommun- och landstingsskatten


2012-02-28 16 (29)för invånarna i Trosa kommun skulle därmed hamna i intervallet 32,96–33,56.Den kommun i Stockholms län som idag har den högsta skattesatsen är Värmdö,32,23 procent. Den högsta skattesatsen i riket har Ragunda kommun med 34,17procent.Det som främst bidrar till en hög landstingsskatt i Stockholms län är inte kollektivtrafikkostnaderna(som många tror) utan höga kostnader för hälso- och sjukvården.Som Sveriges Kommuner och Landsting (SKL) tidigare redovisat i promemorian2008-05-13 Regionfrågan i Sörmland genererar den höga sjukvårdskonsumtioneni Stockholms län en merkostnad som svarar mot 1,50–1,70 procentenheterpå skatten jämfört Sörmland.Tabell 3,7 Skattemässiga effekter av en eventuell indelningsändring för invånarnai Trosa kommunProcentLandstingsskatt i Sörmland 10,17Landstingsskatt i Stockolm 12,10Skillnad 1,93Potentiell skattesänkning i Trosa kommun – 0,60Total effekt 1,33Källa: SCB och egen beräkning3.5 Slutsatser – ekonomiska konsekvenserMot bakgrund av vad som ovan redovisats kan utredningen inte dra någon annanslutsats än att en indelningsändring har mycket liten inverkan på landstingensekonomi och detta gäller såväl Stockholms som Sörmlands läns landsting. Deekonomiska effekterna av en indelningsändring handlar om motsvarande +- 1 örepå skatten.Utjämningssystem gör att de båda landstingen ska kunna erbjuda sina invånare”samma standard till samma pris” oavsett om det sker en indelningsändring ellerej.En indelningsändring som innebär att Trosa kommun överförs från Sörmlands länoch landsting till Stockholms län och landsting strider således inte mot indelningslagensintentioner om acceptabla förändringar vad beträffar landstingens ekonomi.Trosa kommuns ekonomi påverkas inte heller av en eventuell indelningsändringmen däremot påverkas den förvärvsarbetande befolkningen. För skattebetalarna iTrosa kommun blir den eventuella indelningsändringen kännbar eftersom dethandlar om en skattehöjning på minst 1,33 procentenheter.För de inkomsttagare som dagligen pendlar med buss till Stockholm blir dock dentotala ekonomiska effekten plus minus noll eftersom en sänkt reskostnad (ett SLkorti stället för nuvarande 1 600 kronor per månad med Trosabussen) går i stortsett jämnt upp med skattehöjningen, se vidare avsnitt 4.3.


2012-02-28 17 (29)4 Övriga konsekvenser för landstingensverksamhet4.1 AllmäntDe ekonomiska konsekvenserna av en indelningsändring blir som framgår av avsnitt3 förhållandevis små för landstingen. Det är dock inte bara landstingens ekonomisom kan påverkas av en indelningsändring. Även landstingens verksamhetkan påverkas.4.2 Hälso- och sjukvårdenUtredningens bedömning är att en indelningsändring som innebär att endast Trosakommun överförs till Stockholms län och landsting kommer att ha liten inverkanpå sjukvårdsstrukturen och därmed också på hälso- och sjukvården i stort. Detsammagäller folktandvårdens verksamhet. Men om även Gnesta kommun överförstill Stockholms län och landsting kan Landstinget Sörmland behöva görastrukturella förändringar eftersom underlaget för sjukhuset i Nyköping försvagas.4.3 KollektivtrafikenKollektivtrafiken i Trosa utgörs av tågtrafik med stopp i Vagnhärad samt regionaloch lokal busstrafik. Vagnhärads stationsområde utgör kommunens resecentrummed samordning mellan tåg och buss. Från Vagnhärad avgår tåg till Södertälje–Stockholm och till Nyköping–Norrköping. Sedan maj 2010 finns även en direktlinjebusslinje (Trosabussen) mellan Trosa/Vagnhärad och Liljeholmen i Stockholmmed 13 turer per dag i vardera riktningen.Trosa trafikeras även av sex regionala busslinjer med cirka 40 avgångar från Trosamot Vagnhärad vardagar. Av dessa går merparten väg 218 mot Vagnhärad ochnågra via Västerljung. Via Västerljung går även vissa bussar mot Nyköping.Från den 1 januari 2012 gäller en ny kollektivtrafiklag. Den föreskriver att varjelän ska ha en regional kollektivtrafikmyndighet som upprättar ett regionalt trafikförsörjningsprogram.I Stockholms län är landstinget regional kollektivtrafikmyndighet(RKTM).Från 1 januari 2012 finns det två typer av kollektivtrafik, trafik som samhälletupphandlar och finansierar samt kommersiell trafik. Trafiken som samhället upphandlarblir enligt trafikförsörjningsprogrammet belagt med allmän trafikplikt.Allmän trafikplikt ska omfatta de sträckor, områden och linjer där myndighetenanser att det antingen inte finns en grund för att driva kollektivtrafik på helt kommersiellagrunder eller att trafiken är så pass viktigt för samhället att den måstegaranteras. SL:s nuvarande trafik köras på dessa sträckor. RKTM ansvarar för attupphandla den trafik som omfattas av besluten för allmän trafikplikt.Den nya kollektivtrafiklagen innebär att även andra aktörer kan köra kollektivtrafikpå kommersiella villkor. Kommersiella aktörer ska anmäla trafik som man


2012-02-28 18 (29)avser att köra senast tre veckor före trafik ska startas eller upphöra. Transportstyrelsenär tillsynsmyndighet . Därutöver ska man skicka information kring trafikentill Samtrafiken.Hur den regionala kollektivtrafikmyndigheten i Stockholms län kommer att betraktade regionala busslinjerna i Trosa samt Trosabussen vid ett eventuellt länsochlandstingsbyte för Trosa kommun går inte att uttala sig om med säkerhet. Menmed tanke på den omfattande arbetspendlingen mot Södertälje–Stockholm talardet mesta för att RKTM bedömer att trafiken är så pass viktigt för samhället attden måste garanteras.Reskostnaderna för busspendlarna mot Stockholm skulle därmed halveras. Plus400 kronor netto per månad svarar mot cirka 1,50 procentenheter på skatten förnormalinkomsttagaren.4.4 Övriga verksamheterVad gäller övriga verksamheter är det framför allt sådana verksamheter kring vilkasamverkan sker mellan kommunen och landstinget, t.ex. sjukvård för äldre somkommer att påverkas vid en eventuell indelningsändring.4.5 Slutsatser beträffande den landstingskommunalaverksamhetenUtredningens slutsatser vad beträffar effekterna på den landstingskommunalaverksamheten vid en eventuell indelningsändring kan sammanfattas enligt följande. en indelningsändring som innebär att endast Trosa kommun överförs tillStockholms län och landsting bedöms ha liten inverkan på sjukvårdsstruktureni de båda landstingen och därmed också på hälso- och sjukvården istort. Detsamma gäller kollektivtrafiken i både Stockholms och Sörmlandslän.En indelningsändring som innebär att Trosa kommun överförs till Stockholms länoch landsting bör således inte strida mot indelningslagens intentioner om acceptablaförändringar vad beträffar landstingens verksamhet.5 Demokratisk legitimitet5.1 AllmäntDen representativa demokratin är ingen politisk universalmedicin utan bygger påbestämda förutsättningar. När förutsättningarna inte uppfylls kan den levande demokratinheller inte förverkligas.Begreppet demokrati är en sammansättning av de två grekiska orden demos, sombetyder folk, och kratia med innebörden styrelse och auktoritet.När det gäller den representativa demokratin är det tre grundkomponenter som är


2012-02-28 19 (29)särskilt intressanta i indelningssammanhang; demos, offentliga rum och demokratiskaprocedurer. Medborgarnas stöd för det politiska systemet och den demokratiskalegitimiteten har att göra med alla tre komponenterna.Demostanken är att det krävs en grundläggande samhörighet och solidaritet hosmedborgarna (det demografiska perspektivet), annars riskerar kollektivt beslutsfattandeatt sakna folkligt stöd.Men det räcker inte med att det råder en samhörighet människor emellan. Demokratiär i hög grad en debattordning som bygger på åsiktsutbyte och opinionsbildning.För att samhällsdebatten ska fungera måste det finnas massmedier som nårut till medborgarna i området; ett offentligt regionalt rum. Utifrån gällande förutsättningarifråga om samhörighet och samhällsdebatt kan sedan utformningen avde demokratiska procedurerna diskuteras 1 .5.2 DemosDen representativa demokratin växte fram som en demokratisering av ofta storskaligapolitiska system i form av europeiska nationalstater. Det finns en lång vetenskapligtradition kring frågan om vad som var hönan eller ägget; medborgarnasterritoriella samhörighet eller nationalstatens prägling av medborgarna. Myckettalar för att de nationella demos som finns i flertalet fall har skapats av olika statsbildningari en lång historisk process. Territoriella identifikationer är sociala konstruktioner.Det som är typiskt för nationalstaten är att den nästan undantagslöst består avöverlappande territorier med kommuner och regioner som mindre enheter. Denrepresentativa demokratin begränsas därför inte enbart till det nationella territorietutan avser även kommuner och regioner.Ett territorium är ett politikens ”vi” som etablerar en geografisk gräns för vilkasom är bundna av en viss maktstruktur och vilka som står utanför. Därmed avgörsockså vilka som skall omfattas av solidariteten i systemet.På det regionala planet har Sverige en komplex institutionell situation, en iakttagelsesom på intet sätt är ny. I t.ex. regionutredningen gjorde utredaren BengtOwe Birgersson följande iakttagelse:”Alltför många huvudmän och alltför många myndigheter, förvaltningar och politiskaförsamlingar skall samarbeta om alltför mycket inom alltför skiftande geografiskaområden där gränserna sammanfaller och emellanåt skär varandra”.Det är denna situation, som utredaren benämnde ”den regionala röran”, som starktbidragit till att skapa en komplex legitimitetsgrund. De statliga aktörerna på detregionala planet, som t.ex. länsstyrelsen, länsarbetsnämnden, universitet och högskolor,har en nationell legitimitet som baseras på nationella demos som inte alltidöverensstämmer med de regionala ambitionerna. Dessutom försvåras samordningenav att de statliga aktörerna har skiftande geografiska områden.1 Se bl.a. Gidlund Janerik, Regionalisering och demokratisk legitimitet, utgiven av Regionförbundeti Kalmar län


2012-02-28 20 (29)Landstingen leds av folkvalda församlingar och legitimeras av ett föreställt regionaltdemos. Till betydande delar är verksamheten statligt reglerad och därförfinns det också en nationell legitimitet. Kommunerna har en likartad situation medden skillnaden att verksamheten legitimeras av ett föreställt lokalt demos.I varje enskilt län och i varje enskild kommun är det en empirisk fråga huruvidadet kan anses att det finns ett demos eller inte. De uppifrån ritade länsgränsernaoch de tvångsmässiga kommunsammanslagningarna talar för att sådana demossaknas i många fall, i synnerhet om man kräver att samhörigheten skall följa degeografiska gränserna.Vid sidan av tidigare och aktuella administrativa indelningar vimlar det av gamlagränser (t.ex. landskapsgränser) som en gång i tiden var viktiga för folkliga identifikationeroch som fortfarande har betydelse när människor indelar sin omgivningi ”vi” och ”dom”. Många av gränserna är dock numera borta.5.3 Det offentliga rummetI ett demokratiskt land som Sverige kan det tyckas självklart att det råder friåsiktsbildning, väl förankrad i författningen. Det är fritt fram att hysa obekvämaåsikter, bilda opinion och skapa starka politiska partier etc. På det regionala planetär det emellertid inte tillräckligt för demokratin att det finns nationella fri- ochrättigheter. Det krävs även ett regionalt offentligt rum för att demokratin ska kunnafungera som debattordning. Med detta menas att det skall vara möjligt förmedborgarna att föra en diskussion om regionala förhållanden som i princip ärtillgänglig för alla. Samhällsdebatten är med andra ord avgörande för en levandedemokrati i området.Viktiga aktörer i det svenska offentliga rummet är de politiska partierna och intresseorganisationerna.För att den regionala debatten ska komma till stånd krävsatt politiken bedrivs med stor öppenhet. En annan förutsättning är att det finnsfora för information och debatt som verkligen förgrenas ut i regionen. Här intarmassmedia en nyckelroll.Det är i en empirisk fråga i vad mån man i en viss region har dagstidningar, lokalradiooch lokal-TV som täcker hela området. Frågan är också om den journalistiskanyhetsbevakningen och kritiska granskningen tillräckligt gäller just den regionalagranskningen.5.4 Demokratiska procedurerLandstingens högsta beslutande organ är landstingsfullmäktige. Alla politiskaförsamlingar präglas av politiska spänningsfält som finns i regionen. Om spänningarnahandlar om intressemotsättningar mellan olika politiska partier är de iregel lättare att hantera än om de handlar om konflikter och intressemotsättningarmellan olika delar av regionen.När det gäller partipolitiska konflikter finns en lång tradition att besluta enligtmajoritetsprincipen. Besluten anses vanligen legitima också av motståndarna.Spänningar inom och olika delar av ett län måste hanteras mera varsamt, i annat


2012-02-28 21 (29)fall riskerar konflikterna att underminera legitimiteten för den regionala politikensom sådan. När sprickorna går rakt igenom de politiska partierna säger vissa forskare2 att ”man kan tänka sig att kommunerna i vissa avseenden får vetorätt” – dvs.ett avgörande inflytande – i frågor som rör den regionala sammanhållningen.5.4 Slutsatser – den demokratiska aspektenUtredningens slutsats i demokratifrågan är att ett eventuellt länsbyte för Trosakommun inte strider mot indelningslagens intentioner.6 Näringsgeografiska konsekvenser6.1 De näringsgeografiska sambandenDen nuvarande länsindelningen härstammar från 1634. Länsindelningen gjordessåledes i en annan tid och för helt andra syften än vad som skulle ha gällt idag.Om man idag skulle göra om länsindelningen från grunden skulle ambitionen varaatt åstadkomma regioner som ger bästa möjliga förutsättningar för tillväxt, ökadsysselsättning och för ökad välfärd, dvs. med fokus på de näringsgeografiskasambanden.De näringsgeografiska sambanden inom en region kan illustreras på olika sätt. Detvanligaste sättet är med hjälp av arbetspendling. Genom en ökad arbetspendlingknyts tidigare separata arbetsmarknader ihop och regionerna blir större. Den nyastörre arbetsmarknaden – den förstorade regionen – omfattar då både fler boendeoch fler arbetstillfällen än tidigare.Regionförstoring är en effekt av arbetskraftens växande geografiska rörlighet. På1950-talet uppgick det sammanlagda dagliga resandet till cirka 10 km per invånareoch dag. Idag uppskattas motsvarande siffra till mer än 50 km per invånare ochdag.Lokala arbetsmarknader (LA) är funktionella regioner som avgränsas utifrån statistiköver arbetspendling. Det är inom respektive LA som behovet av arbetskraft ihuvudsak ska tillgodoses. En LA kan bestå av en eller flera kommuner. Indelningeni LA förändras över tiden efter hur pendlingsströmmarna ändrar omfattning ochinriktningTar man fasta på hur pendlingsmönstren utvecklats de senaste trettio åren får manen tydlig bild över regionförstoringens långsiktiga utveckling. I början av sjuttiotaletfanns det nära 190 lokala arbetsmarknader i landet. Åtta av tio lokala arbetsmarknaderhade då mindre än 50 000 invånare. 150 av landets nuvarande 290kommuner utgjorde en egen lokal arbetsmarknad.2 bl.a. Gidlund


2012-02-28 22 (29)I början av åttiotalet hade antalet lokala arbetsmarknader minskat till 140. Detfanns då fortfarande drygt 100 marknader med färre än 50 000 invånare.Mellan början av åttiotalet och fram till första delen av nittiotalet minskade antaletlokala arbetsmarknader med ytterligare 30 stycken. Enligt SCB:s officiella avgränsningsom avser 2003 hade antalet lokala arbetsmarknader minskat till 87. År2005 uppgick antalet lokala arbetsmarknader till 82.Nutek delar in Sverige i 72 funktionella analysregioner (FA-regioner). Den nuvarandeindelningen – från 2005 – baseras främst på pendlingsstatistik från 2003.Hänsyn har även tagits till faktorer som trender i arbetspendlingen och annat somkan förändra resmönstren på ett genomgripande sätt. Indelningen bygger även påutvecklingstendenser i arbetspendlingen och tanken är att indelningen, som främstär tänkt att användas vid regionala analyser, ska kunna ligga fast under minst tioår.FA-regionerna kallades tidigare för Lokala arbetsmarknadsregioner (LAregioner).Namnbytet gjordes för att minska risken för sammanblandning medSCB:s Lokala arbetsmarknader (LA).Enligt SCB omfattar Mälardalen fem lokala arbetsmarknader som totalt inkluderar52 kommuner 3 ; Stockholm (36) 4 , Nyköping (2), Katrineholm (2), Eskilstuna (2),Västerås (4), Skinnskatteberg (3) och Köping (3).Under 1970-talet bestod Stockholms lokala arbetsmarknad av 27 kommuner, varavGnesta kommun var en men inte Trosa. Under 1980-talet tillkom ytterligare tvåkommuner; Trosa och Norrtälje. Sedan slutet av 1990-talet ingår även sex kommunersom tidigare utgjorde Uppsala lokala arbetsmarknad i Stockholms lokalaarbetsmarknad.Av Trosa kommuns 5 686 förvärvsarbetande är det 2 932 (52 procent) som dagligenpendlar ut från kommunen. Av dessa pendlar 82 procent till Stockholms länmen bara 13 procent till Sörmlands län i övrigt.6.2 Slutsatser – näringsgeografinUtredningens slutsats i fråga om de näringsgeografiska sambanden är att en indelningsändringsom innebär att Trosa överförs till Stockholms län och landstingknappast strider mot indelningslagens intentioner ifråga om att skapa administrativaenheter som underlättar för professionell service och samhällsplanering. Trosakommun ingår redan idag i Stockholms lokala arbetsmarknad.3 Antal ingående kommuner redovisas inom parentes4 35 före delningen av Uppsala kommun


2012-02-28 23 (29)7 Statlig verksamhetEn indelningsändring som innebär att Trosa kommun överförs till Stockholms länoch landsting kommer att påverka den statliga organisationen på regional nivåliksom verksamheten i olika regionala förbund och intresseorganisationer.Hur och på vilket sätt är emellertid svårt att uttala sig om. Som framhålls itilläggsdirektiven till den statliga Ansvarskommittén (Fi2003:02) är samhällsorganisationenpå regional nivå komplex med många statliga och regionala aktörer.Det finns också en stor geografisk variation när det gäller olika aktörers regionalaindelning och detta gäller särskilt statliga myndigheter.Samtidigt har den regionala nivåns betydelse för att åstadkomma hållbar utvecklingoch tillväxt alltmer kommit att uppmärksammas. Det är lokalt och regionaltsom förutsättningarna är bäst att ta tillvara och främja den regionala utvecklingen.Det är bland annat mot den bakgrunden som den parlamentariska Ansvarskommitténfick i uppdrag att analysera och lämna förslag på hur ansvaret för uppgiftermed anknytning till regional utveckling borde fördelas mellan staten och denkommunala nivån. Om kommittén fann det motiverat skulle den dessutom lämnaövergripande förslag på förändringar av nuvarande kommun-, landstings-, ochlänsindelning. I sitt slutbetänkande föreslog Ansvarskommittén av Sverige bordedelas in i 6–9 regionkommuner utan att närmare precisera den geografiska utformningenav dessa.Utredningen har inte funnit några starka skäl som talar för att en effektiv statligförvaltning skulle försvåras om Trosa kommun överförs från Sörmland till Stockholmslän. Länsstyrelsen i Stockholm torde vara lika skickad att främja utvecklingeni Trosa och att verka för att invånare, företag och organisationer får det stödoch den service som behövs.8 Preliminär ekonomisk regleringEnligt indelningslagen ska en preliminär ekonomisk reglering upprättas inför regeringensbeslut om en eventuell indelningsändring.Bestämmelser om den ekonomiska regleringen vid en indelningsändring finns iindelningslagen (1 kap. 6 §, SFS 1979:411). Uppläggningen av den ekonomiskaregleringen vid en indelningsändring är beroende av vilken typ av indelningsändringdet är fråga om:1. sammanläggning av kommuner/landsting2. delning av kommuner/landsting3. överföring av ett område från en primär- eller landstingskommun till enannan primär- eller landstingskommun.


2012-02-28 24 (29)Den ekonomiska reglering som blir aktuell om Trosa kommun ska överföras tillStockholms län och landsting handlar således om alternativ 3.Vid områdesöverföring från ett landsting till ett annat blir indelningsändringensomfattning avgörande både för frågan om en ekonomisk reglering behövs överhuvud taget och för frågan om regleringen skall avse andelar i det odelade landstingetshela förmögenhet eller endast till överföringsområdet lokaliserade tillgångaroch skulder samt i vilken utsträckning ersättning skall lämnas för överfördegendom.Utredningen bedömer att en ekonomisk reglering bör göras vid en eventuell indelningsändringmen att regleringen endast bör avse till överföringsområdet lokaliseradetillgångar och skulder.Det övergripande syftet med den ekonomiska regleringen är att fördela den kommunalaförmögenheten, eller delar därav, på ett ändamålsenligt och rättvist sätt.Lagstiftningen utgår från att parterna i princip har avtalsfrihet när det gäller regleringenssakliga innehåll. Regeringen ska dock fastställa regleringen när indelningsändringenbeslutas. Tidigast möjliga datum för den aktuella indelningsändringensikraftträdande är den 1 januari 2015.Utredningens förslag till preliminär ekonomisk reglering om Trosa kommun finneratt man vill gå vidare i indelningsfrågan redovisas nedan.Stockholms läns landsting övertar1. tillgångar och skulder samt byggnader och anläggningar hänförliga till landstingsverksamheteni Trosa kommun2. fordon, maskiner och inventarier hänförliga till sjukvården samt tandvården iTrosa kommun3. ansvaret för de borgens- och ansvarsförbindelser som tecknats före indelningsändringenoch som är hänförliga till landstingsverksamheten i Trosakommun4. förpliktelserna gentemot anställda som vid indelningsändringen har sin arbetsplatshelt knuten till landstingsverksamheten i Trosa kommun samt förpliktelsernamot avgångna landstingsanställda som tidigare haft sin arbetsplats ikommunen.9 Sammanfattande slutsatser och utlåtande9.1 SlutsatserLandstingens ekonomiIndelningslagens intentioner innebär att en indelningsändring inte får resultera i enotillfredsställande ekonomi i de berörda landstingen.


2012-02-28 25 (29)Utredningens slutsats än att en eventuell indelningsändring har mycket liten inverkanpå landstingens ekonomi och detta gäller såväl Stockholms som Sörmlandsläns landsting. De ekonomiska effekterna av en indelningsändring handlar ommotsvarande +- 1 öre på skatten.En indelningsändring som innebär att Trosa kommun överförs till Stockholms länoch landsting strider således inte mot indelningslagens intentioner om acceptablaförändringar vad beträffar landstingens ekonomi.Kommunens ekonomiKommunens ekonomiska förutsättningar påverkas inte av en ändrad läns- ochlandstingsindelning. Men kommunen får ett potentiellt utrymme för att sänka skattenmed 0,60 procentenheter eftersom ansvaret för kollektivtrafiken, färdtjänstenoch hemsjukvården ligger på landstinget i Stockholms län.SkattebetalarperspektivetFör skattebetalarna i Trosa kommun blir den eventuella indelningsändringenkännbar eftersom det handlar om en skattehöjning på minst 1,33 procentenheter.För de som dagligen pendlar till Stockholm med buss blir dock den sammantagnaekonomiska effekten i stort set plus minus noll eftersom reskostnaderna beräknassjunka med motsvarande belopp som skattehöjningen ger upphov till.Landstingens verksamhet i stortFör att en indelningsändring skall komma i fråga kräver indelningslagen att denska leda till acceptabla förändringar vad beträffar landstingens verksamhet i stort.Utredningens slutsats beträffande effekterna på den landstingskommunala verksamhetenär att en indelningsändring som innebär att Trosa kommun överförs tillStockholms län och landsting inte strider mot indelningslagens intentioner.Demografi och demokratiIndelningslagens intentioner är att en indelningsändring ska leda till bättre villkorför kommunaldemokratin och en större samhörighet människor emellan (det demografiskaperspektivet).Utredningens analyser och bedömningar ifråga om hur demokratin kan komma attpåverkas av en indelningsändring sammanfattas enligt följande.Om man ser till var Trosa kommuns förvärvsarbetande har sin arbetsplats är detmycket som talar för att en majoritet av befolkningen har en regional identitet somär inriktad mot Stockholms län.Näringsgeografiska sambandNäringsgeografi handlar om bebyggelsestruktur, pendling, flyttströmmar m.m.Indelningslagens intentioner i fråga om de näringsgeografiska sambanden handlar


2012-02-28 26 (29)om att åstadkomma administrativa enheter som underlättar för professionell serviceoch samhällsplanering.Utredningens slutsats i fråga om de näringsgeografiska sambanden är att en indelningsändringsom innebär att Trosa kommun överförs till Stockholms län ochlandsting knappast torde stå i strid med indelningslagens intentioner. Kommuneningår redan idag i Stockholms lokala arbetsmarknad.Statlig verksamhet m.m.Utredningens uppfattning är att länsstyrelsen i såväl Sörmlands som Stockholmslän är väl skickad att främja utvecklingen i Trosa kommun. Emellertid går det inteatt bortse från att Trosa kommun ur näringspolitisk synpunkt har mer gemensamtmed Stockholms län och mot den bakgrunden är det mer som talar för en indelningsändringän emot.Hinder mot en ändrad länsindelningUtredningen inte funnit något som skulle försvåra en effektiv samhällsplaneringom Trosa kommun överförs till Stockholms län och mot den bakgrunden drar utredningenslutsatsen att det heller inte föreligger hinder för att även ändra länsindelningen.PersonalfrågorDe som arbetar inom landstingsverksamheten i Trosa kommun förutsätts bli överfördatill Stockholms läns landsting (SLL) vid en indelningsändring. Vidare förutsättsatt SLL tar över samtliga förpliktelser mot såväl anställda som tidigare anställdainom landstingsverksamheten i Trosa.9.2 UtlåtandeI utredningens uppdrag ingår att pröva om förutsättningarna för att en indelningsändringska komma ifråga är uppfyllda. Att fatta beslut i indelningsfrågor är enuppgift för regeringen.Som framgår av vad som ovan redovisats anser utredningen att samtliga kriteriersom indelningslagen ställer upp som villkor för en indelningsändring är uppfyllda.Effekterna på landstingens ekonomi och verksamhet i stort blir acceptabla vid eneventuell indelningsändring och vad beträffar näringsgeografin så skulle en indelningsändringinnebära att Trosa kommun också administrativt hänförs till denarbetsmarknadsregion där kommunen redan befinner sig.Eftersom det offentliga rummet i kommunen domineras av media från Stockholmfinns det heller inget som talar för att kommunaldemokratin skulle påverkas negativtav en indelningsändring, snarare tvärtom.


2012-02-28 27 (29)Starka skäl talar således för ett länsbyte. Men det finns också skäl som talar emot,t.ex. skattebetalarperspektivet. Mot den bakgrunden måste frågan hanteras extraomsorgsfullt och varsamt. Utredningens principiella ståndpunkt är att Trosakommuns uppfattning bör tillmätas stor vikt när det gäller ärendets fortsatta prövning.Detsamma gäller invånarnas uppfattning.


2012-02-28 28 (29)Bilaga 1 Konsekvenser om både Gnesta och Trosa byter länLandstingens resultaträkningar om både Gnesta och Trosa hade överförtstill Stockholms län och landsting 2010 (kr/inv.)Före indelningsändring Stockholm SörmlandNettokostnader – 25 940 – 22 007Skatteintäkter 24 376 17 053Utjämning – 187 2 254Övriga generella bidrag 2 625 3 016Finansnetto – 162 118Resultat före extraordinära poster 712 436Efter indelningsändringNettokostnader – 25 868 – 22 007Skatteintäkter 24 344 16 939Utjämning – 160 2 345Övriga generella bidrag 2 629 3 016Finansnetto – 162 118Resultat före extraordinära poster 783 412FörändringNettokostnader 72 – 1Skatteintäkter – 32 – 114Utjämning 27 91Övriga generella bidrag 4 0Finansnetto 0 0Resultatförändring 71 – 24Utdebiteringsförändring (%) 0,03 – 0,01


2012-02-28 29 (29)Bilaga 2 Konsekvenser om såväl Gnesta och Trosa som Håbo byterlänLandstingens resultaträkningar om både Gnesta och Trosa samt Håbokommun hade överförts till Stockholms län och landsting 2010 (kr/inv.)Före indelningsändring Stockholm Sörmland UppsalaNettokostnader – 25 940 – 22 005 – 21 481Skatteintäkter 24 376 17 063 17 923Utjämning – 187 2 254 1 408Övriga generella bidrag 2 625 3 016 2 763Finansnetto – 162 118 – 164Resultat före extraordinära poster 712 436 450Efter indelningsändringNettokostnader – 25 797 – 22 007 – 21 488Skatteintäkter 24 328 16 939 17 824Utjämning – 144 2 345 1 429Övriga generella bidrag 2 630 3 016 2 763Finansnetto – 162 118 – 164Resultat före extraordinära poster 855 412 364FörändringNettokostnader 143 – 1 – 8Skatteintäkter – 48 – 114 – 99Utjämning 43 91 21Övriga generella bidrag 5 0 0Finansnetto 0 0 0Resultatförändring 143 – 24 – 86Utdebiteringsförändring (%) 0,07 – 0,01 – 0,05


20121031UtvecklingskonsultSuneErikssonkonsult.sune.eriksson@gmail.comGransångarvägen616771Bromma0725516777


Sida2av19Innehåll1. Uppdrag...........................................................................................................................................32. Denstatligaverksamheten–länsstyrelseniStockholmslän..........................................................3A.Viktigafaktorervidlänsbyte........................................................................................................4I.Demokrati................................................................................................................................4II.Ekonomi...................................................................................................................................4III.Infrastrukturochkommunikationer....................................................................................4IV.Sjukochhälsovård..............................................................................................................4V.Miljö.........................................................................................................................................4B.Länsstyrelsenshanteringavfråganomeneventuellremissomlänsbyte..................................53. Regionalplaneringochregionalutveckling....................................................................................54. Infrastrukturochkommunikationer................................................................................................7A.Regionaltågtrafik........................................................................................................................7I.BefintligtågtrafikStockholm–Vagnhärad..............................................................................7II.RegionaltsamarbetekringtågtrafikochinfrastruktursatsningariöstraMellansverige........8III.Avsiktsförklaringfördenregionalatågtrafiken...................................................................8IV.Fordonsförsörjning............................................................................................................10V.Resandeutveckling,intäkterochkostnader..........................................................................10VI.KonsekvenserförTrosakommunochförtrafikenStockholm–Vagnhärad....................10B.SLtrafiken..................................................................................................................................11I.Stockholmslänstrafikstruktur..............................................................................................11II.HanteringavbefintligtordinariebussutbudiTrosakommun..............................................11III.Trosabussen.......................................................................................................................11IV.Spårbundentrafik..............................................................................................................12V.Tidsplan,övergångsbestämmelser........................................................................................125. Hälsoochsjukvård.......................................................................................................................12A.Framtidsplanenförlänetshälsoochsjukvård.........................................................................12I.Investeringaridenframtidahälsoochsjukvården..............................................................13B.VårdutbudiTrosakommun.......................................................................................................13C.Konsekvenservidlänsbyte........................................................................................................14D.Reglerföretableringavprivataläkarmottagningar..................................................................14


Sida3av196. SamverkansavtalmellankommunerinomramenförKSLochmellankommunerochStockholmslänslandstingiStockholmslän..............................................................................................................147. SamverkaninomSödertörnssamarbetskommitté.......................................................................158. Utredarenssammanfattandebedömning.....................................................................................161. UppdragKommunstyrelseniTrosakommunhargivitförvaltningeniuppdragatttaframunderlagidenprocesssompågårkringetteventuelltlänsbyteförTrosakommun.Undertecknadharsomkonsultfåttuppgiftenattbidratillatttaframettbeslutsunderlagifrågan.Avsärskildviktharvaritattklargöraochförtecknaavtal,överenskommelserochsamverkansområdeninomStockholmslänelleraktuelldelavStockholmslän,mellankommuner,Stockholmslänslandstingochandraregionalaellerstatligaorgan.2. Denstatligaverksamheten–länsstyrelseniStockholmslänStockholmslänbestårav26kommuner,frånNynäshamnisödertillNorrtäljeinorr.TrosakommungränsartillSödertäljekommuninorrochNynäshamnskommuniöster.Länsstyrelsenärenstatligmyndighetsomharenlokalrepresentationivarjelänochutgörenlänkmellanmänniskorochkommuneråenasidanochregering,riksdagochcentralamyndigheterådenandra.Landshövdingenärchefförlänsstyrelsenochhariuppdragattföljautvecklingenochinformeraregeringenomlänetsbehov.Länsstyrelsenledsavenlandshövdingsomärregeringenslokalaföreträdare.FörnärvarandeärChrisHeisterlandshövdingiStockholmslän.DetärframförallttreverksamhetersomRutgerÖijerholm,t.f.länsrådpålänsstyrelseniStockholmbetonarianledningavutredningenomlänstillhörighetförTrosakommun(Öijerholm,2012).Förutomdenstrategiskanivånvillhanframhållatillväxtfrågorochsamhällsbyggnadsfrågor.EnorganisationsförändringgenomförsjustnuinomlänsstyrelsenochÖijerholmbedömerattavdelningenhargodaerfarenheteravtillväxtochsamhällsbyggnadsfrågorinomområdenmedsåvälbefolkningstillväxtsomglesbygd.Naturligtvisävendetävengodkompetensatthanteradesärskildafrågorsomkanuppkommaiskärgårdskommuner.Ifrågoromregionalutvecklingsplaneringskerettnärasamarbetemedlandstinget.KjellHaglundärchefföranalysenheteninomlänsstyrelsenochdensomdirektkommerattberörasavenremissfrånKammarkollegietvideneventuellansökanfrånTrosakommunomlänsbyte(Haglund,2012).Haglundharvaritinbegripenitidigarekorrigeringarinomlänet,exempelvisengränsjusteringmellanVaxholmsochLidingökommunermedföregående


Sida4av19folkomröstning.Nedanståendepunkterunder”A”och”B”framkomvidintervjumedHaglund,oktober2012.A. ViktigafaktorervidlänsbyteI. DemokratiKjellHaglundserdetsomviktigtatttaredapåbefolkningensviljaisambandmedattfråganomlänsbyteskaavgöras.Sannoliktbehövermangöraenfolkomröstning,såsomgjordesvidavgörandetomStorholmenskulletillhöraVaxholmskommunellerflyttasövertillLidingökommun.Manbördåsärskilttänkapåattplaneraomröstningensåattmankanfåettbradeltagande.Enopinionsmätningkanvaraettbrasättattförberedafrågan.II.EkonomiFörbefolkningenkommerskatteeffekternaattfåenviktigbetydelse.Härbörstuderasintebaraskattesatsernautanocksåvadmanfårförpengarna.TrosakommunharlåtitSKLutredadennafråga,(Sundström&deBeer,20120228),ochhardärvidfåttengodbelysningavdeekonomiskaeffekterna,seSundströmsutredning.III.InfrastrukturochkommunikationerTrosakommunhartågförbindelsetillVagnhäradmenocksådirektbusstillLiljeholmen.ISörmlanddelarkommunernaochlandstingetpåkostnadsansvaretförkollektivtrafikentillskillnadfrånStockholmdärlandstingetäransvarig.IställetharStockholmenhögrelandstingsskatt.2010stodTrosakommunförden9:estörstainpendlingentillStockholmsländå2424personerpendladeintilllänet.Avdessapendlade1363tillSödertäljeoch611personertillStockholm.Bredbandsinfrastrukturen(fiber)harenframskjutenplatsidiskussioneniStockholmsläneftersomlägetskiljersigmycketmellandeolikakommunerna.Länsstyrelsenförmedlarresurservialandsbygdsprogrammetförattstödjasatsningarpåfiberbredband.Nuvarandeprogramperiodförstrukturfondernapågårframtill2014ochinganyabeslutkommeratttasefter2013.Dennyastrukturfondsperiodenär2014–2020.IV.SjukochhälsovårdFråganomvarbefolkningenskallfåsinvårdtillgodoseddärenviktigfrågaattstämmaavisambandmedlandstingetspågåendeöversynavdenframtidasjukochhälsovården.ÄveneffekternaförvårdeniSörmlandärviktigaattstudera,(Haglund,2012).DennafrågaharocksåutrettsavSKL,(Sundström&deBeer,20120228).DerasbedömningärattenindelningsändringsominnebärattendastTrosakommunöverförstillStockholmslänochlandstingkommeratthaliteninverkanpåsjukvårdsstrukturenochdärmedocksåpåhälsoochsjukvårdenistort.V. MiljöVattenochavloppsfrågornaärhögtprioriteradeochStockholmsregionenvillhaframenV/Astrategisombyggerpåattisåstorutsträckningsom


Sida5av19möjligtbyggasammankoppladenätellerstörrelösningarförattkunnaklaradestoraåtagandensomfinnsidennakomplexafråga.B. LänsstyrelsenshanteringavfråganomeneventuellremissomlänsbyteOmlänsstyrelsenfårTrosaslänstillhörighetsutredningpåremissfrånkammarkollegietkommermansannoliktattremitteradentilllandstingetföryttrandeomdettaintegjortsavkammarkollegiet,menävenhöraKSL:ssynpåsaken.VidarebörävenRegionförbundetsiSörmlandsynpunkterhämtasin(Haglund,2012).3. RegionalplaneringochregionalutvecklingIStockholmslänharlänsstyrelsenansvaretfördenregionalautvecklingen,mengenomsärskildlagstiftningharansvaretförregionplaneringentillfallitStockholmslänslandsting(Nylund,2012).DengällanderegionplanenRUFS2010omfattardenregionalautvecklingeniStockholmslän,meninnehållerävenenmålbildförutvecklingenavhelaöstraMellansverige.Figur1beskriversambandeniöstraMellansverige.LänsstyrelsenharantagitRUFSattfungerasomlänetslokalautvecklingsprogram(RUP).Denskaliggatillgrundfördenlokalautvecklingsplaneringenilänet.Ilänsstyrelsensansvarfördenregionalautvecklingeningårocksåattfördeladestatligautvecklingsanslagen.ISörmlandärdetregionförbundetsomharmotsvarandeuppdrag.SvenIngeNylundpåtalardetviktigaiattbevakautvecklingsfrågornaförutomdesjälvklarafrågornaomkommunikationerochsjukvårdihändelseavettlänsbyte.EnregionalutvecklingsplanbrukargällaitvåmandatperioderochmedenenkelframskrivningbörennyRUFStasfram2018.Arbetetmeddennuvarandeplanenstartade2006varförarbetetmedennyplanbörstartaomnågotår.Någotsådantbeslutfinnsännuinte,mendetbörfinnasgottomtidförTrosaattingåiarbetetmeddenframtidautvecklingsplanenihändelseavettföreståendelänsbyte.Troligenfårhälsoochsjukvårdenenalltviktigarerollidenframtidaregionalaplaneringen.TrosakommunharsedantidigaredeltagitisamarbetetmedStockholmslänidets.k.ABDsamarbetetmedbl.a.Södertälje,GnestaochSträngnäskommuner.


Sida6av19FIGUR1.MÅLBILDFÖRÖSTRAMELLANSVERIGE.RUFS2010,SID127.(STOCKHOLMSLÄNSLANDSTING,2010)


4. InfrastrukturochkommunikationerSida7av19A. RegionaltågtrafikI. BefintligtågtrafikStockholm–VagnhäradHösten2012bedriverSJtågtrafikmellanStockholm–Vagnhäradenligttabell1,medanslutandeförbindelsertillTrosa(Resplus).TABELL1.TÅGTRAFIKSTOCKHOLM–VAGNHÄRADMÅFR,MEDANSLUTNINGARTROSA,HÖSTEN2012Trosa Vagnhärad Stockholm Vagnhärad Trosa 7.00 7.46 8.075.53 6.30 7.09 6.47 7.08 7.50 7.59 8.37 8.567.12 7.48 8.31 7.57 8.22 9.05 9.40 10.20 10.399.13 9.33 10.16 11.00 11.40 12.559.49 10.37 11.20 11.40 12.20 12.5511.21 11.41 12.24 12.40 13.19 13.38 13.40 14.20 14.4913.18 13.41 14.24 14.40 15.20 15.43 15.40 16.20 16.4915.21 15.41 16.24 16.44 17.23 17.4216.24 16.44 17.31 17.44 18.25 18.4417.20 17.42 18.24 18.40 19.20 19.4418.21 18.48 19.31 19.59 20.39 21.1519.14 19.44 20.24 20.44 21.24 21.5420.15 20.40 21.20 21.51 22.30 22.54Utbudetavresorär29enkelturerperdag,måndagtillfredageller14respektive15avgångarperriktning.FörbindelsernaVagnhärad–Stockholmutgörsavtimmestrafikunderperioden6.30–11.40(medvissavariationer)ochperioden15.40–20.40.Imotsattriktninggårtimmestrafikunderperioden7.00–8.00och11.00–21.00(medvissavariationer).Tidtabellenharfastlinjesträckningmensaknarstyvtidtabell.AnslutningarnatillochfrånTrosautförsavLänstrafikensbussar.


Sida8av19II.RegionaltsamarbetekringtågtrafikochinfrastruktursatsningariöstraMellansverige.EttsamarbetekringdenregionalatågtrafikeniStockholm–Mälarregionenharpågåttsedanbörjanav90taletisambandmedplaneringenavtrafikenpåSvealandsbanan(Trafiknämnden,Stockholmlänslandsting).DetgemensammatrafikbolagetMÄLABbildades1995avtrafikhuvudmänneniStockholm,Sörmland,Uppsala,VästmanlandochÖrebro.MÄLABochtrafikhuvudmännenslötavtalmedSJ(TIMlochll)somfr.o.m.1997åtogsigattetableraochutföratrafikiregionen,tillstörstadelenutanfinansielltstöd.SJ:sövergripandetrafikåtagandeenligtavtaletTIMlllöpteutvidutgångenav2010ochdärefterharMÄLABmotersättningslutitseparatatrafikavtalpåvissasträckor.Åren20072008gjordespåinitiativavMÄLABochEnBättreSitsenutredningomkollektivtrafikeniStockholmMälarregionen,Framtidenskollektivtrafik(FramKo).Utredningenlämnadeförslagpåprinciperförutvecklingavtrafikutbud,prissystemochorganisationsfrågor.Iljusetavkommandeavregleringsågsdetsomnödvändigtattregionenfickettstörreinflytandeöverdenregionalatågtrafiken.MÄLABföreslogsfårollensomregionalsamarbetsorganisationmedansvarattgentemotresenärernatillhandahållaettsammanhållettrafikutbudbeståendeavtrafikfrånolikaföretagochavtalsformer.År2007tecknadesenöverenskommelsemellanstatenochföreträdareförläneniMälarregionenochÖstergötlandommedfinansieringmedtvåmiljarderkrförbyggetavCitybanan.Iavtaletåtogsigstatenattfärdigställaandrainfrastrukturobjektförattmöjliggörautökadstorregionaltågtrafikochgelänenrättattgemensamtskapaenstorregionaltrafikhuvudman.År2010beslutadeRiksdagenomennykollektivtrafiklag,vilkenblandannatgerderegionalakollektivtrafikmyndigheternamöjlighetattmedallmäntrafikpliktgemensamtorganiseralänsöverskridanderegionalkollektivtrafik.Sedanår2010harMÄLABtillsammansmedtrafikhuvudmännen/landstingen/regionalakollektivtrafikmyndigheterna(RKTM)utretthurregionaltågstrafikenskautformasefter2017närCitybananskapacitetsutökningkantasianspråkochdetnuvarandeTiMavtalet(TiMIII)löperut.TillstödförutformningenavtrafikförsörjningsprogramtogMÄLABunder2011framunderlagspmmedförslagtillgemensammabeskrivningarombehovavregionaltågtrafikochförslagpåettstorregionaltstomnät,Trafikplan2017.Motbakgrundavlångaledtiderharutgångspunktenvaritattmöjliggöragemensammagenomförandebeslutunder2013.III.AvsiktsförklaringfördenregionalatågtrafikenTrafiknämndeniStockholmslänslandstingharden16oktober2012beslutatställasigbakomenavsiktsförklaringfördenregionalatågtrafiken(Trafiknämnden).Avsiktsförklaringenbärsuppavnågravägledandeprinciper:StabilitetövertidenHöggradavintegrationmedövrigregionalkollektivtrafikAtttrafikenoavsettentreprenörelleravtalsformomfattasavettsammanhängandeprissystemmedgemensammaresevillkor.


Sida9av19Följandeambitioneruttryckskringtrafikutbudetiavsiktsförklaringen(MÄLAB): Vardagarbörtrafikenbedrivasmedminsttimmestrafikhelatrafikdygnet(ca0623)ibådariktningarna(stomtrafik). Irusningstidmorgonochkväll(ca0609,1518)börtrafikenförstärkastillhalvtimmestrafikibådariktningarna(insatståg) Påhelgerbörminstvarannantimmestrafikeftersträvas.Ivissarelationerochundervissatiderkommeravsevärtmeratrafikattbehövasiformavinsatståg.Detinnebärminst18avgångarivarjeriktning.Figur2visarlinjeristorregionaltstomnätenligtTrafikplan2017–versionmaj2012.FIGUR 2LINJER I STORREGIONALT STOMNÄT ENLIGT TRAFIKPLAN 2017 – VERSION MAJ2012.Trafikplanenärutformadutifrånvedertagnaprinciperförstomtrafik. Trafikenskabedrivasmedfastalinjesträckningarochenhetligtuppehållsmönster. Trafikenska,därinfrastrukturensåmedger,bedrivasmedstyvatidtabellermedavgångarpåfastaminuttalförsåvälstomtågsominsatståg. Trafikenskabedrivasmedenhetliga,modernaochförregionalkollektivtrafikändamålsenligafordon.a) DelsträckanLinköping–Nyköping–Stockholm–UppsalaAvgångarplanerasvarjetimmepådelsträckanNorrköpingNyköping–Stockholm–Uppsala.VarannantimmekörstågentillochfrånLinköping.Insatståg


trafikerardelsträckanNorrköping–Nyköping–StockholmihuvudriktningenmotStockholmpåmorgonenochfrånStockholmpåeftermiddagen.Lördag/söndag/helgdagplanerasavgångarvarannantimme. FortsattautredningarbehövergörasomdettotalatrafikutbudetpådelsträckanNorrköping–Linköping.Utbudetpådelsträckanbetraktastillsvidaresompreliminärt.Sida10av19IV.FordonsförsörjningAvsiktsförklaringenutgårfrånattregionenkommerattinförskaffaca80fordon(typfordon270sittplatser)tillenkostnadom100mnkrperfordon.Finansieringenskergenomborgensåtagandenfrånlandsting/kommuner.Defordonsomanskaffasskatillhandahållastilldetgemensammatrafiksystemetochadministrerasochutvecklasgemensamtavenpartiengemensamfordonspool.V. Resandeutveckling,intäkterochkostnaderMÄLAB:sberäkningarvisarattdenårligaresandeutvecklingenunderTIMperioden1997–2011uppgåtttill2,2%peråreller325000resenärer.MÄLABharräknatmeden30procentigökningavresandet2020jämförtmedidag.Denuppskattadebruttokostnadenförtrafiksystemetblirdå1700mnkri2012årsprisnivåmedanbiljettintäkternastannarvid1400mnkr.Underskottetförtrafikenuppgårsåledestill300mnkrårligen.VI.KonsekvenserförTrosakommunochförtrafikenStockholm–VagnhäradAvsiktsförklaringeninnebärenutbudsökningavstomtrafikenpåtågtill34enkelturermotdagens29enkelturer.TilldettakommerinsatstågundermorgnarmotStockholmocheftermiddagarutfrånStockholm.OmTrosakommunöverförstillStockholmslänkommerkostnadernaförkommunikationerattöverförastillStockholmslänslandsting.Detbetyderattkommunenskostnaderförunderskottstäckningochborgensåtagandenförframtidafordonsinköpintekommerattbelastakommunen.a) KommandeinfrastrukturellasatsningarRegeringenangeribudgetpropositionen(Regeringen)2012/13:1attdenkommerattföreslåattbyggnationenavennystambanainledsgenomdens.k.Ostlänken,sommöjliggörsnabbtågmellanStockholmochLinköping.EnligtTrafikverketkommersatsningenattfrigörakapacitetpånuvarandespår(Trafikverket).Trafikverketönskarensatsningpåsnabbtågmedanregeringenantyttattävengodstrafikskakunnatrafikeradennyabanan.IdagslägetärdetoklartvadkonsekvensernablirförtrafikentillochfrånVagnhärad.


B. SLtrafikenSida11av19I. StockholmslänstrafikstrukturVidgenomgångavstrukturenförkollektivtrafikförsörjningiStockholmslän(Ekberg,2012)framgårattstomtrafikenutgörsavpendeltågochtunnelbanasamtstombusslinjeridelägendärspårbundentrafiksaknas.Stomtrafikenkompletterasmeddirektbusslinjerdärkapaciteteninteräckertill.UtgångspunktenförvilkaadressersomskatrafikförsörjasutgårfråndetregionalatrafikförsörjningsprogrammetförStockholmslän(Trafiknämnden,Stockholmslänslandsting,2012,ss.1819)somupprättatsseptember2012.Ienbilagatillprogrammetangesriktlinjerförkollektivtrafikensutbudsstandarddärdetrekommenderadelängstagångavståndettillnärmastehållplatsangivits,setabell2.TABELL2.RekommenderadelängstagångavståndTyp av bebyggelseBostadshusFlerbostadshus med fler än 3 våningarFlerbostadshus med högst 3 våningarRadhusVillor i gruppbebyggelse i tätortFriliggande villor på landsbygdAvstånd, meter a)4005007009002 000Nyetablerade arbetsområdenHög arbetsplatstäthet (1 arbetsplats/25 m2) 500Låg arbetsplatstäthet (< 1 arbetsplats/25 m2): Toma 700toa) Avstånden gäller för trafik dagtid och kvällar. För nattrafik finns inga riktlinjer gällande gångavstånd.II.HanteringavbefintligtordinariebussutbudiTrosakommunStockholmslänönskaringaundantagsreglerförsärskildakommunerutantillämparettgemensamtregelverkförhelalänet.DetinnebärattordinariebussutbudsomidagbedrivsavLänstrafikeniSörmlandkommerattprövasmotdeovanangivnareglernaförkollektivtrafikensutbudsstandardiStockholmslän.EnöverenskommelsegörsmedLänstrafikenomvemsomskasvarafördentrafiksomskärdennyalänsgränsenpåsammasättsomidaggörsbeträffandeexempelvislinje702.TroligenkommerLänstrafikenattbliansvarigförattdrivadennatrafikeftersomdetstörstatrafikarbetetfördennatrafikkommerattskeinomSörmlandslän.III.TrosabussenTrosabussenärenprivatdrivendirektbusslinjemellanTrosaochLiljeholmensombeställtsavLänstrafikeniSörmlandochsomgerutförarenenförlustgaranti.Avtalstidenär2010–2013medoptionomförlängningtilljuni2015.StockholmslänslandstingsomregionalkollektivtrafikmyndighetkommeratttaställningtillomdennatrafikskagaranterasförallmäntrafikpliktihändelseavettlänsbyteförTrosakommun.SvaretpådettaärintegivetenligtPerEkberg,funktionsansvarigförsamhällskontakterpåSL,mensannoliktkandenkommaattbligaranteradutifrånovanståenderesonemangomkollektivtrafikensutbudsstandard.DentrafiksombedrivspåjärnvägmellanVagnhäradochStockholmkommersannoliktinteattbedömashållatillräckligkapacitetförtrafikarbetetmotregioncentrumsomär


Sida12av19Stockholmsstad.DetinnebärattTrosabusseniettsådantlägeskulleomfattasavSLkortet.Ställningstagandettillallmäntrafikpliktärettmyndighetsbeslut.IV.SpårbundentrafikVidOstlänkensfärdigställande,2028ellertidigareförsträckanVagnhärad–norrut,kommersannoliktdenspårbundnatrafikenattansestillräckligförtrafikarbetetmotregioncentrum.DetskullekunnainnebäraattTrosabusseniettsådantlägeinteskullegaranterasförallmäntrafikplikt.IställetuppstårensituationdärtågtrafikbedrivsavSJellerandrakommersiellatrafikföretagochSL(undernamnändringtilltrafikförvaltningeniStockholmslän)kommerdåatttaställningtillhurstomtrafikenmotStockholmskagaranteras.TrosakommunhamnardärmedisammasituationsomNykvarnskommundärresormedregionaltågetärattbetraktasomstomtrafik.DirektbusstrafikenfrånTrosakommerattkunnafortsättasomkommersielltdriventrafik.V. Tidsplan,övergångsbestämmelserEttlänsbyteskeråretefterdetattallmännavalhargenomförts.ITrosakommunskulleenmöjligtidpunktvaraden1januari2015.Förattupphandlatrafiktillden1januari2015ärtidenintetillräcklig.EnupphandlingmåsteaviserastillEUettårinnandeninledsochupphandlingsarbetetochgenomförandetinnebärattavtalintehinnerbliklaratillden1januari2015.IställetmåstebefintligaavtalsesöverochdetfårundersökasomdessakantasöveravtrafikförvaltningeniStockholmslänfrånLänstrafikeniSörmland.Fyraårkanvaraenrimligövergångsperiodföröverföringavavtalochomställningavtrafikarbetet.5. HälsoochsjukvårdA. FramtidsplanenförlänetshälsoochsjukvårdLandstingsfullmäktigeharantagitenplanfördenframtidahälsoochsjukvårdeniStockholmslän(Hälsoochsjukvårdsnämndensförvaltning,2011).Planensyftartillattförberedaenstruktursomskakunnaklaradenförväntadeframtidabefolkningsökningenilänet.Målbildenför2015ärattpatientensochinvånarnassamladebehovochfriavalmötsavettflexibeltvårdutbuddärhälsofrämjandeperspektivochpatientensönskemålochmedicinskabehovståricentrum.Enkunskapsbaserad,ändamålsenlig,säkerochtillgängligvårdgespålikavillkortillalla.Målenhardefinieratssom:högtillgänglighet:vårdirätttidgodkvalitetochdelaktighet:säkervårdtillrättpatientpårättnivåhögeffektivitet:säkervårdirätttid,tillrättpatient,pårättnivåtillrättkostnad.Planeninnehållerettantalstrategierförenförändradstrukturavlandstingethälsoochsjukvård.1. MedborgarnagesmöjlighetattkommuniceraochinterageramedhälsoochsjukvårdenviaeHälsa,bl.a.Vårdguiden(därStockholmtroligenkommerattservahelaSverigefrån2013)ochMinaVårdkontakter(MVK).


Sida13av192. Attvårdgivarnaskaarbetahälsofrämjandeochsjukdomsförebyggandetillgodosesgenomavtal,uppföljningochersättningssystem.Vårdenilänetförssystematisktutivårdvalinom24områden,bl.a.tandvård,fotvårdochlogopedi.3. Husläkarmottagningenärdenförstafysiskakontaktenmedvårdgivare.Primärvårdenskakunnastödjapatientensvägivården.Lägstaeffektivaomhändertagandenivå(LEON)gäller.4. Storadelaravbefolkningensbehovavhälsoochsjukvårdkommeratttillgodosesiennymellanform,s.k.specialistcentrum.Härfinnsmottagningarochdagvårdförbarnochvuxna,ivissafallocksåvårdplatsermedslutenvårdförvuxna.5. Akutsjukhusensrollsäkrasgenomattalternativavårdformerfördenspecialiseradevårdenbyggsut.Detgällerbl.a.avanceradsjukvårdihemmet,palliativvårdochgeriatriskvård.Akutsjukhusenbedömsfåökadevårdvolymerp.g.a.befolkningstillväxten.6. NyaKarolinskasjukhuset(NKS)bliretthögspecialiseratsjukhusmedstarkkopplingtillforskningochutbildning.Antaletvårdplatserblirfärreänidag.AstridLindgrensbarnsjukhusochThoraxklinikenberäknaskvarståförvårdändamål.InriktningenförövrigaakutsjukhusblirberoendeavprofileringenavNKS.I. InvesteringaridenframtidahälsoochsjukvårdenInvesteringsvolymenuppgårtill28mdkrfördennärmastetioårsperioden,förutominvesteringenförnyaKarolinskasjukhuset(Forsman,2012).Landstingsfullmäktigebeslutadeijuniominriktningenförgenomförandetavframtidsplanen.IsödraStockholmsatsasbl.a.påsjukhuseniHuddinge,Haninge(därettnyttsjukhusbyggs)samtiSödertäljesomliggerförstiprioriteringsordningochdär1,2mdkrkommerattinvesteras.InvesteringeniSödertäljeinnebärbl.a.attennybehandlingsbyggnaduppförsochattnuvarandebehandlingsbyggnadbyggsomförslutenvård.Eftergenomförandebeslutibörjanav2013förväntassjukhusetståklart2016ochvaraifulldrift2017.B. VårdutbudiTrosakommunITrosafinnsvårdcentralmedutbudförföräldrar,barnochungaiformavbarnmorskemottagning,barnavårdscentralochungdomsmottagning(LandstingetiSörmland).DistriktssköterskemottagningenvidvårdcentralenärocksåöppeniVagnhäradförbokadebesökpåmåndagar.Ensärskilddiabetesmottagninggerrådtillpatientermeddiabetes.Distriktsläkarmottagningenärbemannadmedspecialistläkareiallmänmedicin.Härfinnsocksålegitimeradpsykoterapeut,sjukgymnaster,kuratorerochettlaboratoriumförprovtagning.Trosakommunansvararförhemsjukvårdpåuppdragavbehandlandeläkare.PrimärvårdsjouriTrosanåsfrånvårdcentraliNyköping.PrivatpraktiserandeläkareochsjukgymnastfinnsiTrosa.AkutsjukvårdförsomatiskvårdfinnspålasarettetiNyköpingliksomförlossningsavdelningochBB.PsykiatriskakutmottagningfinnspåMälarsjukhusetiEskilstuna.SörmlandslänharettgemensamtavtalmedVästmanlandomdenhögspecialiseradevården.DetinnebärattenstordelavdennavårdköpsfrånarbetsochmiljömedicinskaklinikeniÖrebro,frånuniversitetssjukhusetiÖrebro,frånAkademiskasjukhusetiUppsalamenävenfrånKarolinska


Sida14av19sjukhusetiSolna/Huddinge(ävenAstridLindgrensbarnsjukhusiSolnaochSödersjukhusetiStockholm).FolktandvårdensomärettdotterbolagtilllandstingetiSörmlandharenmottagningiTrosa.IVagnhäradfinnstreprivatatandläkarkliniker.C. KonsekvenservidlänsbyteEnvissspecialiseringfinnsiSverigepåsåsättattStockholmköperrikssjukvård,exempelvisvårdförbarnmedsvårahjärtsjukdomariGöteborgochSkåneochbrännskadevårdiUppsalaochVästraGötaland.BortsettfråndettaklararStockholmspecialistsjukvårdeninomdetegnalänet.FörStockholmslänskulleettlänsbyteförTrosakommunintestötapånågraproblemenligtCatarinaAnderssonForsman.VårdenvidSödertäljesjukhuskommerattbedrivasmycketflexibeltochsjukhusetharstoraresurser.FörnärvarandefinnsettavtalmellanStockholmslänochUppsalalän,ABCavtalet,somgerpatienterfrittvalavvårdidetandralänet.Vårdinsatsersomberäknasöverstiga35000krskagodkännasiförväg.DettaharintevaritaktuelltattupprättamellanStockholmochSörmlandmenomettsådantfannsskulledepatientersomidagfårvårdvidexempelvisNyköpingslasarettkunnafortsättaattfåsinvårddärifrån.D. ReglerföretableringavprivataläkarmottagningarReglernaföretableringavprivataläkarpraktikerenligtvårdvalssystemetskiljersigintemellanStockholmslänslandstingochSörmlandslänslandstingeftersombådalandstingensverksamhetfallerunderlagenomvalfrihetssystem(LOV).SevidarelandstingensregelverkiSörmland(HälsovalSörmland)ochiStockholm(Hälsoochsjukvårdsnämndensförvaltning).LandstingetiSörmlandharenregelomsamrådangåendelokaliseringavvårdcentral(a.a.s.41).DettaskaintetolkassomettsättattstyraetableringsbeslutetutanärsnarareattsesomettsättattfåtipsangåendelokaliseringenfrånVårdvalSörmland(Henriksson,2012).6. SamverkansavtalmellankommunerinomramenförKSLochmellankommunerochStockholmslänslandstingiStockholmslänDetfinnsenradsamarbetsavtalochöverenskommelsersomreglerarsamverkaninomlänet.KommunförbundetiStockholmslänsamordnaravtalenideflestafallmendetfinnsocksåenstakaavtalmedenkommunsomadministrativtansvarigföravtalen.KommunenkommerihändelseavlänsbyteattblimedlemikommunförbundetStockholmslän(KSL).Avgiftenfårhögstuppgåtill0,5promilleavkommunenssamladeintäkteriformavskatterochstatsbidrag.Strävanfrånstyrelsenharvaritatthållaneremedlemsavgifternaochförnärvarandeuppgårdessatill0,41promille(Dahlberg,2012).Mellankommunernaochlandstingethartecknatsfleraavtalochöverenskommelser,ivissafallsomettresultatavkravfrånstatsmakternaellerefterincitamentfrånstatsmakterna.Avtalharocksåtecknatsmedutbildningsanordnare.Enförteckningavpågåendeavtalärredovisadibilaga1.


7. SamverkaninomSödertörnssamarbetskommittéSida15av19SamverkanmellankommunernapåSödertörn,(Huddinge,Botkyrka,Salem,Södertälje,Nykvarn,Tyresö,HaningeochNynäshamn),harpågåttsedan1960taletmengickinienformellfas2010närSödertörnssamarbetskommittébildades.EnbeskrivningavsamarbetetochenförteckningavkändaavtalinomSödertörnfinnsredovisadibilaga2.SamarbetetmellanSödertörnskommunernayttrarsigblandannatiettstortantalnätverk,merellermindreformella.Härföljerenförteckningöveraktuellanätverk.(SödertörnskommunernasSamarbetskommitté).ArkivarierAllaSödertörnskommuneringårinätverket,dockharSalemingenrepresentantdådesaknarenarkivarie.BibliotekscheferNykvarn,Nynäshamn,SalemochSödertäljeingårisamarbetetmedgemensambiblioteksserver.ChefernainomhandikappomsorgenAllaSödertörnskommuneringårinätverket.DessutomingårNackaochVärmdö.CheferinommätochkartverksamhetAllakommunerpåSödertörnsamtNackaochVärmdödeltar.EkonomichefernaAllaSödertörnskommuneringårinätverket.EUsamordnareAllaSödertörnskommuneringårinätverket.ExploateringschefernaiöstraochsödralänsdelarnaAllakommunerisödraochöstralänsdelarnaingår.FörhandlingscheferAllaSödertörnskommuneringårinätverketIFOchefsgruppenDeltargörTyresö,Nacka,Haninge,Nynäshamn,VärmdöochHuddinge.IndividochfamiljechefernaAllaSödertörnskommuneringårinätverket,dessutomingårNackaochVärmdö.InformationscheferNätverketbeståravInformationschefernaellermotsvarandeideåttaSödertörnskommunernasamtNacka.ITcheferAllaSödertörnskommuneringårinätverket.PåregionaltplanfinnsocksåITforumdärnästanallakommuneriStockholmsläningår.KvalitetscheferKvalitetscheferochverksamhetscontrollerallakommunerpåSödertörnutomNykvarndeltar.LokalfrågorFastighetschefer,lokalcontroller/strategerallakommunerpåSödertörnutomNykvarndeltar.


Sida16av19MASsamverkanMAS(medicinsktansvarigsjuksköterska)deltarinätverkpåSödertörnmedkollegorsomharsammaarbeteirespektivekommun.MiljöstrategerAllaSödertörnskommuneringårinätverket.NäringslivscheferAllaSödertörnskommuneringårinätverket.PersonalcheferAllaSödertörnskommuneringårinätverket.PlaneringscheferAllaSödertörnskommuneringårinätverket.SocialcheferAllaSödertörnskommuneringårinätverketdessutomingårNackaochVärmdö.SPIN.SödertörnsPedagogiskaITNätverkSkolTIansvarigasomträffascirkavarsjätteveckaTuristcheferAllaSödertörnskommuneringåriNätverket.UpphandlingscheferAllaSödertörnskommunersamtNackaochVärmdöingårinätverket.VAcheferNynäshamn,Haninge,SödertäljeEnergi(SödertäljeochNykvarn),Botkyrka,Haninge,Lidingö,Nacka,Norrtälje,RoslagsvattenAB,Salem,TyresöochVärmdö.ÖversiktsplanerareAllaSödertörnskommuneringårinätverket.8. UtredarenssammanfattandebedömningUtredningenvisar,tillsammansmedSKL:sutredning,(Sundström&deBeer,20120228),attTrosakommunharenstarkochnärakopplingtillStockholmslän.TrotsettrelativtbegränsatbefolkningstalstodTrosakommunfördenniondestörstainpendlingentillStockholmslän2010.DetbetyderattenstorandelavbefolkningenpendlarmellandebådalänenvarjedagochettlänsbytetillStockholmslänpåmångasättskulleunderlättakommuninnevånarnasdagligaliv.Trosakommunskulle,efterettlänsbyte,kunnapåverkaStockholmslänsutveckling,tillgagnförkommuninnevånarna.EttställningstagandeförettmedlemskapiStockholmslängerTrosakommunmöjlighetattdirektgåiniarbetetmednästaversionavdenregionalautvecklingsplanenRUFSnärdetarbetetväntasstartaunder2014.VissadirektavläsbaraeffekteraventillhörighettillStockholmslänärattTrosakommunintelängrebliransvarigförkostnaderförkollektivtrafiken.Detrörlänstrafikensbussar,underskottstäckningavtågtrafiken,borgensavgifterförfordonsinköpochsannoliktocksåsubventionsersättningförTrosabussensomtroligenkommerattomfattasavallmäntrafikpliktochdärmedingåiSLkortet.EnannanfördelförTrosabornabliromtågtrafikenfrånVagnhäradkommerattbetraktassomstomtrafikochdärmedomfattasavSLkortet,påsammasättsomdiskuterasiNykvarnskommun.YtterligareenaspektvidlänsbyteärattSLharetttydligtregelverkförrekommenderatlängstagångavståndtillkollektivtrafik,vilketkanvaratillfördelförTrosaborna.HälsoochsjukvårdeniStockholmslänslandstingklarardetextratillskottsomTrosasbefolkningskulleinnebära.VidettlikartatavtalmedSörmlandslandstingetsomUppsalalänslandstingharskulle


Sida17av19befolkningeniTrosakunnaväljaattantingennyttjavårdeniSörmlandslänelleriStockholmslän,vilketkanvaraenfördelfördensomredanharenupparbetadvårdkontakt.DetfinnsenmängdöverenskommelserochavtalsomstyrsamarbetetinomStockholmslänochSödertörn,påsammasättsomiSörmlandslän.HärfinnsenmöjlighetattdeltaidesamarbetensomtillföretttydligtvärdeförTrosabornaochdärnyttanöverstigendenberäknadekostnadeniformavinsattabudgetmedelochpersonaltid.RedannukanTrosakommunväljaattanslutasigtillsamverkansavtaletavseendegymnasieutbildningiStockholmslänliksomungdoms,elevochantagningsdatabasernaförgymnasieskolan.DetskulleinnebäraattTrosakommunseleverskullegesförstahandsmottagningtillallagymnasieutbildningariStockholmslän.EnsamladekonomiskanalysaveffekternaavettlänsbytegenomförsavkommunkontoretidenutredningsomliggertillgrundförTrosakommunsställningstagandeifrågan.DeaspektersomberörtsidennautredningvisarattettlänsbyteärtillfördelförinvånarnaiTrosakommun.Bromma20121031SuneEriksson


KällhänvisningarSida18av19Dahlberg,L.(den10september2012).Direktör.KommunförbundetStockholmslän(KSL).(S.Eriksson,Intervjuare)Ekberg,P.(den4oktober2012).Funktionsansvarigsamhällskontakter.SL.(S.Eriksson,Intervjuare)Forsman,C.A.(den8oktober2012).Hälsoochsjukvårdsdirektör.Stockholmslänslandsting.(S.Eriksson,Intervjuare)Haglund,K.(den18oktober2012).Chefanalysenheten.LänsstyrelsenStockholmslän.(S.Eriksson,Intervjuare)Henriksson,P.M.(den31oktober2012).Ekonom.VårdvalSörmland,SörmlandsLänsLandsting.(S.Eriksson,Intervjuare)Hälsoochsjukvårdsnämndensförvaltning.(u.d.).HämtatfrånRegelbokförhusläkarverksamhetmedbasalhemsjukvård:http://www.uppdragsguiden.sll.se/upload/Avtal/Auktorisering/Regelbocker%202011/Regelbok%202011%20hlm%20slutversion%20m%20lankar.pdfden31oktober2012Hälsoochsjukvårdsnämndensförvaltning.(2011).Framtidenshälsoochsjukvård.Slutrapportfrånprojektetframtidenshälsoochsjukvård.Stockholmslänslandsting.HälsovalSörmland.(u.d.).RegelbokinomhälsovalSörmland.HämtatfrånLandstingetSörmland:http://www.landstingetsormland.se/PageFiles/7745/REGELBOKEN%202012.pdfden31oktober2012LandstingetiSörmland.(u.d.).Hälsa&Vård,LandstingetSörmland.Hämtatfrånhttp://www.landstingetsormland.se/Halsavard/den24oktober2012MÄLAB.(u.d.).Utvecklingavdenregionalatågtrafiken.HämtatfrånWWW.MALAB.se:http://www.malab.se/wpcontent/uploads/2012/05/M%C3%84LABRapportUtvecklingavdenregionalat%C3%A5gtrafikenmaj2012.pdfden17Oktober2012Nylund,S.I.(den15oktober2012).Regionplanerare.Tillväxt,miljöochregionplanering(TMR).(S.Eriksson,Intervjuare)Regeringen.(u.d.).www.regeringen.se.HämtatfrånProp.2012/13:1:http://www.regeringen.se/content/1/c6/19/91/89/1fd3af32.pdfden17Oktober2012Resplus.(u.d.).Resplus.se.Hämtatfrånhttp://tidtabell.resplus.se/tidtabell/81_tag81h.pdfden17Oktober2012Stockholmslänslandsting,T.m.(den4maj2010).2010:5RUFS2010.Hämtatfrånwww.tmr.sll.se:http://www.tmr.sll.se/Global/Dokument/publ/2010/RUFS10_hela.pdfden18oktober2012Sundström,B.,&deBeer,D.(20120228).TrosakommuntillStockholmlänochlandsting?Förutsättningarochkonsekvenser.Stockholm:SverigesKommunerochLandsting.


Sida19av19SödertörnskommunernasSamarbetskommitté.(u.d.).NätverkpåSödertörn.Hämtatfrånhttp://www.sodertornskommunerna.se/natverkden28oktober2012Trafiknämnden.(u.d.).Yttrandeöverutkasttillavsiktsförklaringomutvecklingavdenregionalatågtrafiken.Hämtatfrånhttp://www.sll.se/Handlingar/Trafiknämnden/2012/oktober/TN%2012060138%20Avsiktsförklaring%20Mälab_PDFA.pdfden5oktober2012Trafiknämnden,Stockholmlänslandsting.(u.d.).WWW.SLL.se.Hämtatfrånhttp://www.sll.se/Handlingar/Trafiknämnden/2012/oktober/TN%2012060138%20Avsiktsförklaring%20Mälab_PDFA.pdfden17Oktober2012Trafiknämnden,Stockholmslänslandsting.(den27september2012).RegionalttafikförsörjningsprogramförStockholmslän.Bilaga4,Kollektivtrafikensutbudsstandard.Stockholm.Trafikverket.(u.d.).www.trafikverket.se.Hämtatfrånhttp://www.trafikverket.se/Aktuellt/Nyhetsarkiv/Nyhetsarkiv2/Nationellt/201208/Regeringensatsarpautbyggnadavjarnvagen/?si=80E499055CE78613372B25ED64FAD4B7&rid=339740287&sn=trafikverketseden17Oktober2012Öijerholm,R.(den3oktober2012).T.f.länsråd.LänsstyrelsenStockholmslän.(S.Eriksson,Intervjuare)FåglarnafotograferadeavSuneEriksson.


Teknisk RapportEn beskrivning av genomförande och metoderOpinionsundersökning Trosa kommun2013 02 14


InledningEnkätenheten vid Statistiska centralbyrån (SCB) genomförde under januariår 2013 en enkät- och webbundersökning på uppdrag av Trosa kommun.Syftet med undersökningen var att undersöka vad medborgarna i kommunenhar för uppfattning i frågan kring ett eventuellt läns- och landstingsbyte.Populationen utgjordes av personer folkbokförda i Trosa kommun i åldrarna18 år och uppåt.Urvalet bestod av 1000 personer och det var totalt 656 personer som besvaradefrågeblanketten, vilket var 65,9 procent av urvalet, efter övertäckningenpå 4 personer exkluderats.Resultatet i form av två tabeller levererades 14 februari enligt överenskommelse.Karolin Strömberg var undersökningsledare, Pernilla Larsson var produktionsansvarigoch Johan Löfgren har framställt tabellerna. Trosa kommunskontaktperson gentemot SCB var Jakob Etaat.OmfattningPopulation och urvalPopulationen, d.v.s. de objekt som man vill kunna dra slutsatser om, utgjordesav röstberättigade i Trosa kommun.För att kunna dra ett urval från populationen skapades en urvalsram somavgränsade, identifierade och möjliggjorde koppling till objekten i populationen.Urvalsramen i undersökningen skapades med hjälp av data frånRegistret över totalbefolkningen aktualitet 2012-10-31. Antalet personer iurvalsramen var 9064.Från urvalsramen drogs ett obundet slumpmässigt urval om 1000 personer.Ett obundet slumpmässigt urval innebär att alla objekt har samma sannolikhetatt komma med i urvalet.Urvalsstorleken bestämdes av Trosa kommun till 1000 personer.FrågorTrosa kommun utformade frågan i blanketten. Ursprungliga frågeställningenvar ”Vill du att Trosa kommun ska ansöka om att övergå till Stockholmslän och landsting?”. Efter diskussioner med SCB ändrades frågan tilldet mer neutrala ”Vill du att Trosa kommun ska ansöka om att övergå tillStockholms län och landsting eller vara kvar i Södermanlands län ochlandsting eller den region som Södermanlands län kan komma att ingå i?”2


Därefter genomfördes en granskning av mätteknisk expertis i syfte attminska risken för mätfel. Grundläggande för bra kvalitet i en undersökningär kvaliteten på de data som samlas in. För att säkerställa att frågorna fungerarså bra som möjligt och enligt intentionerna har därför blanketten genomgåttett mättekniskt test.SCB gav olika förslag på möjliga förändringar av frågan och svarsalternativen.Trosa kommun valde använda den ursprungliga frågan med någramindre förändringar i ordval (se bilaga 1).SCB rekommenderade att lägga till ett svarsalternativ för ”ingen åsikt”/”vetinte” i undersökningen. Trosa kommun ville inte ha med det eftersom deville att undersökningen skulle vara så lik en folkomröstning som möjligt.Blanketten bestod av 1 fråga.DatainsamlingFrågeblanketterna skickades ut med post. I ett informationsbrev ombadspersonen att besvara frågan och skicka svaret till SCB. Det första utskicketgenomfördes den 10:e januari 2013. Sedan skickades ett tack- och påminnelsekortden 22:a januari. Insamlingen avslutades den 4 februari 2013.Tabell 1 Beskrivning av inflödet. Antal och andelAntalAndelEfter första utskick 455 45,7Efter ToP-kort 201 20,2Totalt 656 65,9Bortfall 340 34,1Urval 996 100,0I informationsbrevet kunde uppgiftslämnarna läsa om undersökningensbakgrund, syfte och att undersökningen genomfördes i samarbete mellanTrosa kommun och SCB.Brevet informerade även om personuppgiftslagen samt offentlighets- ochsekretesslagen och att det var frivilligt att medverka i undersökningen.För att SCB ska kunna lämna ut data från en enkätundersökning krävs informeratsamtycke av uppgiftslämnarna. Det innebär att de genom att besvarablanketten och skicka in den godkänner att deras svar behandlas pådet sätt, som beskrivs i informationsbrevet.Datainsamlingen genomfördes av enkätenheten vid SCB.3


Datainsamlingen genomfördes via webb samt skanning av de frågeblankettersom inkommit via post.SCB kan inte garantera att den utvalda personen själv besvarat frågeblanketten.Någon kontroll av att rätt person har besvarat frågeblanketten harinte gjorts. Detta på grund av att det inte finns några kontrollfrågor i blanketten.Svarsdatafilen kompletterades med vikter för uppräkning till populationsnivå.BortfallVanligtvis består bortfallet dels av objektsbortfall, som innebär att frågeblanketteninte är besvarad alls, och dels av partiellt bortfall som innebäratt vissa frågor i blanketten inte är besvarade. Eftersom denna frågeblankettenbart består av en fråga är objektbortfall och partiellt bortfall sammasak i denna undersökning. Frågan om ett eventuellt länsbyte saknade ettalternativ som ”ingen åsikt/vet inte” och det partiella bortfallet/objektsbortfalletkan bero på att personer har just denna åsikt och hardärför skickat in enkäten tom. Tolv enkäter inkom tomma. Dessa kodadessom bortfall.Objektsbortfall kan bland annat bero på att uppgiftslämnaren inte är villigatt delta i undersökningen, att uppgiftslämnaren inte går att nå eller attuppgiftslämnaren är förhindrad att medverka. Objektsbortfallet i dennaundersökning redovisas i tabell 2 nedan.Om bortfallet skiljer sig från de svarande, med avseende på undersökningsvariablerna,så kan skattningarna som grundar sig på enbart de svarandevara skeva. För att reducera bortfallsskevheten har vikter beräknatsmed hjälp av kalibrering (se bilaga).Tabell 2 Beskrivning av objektsbortfallAntalEj avhörda 323Avböjd medverkan 2Ej anträffad 3Enkät inkommen blank 12Totalt 340Med ”Ej avhörda” menas att ingen uppgift om varför frågeblanketten inteär besvarad har lämnats. Med ”Avböjd medverkan” menas att SCB meddelatsatt uppgiftslämnaren inte vill medverka i undersökningen. ”Ej anträf-4


fad” innehåller saknad adress i Registret över totalbefolkningen (RTB),hemlig adress och tillfälligt bortrest.Viktberäkning och estimationFör varje svarande person (kallas objekt i fortsättningen) har en vikt beräknats.Syftet med detta är att kunna redovisa resultat för hela populationenoch inte bara för de svarande. Vikten kallas därför även för uppräkningstal.Vikterna har beräknats utifrån urvalsdesignen samt antaganden om objektsbortfalloch täckningsfel. Beräkningen gjordes med hjälp av ett av SCBegenutvecklat SAS-makro (ETOS).I denna undersökning har två varianter av vikter tagits fram. En för OSUmed ”rak uppräkning”, och en med kalibrerade vikter för att reduceraeventuell bortfallsskevhet.Vikterna vid rak uppräkning kan beskrivas med formeln:N nNw k *n m mDär wk = vikt/uppräkningstal för objekt kNnm= antal objekt i urvalsramen= antal objekt i urvalet= antal objekt som svaratVikterna bygger på antagandet att ramen återspeglar populationen väl ochdärmed att över- och undertäckningen är försumbar. Dessutom antas attbortfallet inte skiljer sig från de svarande med avseende på undersökningsvariablerna.Vikterna vid kalibrering kan beskrivas med formeln:wk = dk . vkDär wk = vikt/uppräkningstal för objekt kdkvk= designvikt= kalibreringsvikt baserad på hjälpinformationDesignvikten är den del av vikten som beror på urvalsdesignen. Vid bortfallkan det vara så att vissa grupper av urvalet svarar i större utsträckningän övriga, t.ex. kan kvinnor svara i högre grad än män. Om de grupper somsvarat i högre grad har en annan fördelning på undersökningsvariablernaän övriga kan detta ha en snedvridande effekt på resultatet. För att kom-5


pensera för detta har kalibreringsvikter använts (se bilaga för mer detaljer).Vikterna bygger på antagandet att ramen återspeglar populationen väl ochdärmed att över- och undertäckningen är försumbar.För en mer utförligare beskrivning av kalibreringsestimatorn se Lundströmoch Särndal (2001): Estimation in the Presence of Nonresponse and Frame Imperfections,Statistics Sweden.Vikterna/uppräkningstalen multipliceras med objektens variabelvärden föratt skapa statistikvärden gällande för populationen. Vikterna kompenserarför objektbortfallet. I denna undersökning är det väldigt liten skillnad(0.8%) i skattning av populationen med rak uppräkning och kalibrering.För beräkning av skattningen av totaler används följande formel:Ŷrw k ykdär wk = vikt/uppräkningstal för objekt kyk = variabelvärde för objekt ksummering sker av de svarande (r)Och för beräkning av skattningen av medelvärden används följande formel:Ŷrwrkwykkdär wk = vikt/uppräkningstal för objekt kyk = variabelvärde för objekt ksummering sker av de svarande (r).Statistikens tillförlitlighetRamtäckningTäckningsfel, under- och övertäckning, innebär att urvalsram och populationinte helt stämmer överens. Undertäckning innebär att vissa objekt somingår i populationen saknas i urvalsramen. Övertäckning innebär att objektsom inte ingår i populationen ändå finns i urvalsramen. Ett sätt att minskatäckningsfelen är att ha bra och uppdaterade register. Registret över totalbefolkningen(RTB) som använts vid identifikationskörningen bedöms varaav god kvalitet och bra uppdaterat.6


I denna undersökning visade sig 4 personer vara övertäckningsobjekt. Detvar personer som avlidit. Någon undertäckning har inte observerats, menundertäckning är vanligtvis svårare att upptäcka än övertäckning.UrvalDenna kvalitetskomponent avser fel som uppkommer på grund av att endastett urval av populationen undersöks. Urvalsfel är således den avvikelsemellan ett skattat värde och det faktiska värdet som beror på att maninte undersöker alla objekt i populationen. Urvalsfelets storlek minskarmed en ökad urvalsstorlek.MätningEtt fel som kan uppstå vid mätning är att lämnade uppgifter skiljer sig frånfaktiska uppgifter. Felet kallas mätfel och kan uppkomma då uppgiftslämnareninte minns de faktiska uppgifterna, missförstår frågan eller medvetetsvarar felaktigt.BearbetningVid den manuella och maskinella bearbetningen av datamaterialet kan bearbetningsfeluppstå. Exempel på bearbetningsfel är registreringsfel ochkodningsfel. Dessa fel kan förhindras och upptäckas i de kontroller somgenomförs vid dataregistreringen. I den här undersökningen bedöms registreringsfeletvara litet eftersom frågeblanketten endast hade fasta svarsalternativ.BortfallBortfallsfel inträffar om objekten i bortfallet och de svarande skiljer sig åtavseende frågan i undersökningen. En beskrivning av bortfallet finns i denbortfallsanalys som gjorts i samband med valet av hjälpinformation tillkalibreringen (se bilaga).Beskrivning av tabellerTabellerTvå versioner av tabeller har tagits fram där olika viktningsförfarandenanvänts. Tabellerna har räknats upp till populationsnivå, vilket innebär attresultatet avser hela populationen och inte endast de svarande. Antalsuppgifternaär således skattningar av antal personer i populationen med denaktuella egenskapen.De tabeller som presenteras i denna rapport har tagits fram enligt de formlersom presenterats i avsnitt ”Viktberäkning och estimation” med hjälp avSAS och variansprogrammet ETOS.7


JämförbarhetJämförbarhet över tidDetta är första gången som SCB genomför undersökningen.ÖvrigtSCB har fått in synpunkter från en kommuninvånare i Trosa som anser attinformationen som Trosa har gått ut med har varit i fördel till ett länsbytemot Stockholms län och landsting. Om detta är fallet så kan undersökningensresultat påverkats.BilagorBilaga 1 Frågeblankett, informationsbrev och påminnelsebrevBilaga 2 KalibreringsrapportBilaga 3 TabellerBilaga 4 Bortfallsanalys8


Läns- och landstingsbyte förTrosa kommun?– ett vägval för dig som medborgareTrosa kommun har under det senaste året undersökt möjligheterna att genomföra ett länsochlandstingsbyte som skulle innebära att kommunen övergår till Stockholms län ochlandsting. Undersökningen inleddes med anledning av att landstinget i Södermanlands länpåbörjat en process för att utreda förutsättningarna att ingå i en ny region.Ett byte av läns- eller regiontillhörighet innebär ett tydligt vägval för framtiden och det ärdärför viktigt att man vid ett sådant beslut tar hänsyn till medborgarnas åsikter. För attundersöka vad du som medborgare har för uppfattning i frågan har Trosa kommunuppdragit åt Statistiska centralbyrån, SCB, att genomföra en opinionsundersökning genomdenna enkät.Undersökningens resultat kommer att bli en viktig del i det underlag somkommunfullmäktige har när man tar beslut i ärendet under våren 2013.På nästa sida finner du mer information om undersökningen.Ditt svar är viktigtDu är en av 1 000 kommuninvånare i åldern 18 år och uppåt som har blivit slumpmässigtutvalda från SCB:s befolkningsregister. Ditt svar är betydelsefullt eftersom det gerkommunen en uppfattning om vad invånarna tycker. Det är frivilligt att delta iundersökningen, men din medverkan är viktig. Ditt svar kan inte ersättas med någonannans och din medverkan bidrar till att resultatet blir mer tillförlitligt.Du gör så härPå det medföljande frågebladet finner du information om hur du medverkar iundersökningen och om vilken fråga som ska besvaras.Vi behöver ditt svar senast den 4 februari men besvara gärna enkäten så snart sommöjligt.Tack på förhand för din medverkan!Med vänlig hälsningJohan Sandlund Jakob Etaat Karolin StrömbergKommunchef Kanslichef UndersökningsledareTrosa kommun Trosa kommun SCBKontakta oss gärna:Frågor om undersökningenFrågor om de olika valenSCB, enkätenhetenTrosa kommunpernilla.larsson@scb.se, 019-176930 0156-52000SCB, DIH/ENK, 701 89 ÖrebroKommunkontoret, 619 80 TrosaVar god vändwww.scb.sewww.trosa.se


Hur lämnade uppgifter användsEfter avslutad bearbetning hos SCB avlägsnas alla identitetsuppgifter innan materialetöverlämnas i form av en tabell till Trosa kommun.Undersökningens resultat kommer att bli en viktig del i det underlag somkommunfullmäktige har när man tar beslut i ärendet under våren 2013.Skydd av lämnade uppgifterDet kommer inte att framgå vad just du har svarat när undersökningens resultat redovisas.Uppgifterna som lämnas skyddas av sekretess enligt 24 kap. 8 § offentlighets- ochsekretesslagen (2009:400). De personer vid SCB som arbetar med undersökningenomfattas av reglerna om handlingssekretess och tystnadsplikt.Regler för personuppgiftsbehandling finns även i personuppgiftslagen (1998:204) samt ilagen (2001:99) och förordningen (2001:100) om den officiella statistiken.Numret högst upp på frågeblanketten är bl.a. till för att SCB under insamlingen ska kunnase vilka som har svarat.ResultatResultatet från undersökningen kommer att finnas tillgängligt på kommunens hemsidawww.trosa.se från och med den 18 februari år 2013.Om Trosa kommun väljer att ansöka om ett läns- och landstingsbyte kommer ansökanlämnas vidare till kammarkollegiet och regeringen för vidare beslut. Ett eventuellt bytekan träda i kraft tidigast den 1 januari år 2015.Instruktioner:därför tänka på att:▪Använda kulspetspenna med svart eller blå färg, inte röd. Använd inte blyertspenna!▪ Markera dina svar med kryss, så här och INTE så här:▪Om du vill ändra ditt svar, täck hela rutan:


Mer information kring frågan om läns- och landstingsbyteUnder det senaste året har Trosa kommun undersökt möjligheterna att genomföra ett läns- ochlandstingsbyte som skulle innebära att kommunen övergår till Stockholms län och landsting.Trosa kommun ingår idag i Södermanlands län och landsting. För drygt ett år sedan påbörjadelandstinget i Södermanlands län en process för att undersöka förutsättningarna att ingå i en ny region.Då en regionbildning mellan Södermanlands län och Stockholms län inte visat sig vara möjlig har manistället övervägt andra regionlösningar. Region Mälardalen är ett av de förslag som diskuterats. Det ären sammanslagning mellan Södermanlands län, Örebro län och Västmanlands län.Trosa kommun står i och med regionfrågan inför en förändring som innebär att man behöver taställning till om man vill övergå till Stockholms län eller fortsätta att ingå i Södermanlands län ellerden region som Södermanlands län skulle kunna bli del av.Besök gärna www.trosa.se/lansbyte för mer information i frågan. Du finner också mer information iden folder kommunen har skickat ut till samtliga hushåll i kommunen, samt i det åttasidigainformationshäfte som medföljde ÖSP (Östra Södermanlands Posten) den 8 januari.Så medverkar duDu kan medverka i undersökningen genom att besvara en webbenkät eller en pappersenkät.Om du vill besvara webbenkäten gör du det viawww.insamling.scb.seLogga då in med användarnamn och lösenord.Användarid:Lösenord:Vill du istället besvara pappersenkäten kryssar du för ett av svarsalternativen i den nedanståendefrågan och skickar in ditt svar i det portofria svarskuvertet.Vi behöver ditt svar senast den 4 februari men besvara gärna enkäten så snart som möjligt.Tycker du att Trosa kommun ska ansöka om att övergå till Stockholms länoch landsting eller vara kvar i Södermanlands län och landsting ocheventuellt ingå i den nya region som Södermanlands län kan komma atttillhöra?Jag tycker att Trosa kommun bör ansöka om att övergå till Stockholms länoch landsting.Jag tycker att Trosa kommun bör vara kvar i Södermanlands län ochlandsting och eventuell ingå i den nya region som Södermanlands länkan komma att tillhöra.Tack för att du medverkar i undersökningen!


Foto: Torbjörn ArvidsonS-701 89 ÖREBROBPORTOÖREBRO 1BETALTPORT PAYÉP212


Stort tack till alla som har svaratFör en tid sedan fick du en frågeblankett med rubriken Läns- och landstingsbyte för Trosakommun? – ett vägval för dig som medborgare från Statistiska centralbyrån och Trosakommun. Vi vill tacka alla er som har svarat på frågan om läns- och landstingsbyte.Har du inte har hunnit svara än så vill vi påminna dig att du fortfarande har möjlighet attskicka in frågeblanketten. Vi behöver ditt svar senast den 4 februari men besvara gärnaenkäten så snart som möjligt.Du kan besvara frågan via www.insamling.scb.seLogga in med användarnamn och lösenord.Du kan fortfarande besvara pappersenkäten. Skickadå in den i det portofria svarskuvertet.Användarnamn:Lösenord:Ditt svar är betydelsefullt eftersom det ger kommunen en uppfattning om vad invånarnatycker i frågan. Det är frivilligt att delta i undersökningen, men din medverkan är viktig.Ditt svar kan inte ersättas med någon annans och din medverkan bidrar till att resultatetblir mer tillförlitligt.Undersökningens resultat kommer att bli en viktig del i kommunfullmäktiges underlagnär man tar beslut i ärendet under våren 2013.Resultatet från undersökningen kommer att finnas tillgängligt på kommunens hemsidawww.trosa.se från och med den 18 februari 2013.SCB-Tryck, Örebro 2013.01 MILJÖMÄRKT Trycksak 341590Johan Sandlund Jakob Etaat Karolin StrömbergKommunchef Kanslichef UndersökningsledareTrosa kommun Trosa kommun SCBKontakta oss gärna:Frågor om undersökningenFrågor om de olika valenSCB, enkätenhetenTrosa kommunpernilla.larsson@scb.se, 019-176930 0156-52000SCB, DIH/ENK, 701 89 ÖrebroKommunkontoret, 619 80 Trosawww.scb.sewww.trosa.se


STATISTISKA CENTRALBYRÅN 2013-02-12 1(6)PCA/MIHJohan Löfgren, Fredrik CarlssonBilaga 2Kalibreringsrapport för undersökningen”Opinionsundersökning Trosa kommun”1. InledningI en urvalsundersökning är alltid skattningarna behäftade med urvalsfelberoende på att endast en delmängd (urval) av populationen studeras. Ettannat fel uppkommer om man inte lyckas få svar från alla personer (bortfall)och om dessa avviker från de svarande med avseende på undersökningsvariablerna.Detta fel kallas för bortfallsfel.För att underlätta användningen av statistiken är det värdefullt om storlekenpå felen kan uppskattas. Av nämnda feltyper är det endast storleken påurvalsfelet som kan skattas med hjälp av urvalsinformation. Kunskap ombortfallsfelet kan i regel bara fås på ett indirekt och approximativt sätt genomatt utnyttja registervariabler.Både urvalsfel och bortfallsfel kan reduceras genom att använda ett effektivtuppräkningsförfarande. I följande avsnitt redovisas hur det görs i dennaundersökning.2. ParametrarFör frågan i undersökningen kommer den procentuella andelen personer meden viss egenskap att redovisas som en total för hela populationen.3. HjälpinformationViss hjälpinformation utnyttjas vanligtvis även före estimationen, t.ex. förbildande av stratifierade urvalsdesigner. Det kan dock finnas ytterligarehjälpinformation som är effektiv i estimationen.Det centrala arbetet för att få god kvalitet på skattningarna, då kalibreringsestimatornanvänds, är att använda ”stark” hjälpinformation. I följandeavsnitt beskrivs detta arbete för denna undersökning.3.1 Tänkbara hjälpvariablerVid val av hjälpvariabler är det tre kriterier som ska beaktas (se Lundströmoch Särndal 2001):Det första kriteriet är att variabeln samvarierar väl medsvarsbenägenheten (-sannolikheten). Det är det viktigaste kriteriet


STATISTISKA CENTRALBYRÅN 2013-02-12 2(6)PCA/MIHJohan Löfgren, Fredrik Carlssoneftersom det leder till en minskning av bortfallsskevheten för allaskattningar.Det andra kriteriet är att variabeln samvarierar väl med (viktiga)målvariabler. Om så är fallet minskar bortfallsbiasen för de skattningarsom byggs upp av dessa målvariabler. Även variansen minskar för dessaskattningar.Det tredje kriteriet är att variabeln avgränsar (viktiga)redovisningsgrupper. Det leder framförallt till minskad varians iskattningar för dessa redovisningsgrupper.Tänkbara hjälpvariabler, det vill säga variabler som tros uppfylla dessakriterier, hämtades ifrån RTB (Registret över totalbefolkningen).Hjälpvariablerna är definierade enligt tabell 1.Tabell 1. Definition av de utnyttjade hjälpvariablernaVariabel (benämning) Förklaring av kodernaKön1 = Man2 = KvinnaÅlder1 = 18-29 år2 = 30-39 år3 = 40-49 år4 = 50-59 år5 = 60-69 år6 = 70- år3.1.1 Kriterium 1: Variabeln samvarierar med svarsbenägenhetenFör att se huruvida hjälpvariablerna uppfyller det första kriteriet, studerassambandet mellan den dikotoma variabeln svarande/bortfall ochhjälpvariablerna. Det görs genom att beräkna andel svarande i olika grupper,bestämda av respektive hjälpvariabel.Vid stora skillnader mellan svarsandelarna utgör variabeln en stark kandidattill hjälpvariabel.I tabellerna 2-7 skattas de procentuella svarsandelarna i årets undersökningför de utvalda hjälpvariablerna. Vid skattningen används designvikten (vidstratifierat OSU: N h /n h ).Tabell 2. Skattade procentuella andelar svarande fördelade på könGrupp Kvinna Man TotaltTotalt 65,8 65,9 65,9Tabell 3. Skattade procentuella andelar svarande fördelade på ålder18-29 30-39 40-49 50-59 60-69 70-


STATISTISKA CENTRALBYRÅN 2013-02-12 3(6)PCA/MIHJohan Löfgren, Fredrik CarlssonTotalt 34,3 58,1 60,4 68,1 84,4 80,6De skattade svarsandelarna visar att ålder bör vara stark enligt kriterium 1, dåden visar på stora skillnader i svarsfrekvenser. Analysen ovan talar för attålder bör användas i hjälpvektorn.3.1.2 Kriterium 2: Variabeln samvarierar med viktiga målvariablerHär studeras huruvida hjälpvariablerna samvarierar med viktigamålvariabler. De parametrar som studeras är skattad andel personer somuppfyller villkoren i tabell 8. Vid skattningen används designvikter. Ingenytterligare hjälpinformation än den som finns i designen används.Tabell 8 Skattningar fråga 1, andel som anser att tycker att Trosa kommun böransöka om att övergå till Stockholms län och landstingVariabelAndelTotalt 63,0Kvinnor60,4Män65,61 = 18-29 år61,22 = 30-39 år67,13 = 40-49 år76,14 = 50-59 år70,65 = 60-69 år54,36 = 70- år54,9Det bör betonas att resultaten ovan är skattningar behäftade med vissurvalssosäkerhet. Skattning av urvalsosäkerheten presenteras inte här, menfinns med i de tabeller som levereras.En slutsats som kan dras är att kön och ålder verkar samvariera med denstuderade parametern.3.1.3 Kriterium 3: Variabeln avgränsar viktiga redovisningsgrupperOm hjälpvariabeln avgränsar viktiga redovisningsgrupper kan kvaliteten blibättre i dessa grupper. Framförallt blir skattningarna säkrare omhjälpvariabeln väl avgränsar redovisningsgruppen.Kalibreringsestimatorn ger konsistenta skattningar i den meningen attestimatorn ger exakta skattningar för utnyttjade registertotaler.I föreliggande undersökning skall skattningar enbart tas fram för totalen.Därav är kriterium 3 ej aktuellt.


STATISTISKA CENTRALBYRÅN 2013-02-12 4(6)PCA/MIHJohan Löfgren, Fredrik Carlsson3.2 Slutligt val av hjälpvektorEfter en sammanvägning av analysen kring ovanstående kriterier samt efterkontroll av vikternas beslutades att samtliga studerade variabler ska ingå ihjälpvektorn. Hjälpvektorn ser ut som följer:Kön + Ålder4. Teknisk beskrivning av urval och estimationVi har en population U bestående av N personer. De parametrar vi ärintresserade av är främst funktioner av två totaler Y y ochZUzk, där y kär värdet på variabel y för person k och zkvärdet på enannan variabel för samma person. Vi kan definiera y (och även z) som endikotom variabel, dvs.1 om person k har studerade egenskapy k(4.1)0 för övrigtDet finns givetvis också intresse av parametrar för olikaredovisningsgrupper. Låt oss benämna dessa U1,..., Ud,..., UD, därUD U dd 1. Totalen för redovisningsgrupp d kan skrivasUkY y(4.2)dUdkdärydky0kför kUför övrigt.dZdbildas på likartat sätt.En generell parameter för redovisningsgrupp d (d kan också avse helaYdpopulationen) kan skrivasdC , där C är en konstant.ZdDen vanligaste parametern är en procentuell andel, som erhålles när C 100och zk1 för alla k, och y är definierad enligt (4.1). Om vi låter Ndvaraantalet personer i redovisningsgrupp d, då kan parametern skrivas


STATISTISKA CENTRALBYRÅN 2013-02-12 5(6)PCA/MIHJohan Löfgren, Fredrik CarlssonPdyU dk100 (4.3)NdVi drar ett obundet slumpmässigt urval shav storleken nhfrån stratum h (h 1 ,...,H ), men p.g.a. övertäckning och bortfall har vi endast svarsmängdenrhav storlekenstratum h ger vi beteckningenm h att utföra beräkningarna på. Storleken påNh.Den ”konventionella” estimatorn (för Yd), har följande form:Hˆ Nhdyr dk(4.4)hh 1mhYI estimator (4.4) används ingen ytterligare hjälpinformation än stratifieringsinformationen.Denna estimationsmetod brukar kallas ”rak uppräkning inomstrata”.I syfte att erhålla en estimator med mindre urvalsfel och bortfallsskevhet änestimator (4.4) utnyttjar vi hjälpinformation också i estimationen. Vi bildaren hjälpvektor x k, som anger till vilka kategorier avKön + Åldersom person k tillhör. Från registret över totalbefolkningen framställer visedan hjälptotalerna xU k . Vi utnyttjar denna hjälpinformation i endkalibreringsestimator.Kalibreringsestimatorn för totalen Ydhar följande utseende:Ŷ d v y(4.5)wdrkkdkdärd /kN h nhför kr hochvk1 (x(4.6)xU kdk x k )dk x k xr r k1k


STATISTISKA CENTRALBYRÅN 2013-02-12 6(6)PCA/MIHJohan Löfgren, Fredrik CarlssonVid skattning av en parameter av typenmed hjälp av kalibreringsvikternaw d v .kYCddskattas respektive totalZdDenna kalibreringsvikt uppfyller kalibreringsvillkoret: w xr kxu kvilket innebär att om vikterna läggs på variabler som ingår i hjälpvektornsummeras dessa upp till de hjälptotaler vi hämtat från registren.kkk,Referenser:Lundström S. och Särndal C.-E. (2001). Estimation in the Presence ofNonresponse and Frame Imperfections. Stockholm, Statistics Sweden.


Bilaga 3 TabellerRak uppräkningJag tycker att Trosa kommun böransöka om att övergå tillStockholms län och landsting.Jag tycker att Trosa kommun bör vara kvar iSödermanlands län och landsting och eventuelltingå i den nya region som Södermanlands länkan komma att tillhöra.Totalt 63,0 ± 3,6 37,0 ± 3,6KönKvinna 60,4 ± 5,1 39,6 ± 5,1Man 65,6 ± 5,0 34,4 ± 5,0Ålder18-29 61,2 ± 13,1 38,8 ± 13,130-39 67,1 ± 10,0 32,9 ± 10,040-49 76,1 ±7,6 23,9 ±7,650-59 70,6 ± 8,2 29,4 ± 8,260-69 54,3 ± 7,2 45,7 ± 7,270- 54,9 ± 8,2 45,1 ± 8,2Kalibrerade skattningarJag tycker att Trosa kommun böransöka om att övergå tillStockholms län och landsting.Jag tycker att Trosa kommun bör vara kvar iSödermanlands län och landsting och eventuelltingå i den nya region som Södermanlands länkan komma att tillhöra.Totalt 63,8 ± 3,7 36,2 ± 3,7KönKvinna 61,1 ± 5,3 38,9 ± 5,3Man 66,5 ± 5,1 33,5 ± 5,1Ålder18-29 61,2 ± 13,4 38,8 ± 13,430-39 67,1 ± 10,0 32,9 ± 10,040-49 76,2 ±7,6 23,8 ±7,650-59 70,6 ± 8,2 29,4 ± 8,260-69 54,4 ± 7,1 45,6 ± 7,170- 54,9 ± 8,1 45,1 ± 8,1


Bilaga 4 BortfallsanalysÅldergruppKönInflödeSvarandeBortfallAntal Andel Antal Andel18-29 49 34,3% 94 65,7%30-39 79 58,1% 57 41,9%40-49 113 60,4% 74 39,6%50-59 109 68,1% 51 31,9%60-69 173 84,4% 32 15,6%70- 133 80,6% 32 19,4%Totalt 656 65,9% 340 34,1%InflödeSvarandeBortfallAntal Andel Antal AndelMan 323 65,9% 167 34,1%Kvinna 333 65,8% 173 34,2%Totalt 656 65,9% 340 34,1%


SammanträdesprotokollValnämndenTrosa kommunSammanträdesdatum2013-02-25§ 9 Dnr VN 2013/1Folkomröstning om indelningsändring avseendeläns- och landstingsbyte för Trosa kommunValnämnden föreslårKommunfullmäktige besluta1. att folkomröstning ska genomföras i fråga om läns- och landstingsbyte förTrosa kommun.2. att folkomröstningen genomförs söndagen den 26 maj år 2013.3. att indelningen i omröstningsdistrikt och vallokaler ska motsvara indelningenav valdistrikt och vallokaler vid allmänna valet år 2010, enligt nedan:OmröstningsdistriktVallokalTrosa ÖstraTomtaklintskolan, TrosaTrosa VästraTomtaklintskolan, TrosaTrosa SödraTomtaklintskolan, TrosaVagnhärad NorraHedebyskolan, VagnhäradVagnhärad SödraHedebyskolan, VagnhäradVagnhärad CentraltHedebyskolan, VagnhäradVästerljungSockenstugan, Västerljung4. att omröstningslokalerna ska vara öppna för röstning mellan klockan 10.00och 18.00 på omröstningsdagen.Forts.Justerandes signaturUtdragsbestyrkande5


SammanträdesprotokollValnämndenTrosa kommunSammanträdesdatum2013-02-25Forts. § 95. att frågan som ska ställas i folkomröstningen ska vara: Tycker du att Trosakommun ska övergå till Stockholms län och landsting eller vara kvar iSödermanlands län och landsting och eventuellt ingå i den nya region somSödermanlands län kan komma att tillhöra?6. att frågan ska besvaras med följande svarsalternativ:– Jag tycker att Trosa kommun ska övergå till Stockholms län ochlandsting.– Jag tycker att Trosa kommun ska vara kvar i Södermanlands län ochlandsting och eventuellt ingå i den nya region som Södermanlands län kankomma att tillhöra.7. att folkomröstningen ska genomföras med två röstsedlar med följandeinformation:Röstsedel 1 Röstsedel 2[Rubrik] (Folkomröstning om länsochlandstingsbyte för Trosa kommun)[Fråga] (Tycker du att Trosa kommunska övergå till Stockholms län ochlandsting eller vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra?)[Svarsalternativ] (Jag tycker attTrosa kommun ska övergå tillStockholms län och landsting.)[Rubrik] (Folkomröstning om länsochlandstingsbyte för Trosa kommun)[Fråga] (Tycker du att Trosakommun ska övergå till Stockholmslän och landsting eller vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra?)[Svarsalternativ] (Jag tycker attTrosa kommun ska vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra.)Forts.Justerandes signaturUtdragsbestyrkande6


SammanträdesprotokollValnämndenTrosa kommunSammanträdesdatum2013-02-25Forts. § 98. att röstsedlarna ska vara vita med svart text och ha samma storlek som vidordinarie val till kommunfullmäktige.9. att varje röstsedel ska framställas i 20 000 exemplar.10. att förtidsröstning anordnas under tiden 16 maj 2013 - 25 maj 2013.Förtidsröstning sker vid följande platser: Trosa stadsbibliotek (ÖstraLånggatan 28), Vagnhärads bibliotek (Centrumvägen 16 A), samt vid ICASupermarket Trossen (Verktygsgatan 1).11. att institutionsröstning anordnas under tiden 16 maj 2013 – 25 maj2013. Institutionsröstning sker vid (ett tillfälle under 2 timmar perboende) följande platser: Trosagården (Rodergatan 3), Häradsgården(Gärdesvägen 37) samt Ängsgården (Tomtaklintgatan 2 C).12. att budröstning ska tillåtas.13. att röstsammanräkningen senast ska vara avslutad måndagen den27 maj 2013.14. att kostnaden för folkomröstningen beräknas till 550 tkr. Kostnadenbelastar kommunens resultat för 2013.15. att valnämnden i övrigt uppdras att genomföra folkomröstningen.ÄrendetBakgrundTrosa kommun har initierat en process i syfte att kartlägga förutsättningarna fören s.k. indelningsändring som skulle innebära att kommunen framgent blirtillhörande Stockholms län och landsting.Forts.Justerandes signaturUtdragsbestyrkande7


SammanträdesprotokollValnämndenTrosa kommunSammanträdesdatum2013-02-25Forts. § 9Kommunfullmäktige gav den 5 december 2012, § 98 kommunstyrelsen i uppdragatt vidare utreda ärendet inför ett slutligt ställningstagande i fullmäktige den 13mars 2013. Vid sammanträdet fattade fullmäktige även beslut om att gevalnämnden i uppdrag att inleda ett samråd med den centrala valmyndigheten isyfte att möjliggöra en eventuell folkomröstning i frågan.Valnämnden har den 20 februari 2013, § 6 behandlat frågan och beslutade dåatt samråda med valmyndigheten om att genomföra en folkomröstning söndagenden 26 maj 2013. Valmyndigheten har meddelat att man inte har något atterinra mot det föreslagna datumet.Statistiska centralbyrån, SCB, har på fullmäktiges uppdrag under våren 2013genomfört en opinionsundersökning i frågan. Undersökningen genomfördesunder januari till februari månad 2013 och visade att en majoritet av Trosakommuns invånare är positivt inställda till ett byte till Stockholms län ochlandsting.I det fall Trosa kommun avser genomföra en folkomröstning i frågan ska ettsådant beslut fattas av fullmäktige. Kommunstyrelsens arbetsutskott har den 18februari beslutat att föreslå fullmäktige att folkomröstning ska genomföras.Valnämnden bereder därför föreliggande ärende för slutgiltigt ställningstagande ifullmäktige den 13 mars 2013.Yrkanden– Greger Tidlund (S) yrkar bifall till förvaltningens förslag med ändring i att-sats5, 6 och 7 innebärandes att frågan som ska ställas i folkomröstningen blirföljande: Tycker du att Trosa kommun ska övergå till Stockholms län ochlandsting eller vara kvar i Södermanlands län och landsting?, samt attsvarsalternativen blir följande: (1) Jag tycker att Trosa kommun ska övergå tillStockholms län och landsting. (2) Jag tycker att Trosa kommun ska vara kvar iSödermanlands län och landsting.– Dan Larson (M) yrkar bifall till förvaltningens förslag.Forts.Justerandes signaturUtdragsbestyrkande8


SammanträdesprotokollValnämndenTrosa kommunSammanträdesdatum2013-02-25Forts. § 9PropositionOrdföranden ställer proposition på Dan Larsons (M) yrkande mot Greger Tidlunds(S) yrkande och finner att valnämnden beslutar i enlighet med Dan Larsons (M)yrkande om bifall till förvaltningens förslag.ReservationGreger Tidlund (S) reserverar sig mot beslutet till förmån för eget förslag.Ärendets beredningTjänsteskrivelse från kanslichef Jakob Etaat 2013-02-22Kopia tillKommunstyrelsenAktenJusterandes signaturUtdragsbestyrkande9


TjänsteskrivelseValnämndenDnr VN 2013/12013-02-22KommunkontoretJakob EtaatTel. 0156-520 06Fax. 0156-520 17Jakob.etaat@trosa.seFolkomröstning om indelningsändring avseendeläns- och landstingsbyte för Trosa kommunFörslag till beslutValnämnden föreslårKommunfullmäktige besluta1. att folkomröstning ska genomföras i fråga om läns- och landstingsbyte förTrosa kommun.2. att folkomröstningen genomförs söndagen den 26 maj år 2013.3. att indelningen i omröstningsdistrikt och vallokaler ska motsvara indelningenav valdistrikt och vallokaler vid allmänna valet år 2010, enligt nedan:OmröstningsdistriktTrosa ÖstraTrosa VästraTrosa SödraVagnhärad NorraVagnhärad SödraVagnhärad CentraltVästerljungVallokalTomtaklintskolan, TrosaTomtaklintskolan, TrosaTomtaklintskolan, TrosaHedebyskolan, VagnhäradHedebyskolan, VagnhäradHedebyskolan, VagnhäradSockenstugan, Västerljung4. att omröstningslokalerna ska vara öppna för röstning mellan klockan 10.00och 18.00 på omröstningsdagen.5. att frågan som ska ställas i folkomröstningen ska vara: Tycker du att Trosakommun ska övergå till Stockholms län och landsting eller vara kvar iSödermanlands län och landsting och eventuellt ingå i den nya region somSödermanlands län kan komma att tillhöra?1


6. att frågan ska besvaras med följande svarsalternativ:– Jag tycker att Trosa kommun ska övergå till Stockholms län ochlandsting.– Jag tycker att Trosa kommun ska vara kvar i Södermanlands län ochlandsting och eventuellt ingå i den nya region som Södermanlands län kankomma att tillhöra.7. att folkomröstningen ska genomföras med två röstsedlar med följandeinformation:Röstsedel 1 Röstsedel 2[Rubrik] (Folkomröstning om länsochlandstingsbyte för Trosa kommun)[Rubrik] (Folkomröstning om länsochlandstingsbyte för Trosa kommun)[Fråga] (Tycker du att Trosa kommunska övergå till Stockholms län ochlandsting eller vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra?)[Fråga] (Tycker du att Trosakommun ska övergå till Stockholmslän och landsting eller vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra?)[Svarsalternativ] (Jag tycker attTrosa kommun ska övergå tillStockholms län och landsting.)[Svarsalternativ] (Jag tycker attTrosa kommun ska vara kvar iSödermanlands län och landsting ocheventuellt ingå i den nya region somSödermanlands län kan komma atttillhöra.)8. att röstsedlarna ska vara vita med svart text och ha samma storlek som vidordinarie val till kommunfullmäktige.9. att varje röstsedel ska framställas i 20 000 exemplar.10. att förtidsröstning anordnas under tiden 16 maj 2013 - 25 maj 2013.Förtidsröstning sker vid följande platser: Trosa stadsbibliotek (ÖstraLånggatan 28), Vagnhärads bibliotek (Centrumvägen 16 A), samt vid ICASupermarket Trossen (Verktygsgatan 1).2


11. att institutionsröstning anordnas under tiden 16 maj 2013 – 25 maj2013. Institutionsröstning sker vid (ett tillfälle under 2 timmar per boende)följande platser: Trosagården (Rodergatan 3), Häradsgården (Gärdesvägen37) samt Ängsgården (Tomtaklintgatan 2 C).12. att budröstning ska tillåtas.13. att röstsammanräkningen senast ska vara avslutad måndagen den 27 maj2013.14. att kostnaden för folkomröstningen beräknas till 550 tkr. Kostnaden belastarkommunens resultat för 2013.15. att valnämnden i övrigt uppdras att genomföra folkomröstningen._________ÄrendetBakgrundTrosa kommun har initierat en process i syfte att kartlägga förutsättningarna fören s.k. indelningsändring som skulle innebära att kommunen framgent blirtillhörande Stockholms län och landsting. Kommunfullmäktige gav den 5december 2012, § 98 kommunstyrelsen i uppdrag att vidare utreda ärendet införett slutligt ställningstagande i fullmäktige den 13 mars 2013. Vid sammanträdetfattade fullmäktige även beslut om att ge valnämnden i uppdrag att inleda ettsamråd med den centrala valmyndigheten i syfte att möjliggöra en eventuellfolkomröstning i frågan.Valnämnden har den 20 februari 2013, § 6 behandlat frågan och beslutade dåatt samråda med valmyndigheten om att genomföra en folkomröstning söndagenden 26 maj 2013. Valmyndigheten har meddelat att man inte har något atterinra mot det föreslagna datumet.Statistiska centralbyrån, SCB, har på fullmäktiges uppdrag under våren 2013genomfört en opinionsundersökning i frågan. Undersökningen genomfördesunder januari till februari månad 2013 och visade att en majoritet av Trosakommuns invånare är positivt inställda till ett byte till Stockholms län ochlandsting.I det fall Trosa kommun avser genomföra en folkomröstning i frågan ska ettsådant beslut fattas av fullmäktige. Kommunstyrelsens arbetsutskott har den 18februari beslutat att föreslå fullmäktige att folkomröstning ska genomföras.Valnämnden bereder därför föreliggande ärende för slutgiltigt ställningstagande ifullmäktige den 13 mars 2013.Att genomföra en folkomröstningGenomförande av kommunala folkomröstningar regleras främst i lagen(1994:692) om kommunala folkomröstningar. Enligt denna ska fullmäktigebesluta om:3


1. dag för omröstning,2. omröstningsdistrikt och omröstningslokaler,3. den fråga och de svarsalternativ som ska ställas till de röstberättigade,4. röstsedlarnas antal, innehåll och utseende,5. huruvida röstning kan ske på annat sätt än genom personlig inställelse iomröstningslokalen, samt6. när röstningssammanräkningen ska vara avslutad.Dagen för folkomröstningen beslutas efter samråd med den centralavalmyndigheten. Detta samråd ska ske senast tre månader föreomröstningsdagen. Valnämnden är enligt lag ansvarig för att anordnafolkomröstningen och genomföra sammanräkningen. Till skillnad mot ett allmäntval åligger det kommunen att fastställa hur omröstningen ska ske, närsammanräkningen ska vara avslutad och vilket valmaterial som skatillhandahållas.Rösträtt vid en kommunal folkomröstning har den som är folkbokförd ikommunen, senast på dagen för omröstningen fyller 18 år och:1. är medborgare i Sverige eller någon annan av Europeiska unionensmedlemsstater2. är medborgare i Island eller Norge, eller3. för de fall de är andra utlänningar, har varit folkbokförda i Sverige tre åri följd före dagen för folkomröstningen.Datum för genomförandeEnligt lagen (1994:692) om kommunala folkomröstningar ska fullmäktigefastställa datum för omröstningen. Folkomröstningen föreslås äga rum söndagenden 26 maj 2013. Detta datum möjliggör en rimlig administrativ hantering ochbedöms dessutom kunna bidra till ett högt valdeltagande då det inte ligger ianslutning till någon längre ledighet.Indelning av omröstningsdistrikt och vallokalerFörvaltningen föreslår att omröstningsdistrikt och omröstningslokaler motsvararindelningen vid det allmänna valet 2010.Öppettider under valdagenDå antalet röstande i regel är något lägre i början och slutet av valdagen föreslåsatt omröstningslokalerna har öppet mellan klockan 10.00 och 18.00 underomröstningsdagen.Frågeställning och svarsalternativFolkomröstningen föreslås avse följande frågeställning: Tycker du att Trosakommun ska övergå till Stockholms län och landsting eller vara kvar iSödermanlands län och landsting och eventuellt ingå i den nya region somSödermanlands län kan komma att tillhöra?4


Frågeställning föreslås besvaras med något av följande svarsalternativ:– Jag tycker att Trosa kommun ska övergå till Stockholms län ochlandsting.– Jag tycker att Trosa kommun ska vara kvar i Södermanlands län ochlandsting och eventuellt ingå i den nya region som Södermanlands län kankomma att tillhöra.Frågeställning och svarsalternativ motsvarar den fråga och de svarsalternativsom utformats i samråd med Statistiska centralbyrån, SCB, vid genomförandetav opinionsundersökningen under våren 2013.RöstsedlarnaRöstsedlarna föreslås vara vita med svart text och ha samma format som vid ettallmänt val. Röstsedlarna föreslås framställas i 20 000 exemplar vardera, vilketmöjliggör för kommunen att skicka ut ett exemplar av varje röstsedel till deröstberättigade innan förtidsröstningen påbörjas.Förtidsröstning och institutionsröstningFörtidsröstning och institutionsröstning föreslås äga rum under perioden 16 maj- 25 maj 2013. Förtidsröstningen sker under denna period vid Trosastadsbibliotek (Östra Långgatan 28), Vagnhärads bibliotek (Centrumvägen 16 A),samt vid ICA Supermarket Trossen (Verktygsgatan 1). Institutionsröstningföreslås, som vid det allmänna valet 2010, ske vid Trosagården (Rodergatan 3),Häradsgården (Gärdesvägen 37) samt vid Ängsgården (Tomtaklintgatan 2 C).Valnämnden fattar, efter samråd med berörda inrättningar, beslut om tider förförtidsröstning och institutionsröstning.BudröstningFör att underlätta röstningen för personer som har svårt att ta sig tillomröstningslokalen föreslås att kommunen tillhandahåller budröstning.Budröstningen administreras av kansliets personal.Finansiering av folkomröstningenKostnaden för genomförandet av folkomröstningen uppskattas till ca 480 tkr.Utöver detta tillkommer en kostnad om ca 70 tkr för information i anslutning tillomröstningen. Sammantaget täcker detta bland annat personalkostnader(arvoden, ersättningar mm), verksamhetskostnader (material, lokaler,transporter, informationsmaterial mm) samt kostnader för tryck av röstkort,röstsedlar och röstlängder.5


Valnämndens uppdragValnämnden ansvarar för genomförandet av folkomröstningen. I detta ingårbland annat att samordna valdistrikten, fastställa organisation vid omröstning,förtidsröstning, institutionsröstning, att förordna röstmottagare samt attarrangera utbildning för röstmottagare.Johan SandlundKommunchefJakob EtaatKanslichefBeslut tillKommunfullmäktige6


PMKommunstyrelsenDnr KS 2012/1072013-02-14KommunkontoretJakob EtaatTel. 0156-520 06Fax. 0156-520 17Jakob.etaat@trosa.seFolkomröstning om indelningsändring avseende läns- ochlandstingsbyte för Trosa kommunÄrendetBakgrundTrosa kommun har initierat en process i syfte att kartlägga förutsättningarna fören s.k. indelningsändring som skulle innebära att kommunen framgent blirtillhörande Stockholms län och landsting. Som ett led i denna process harkommunen tillsatt Björn Sundström och Derk de Beer att genom SverigesKommuner och Landsting (SKL) genomföra en utredning kring förutsättningarnaför ett läns- och landstingsbyte. Kommunen har även uppdragit åtutvecklingskonsult Sune Eriksson att genomföra en detaljeradkonsekvensbeskrivning av en eventuell indelningsändring.Ett läns- och landstingsbyte innebär ett vägval för Trosa kommun ochfullmäktige har därför ansett det viktigt att, utöver utredningarnas bedömning,skapa sig en uppfattning av vad medborgarna har för inställning i frågan. Ienlighet med Kommunallagen kap 5 § 34 får fullmäktige besluta att:”[…] det som ett led i beredningen av ett ärende som fullmäktige skall handlägga skallinhämtas synpunkter från medlemmar i kommunen eller landstinget. Detta kan ske genomfolkomröstning, opinionsundersökning eller något liknande förfarande […]” 1I enlighet med lagstiftningen beslutade fullmäktige den 5 december 2012, § 98att Trosa kommuns invånares synpunkter i frågan skulle inhämtats genom enopinionsundersökning. Denna undersökning genomfördes under januari tillfebruari månad år 2013.1 Sveriges kommuner och landsting, Kommunallagen med kommentarer och praxis, femte upplagan(Stockholm 2011) sid. 3641


Vid fullmäktiges sammanträde den 13 mars 2013 beslutar fullmäktige, utifrånutlåtanden i genomförda utredningar samt resultatet i genomfördopinionsundersökning, om man ska gå vidare med en ansökan om att byta länochlandsting. Vid detta sammanträdestillfälle fattar fullmäktige även beslut omTrosa kommun ska genomföra en folkomröstning i frågan.OpinionsundersökningDen aktuella opinionsundersökningen genomfördes av Statistiska centralbyrån,SCB, genom en enkätundersökning som riktade sig till 1000 slumpvis utvaldainvånare i kommunen i åldern 18 år och uppåt. (Urvalsantalet utökades efterönskemål från Trosa kommun för att uppnå en förhöjd tillförlitlighet iundersökningen. SCB:s urvalsstandard för liknande undersökningar, som t exMedborgarundersökningen, är ett urval på 500 personer för en kommun medTrosas invånarantal.)Undersökningen har en hög svarsfrekvens på motsvarande 65,9 procent. En rakuppräkning av resultatet visar att en klar majoritet av de svarande förespråkarett byte till Stockholms län och landsting. Bland de svarande angav 63,0 procent(+- 3,6 procent) att man förespråkar ett byte till Stockholms län och landstingmedan 37,0 procent (+- 3,6 procent) angav att man förespråkar att Trosakommun är kvar i Södermanlands län och landsting eller ingår i annan regionsom även skulle omfatta Södermanlands län. 2Statistiska centralbyrån har använt sig av kalibrering av vikter som metod för attkompensera för eventuella skevheter i resultatet orsakade av bortfall. Genom attanvända sig av vikter får man ett resultat som avses spegla hela populationenoch inte bara urvalet. 3 Det kalibrerade resultatet av opinionsundersökningenvisar att 63,8 procent (+- 3,7 procent) förespråkar ett byte till Stockholms länoch landsting medan 36,2 procent (+- 3,7 procent) förespråkar att Trosakommun är kvar i Södermanlands län och landsting eller ingår i annan regionsom även skulle omfatta Södermanlands län. Andelen för ett läns- ochlandstingsbyte till Stockholm är således, om än marginellt, något större vid ettskattat resultat än vid den raka uppräkningen. 4Opinionsundersökningen visar sammantaget att en klar majoritet, oberoende avfelmarginal och med hänsyn tagen till bortfall, förespråkar ett läns- ochlandstingsbyte till Stockholm. Statistiska centralbyråns metodanvändning ikombination med ett entydigt undersökningsresultat bedöms ge fullmäktige etttillförlitligt underlag som visar kommunens invånares inställning i frågan omläns- och landstingsbyte för Trosa kommun.2 Statistiska centralbyrån. Teknisk Rapport. En beskrivning av genomförande och metoder.Opinionsundersökning Trosa kommun 2013-02-14. Bilaga 3 Tabeller3 Ibid. sid. 54 Ibid. Bilaga 3 Tabeller2


FolkomröstningI det fall Trosa kommun väljer att genomföra en folkomröstning i frågan skall ettsådant beslut fattas av fullmäktige. Vid fullmäktiges sammanträde den 13 mars2013 avses beslut tas om huruvida en folkomröstning i frågan ska hållas eller ej.Om fullmäktige beslutar att genomföra en folkomröstning bör även tidpunktenför denna fastslås vid detta sammanträdestillfälle (datum för folkomröstningbeslutas efter samråd med den centrala valmyndigheten. Valnämnden ansvararför samrådet med valmyndigheten). Enligt Lag om kommunala folkomröstningar(1994:692) ska fullmäktige, utöver att ta beslut om dag för genomförande avfolkomröstning, även besluta om omröstningsdistrikt och omröstningslokaler,den fråga och de svarsalternativ som skall ställas till de röstberättigade,röstsedlarnas antal, innehåll och utseende, huruvida röstning kan ske på annatsätt än genom personlig inställelse i omröstningslokalen, samt närröstsammanräkningen senast skall vara avslutad. Valnämnden ansvarar, i likhetmed vid allmänna val, för genomförandet av folkomröstningen.Kostnaden för genomförande av en folkomröstning bedöms bli ca 480 tkr. 5 Idetta ingår bland annat personalkostnader (arvoden, ersättningar mm),verksamhetskostnader (material, lokaler, transporter, informationsmaterial mm)samt kostnader för tryck av röstkort, röstsedlar och röstlängder. Utöver dettatillkommer arbetstid för administration av omröstningen samt eventuellakostnader för tillkommande informationsspridning.Kommunala folkomröstningar som hålls under en mandatperiod tenderar i regelatt få ett lägre valdeltagande än allmänna val och folkomröstningar som hålls ianslutningar till allmänna val. Det genomsnittliga valdeltagande vid dekommunala folkomröstningar som hållits mellan allmänna val sedan år 2006 ärexempelvis 45,6 procent, vilket går att jämföra med 84,6 procent som var detgenomsnittliga valdeltagandet i Sverige vid det allmänna valet år 2010.Valdeltagandet varierar givetvis till stor del från fall till fall och är inte minst medanledning av vilken fråga som folkomröstningen avser behandla. Det generelltsett låga valdeltagande bör dock tas i beaktandet då man avser använda sig avfolkomröstning som metod för att efterhöra medborgarnas inställning i en fråga.En annan viktig aspekt att beakta är att folkomröstningar är rådgivande. I denaktuella frågan om läns- och landstingsbyte beslutar fullmäktige om att ansökaom en indelningsändring. Trosa kommuns mandat att ta beslut i ärendetbegränsas i princip till själva ansökan. Rätten att fatta beslut om att genomföraindelningsändringen innehar regering och riksdag.Johan SandlundKommunchefJakob EtaatKanslichef5 Kostnaden för opinionsundersökningen uppgick till ca 170 tkr inklusive informationsspridning ianslutning till undersökningen.3


TjänsteskrivelseKommunstyrelsenDnr KS 2013/152013-01-29KommunkontoretHelena HåkanssonTel. 0156-522 50Fax. 0156-520 17helena.hakansson@trosa.seAnsökan om anslutning till finskt förvaltningsområdeFörslag till beslutKommunstyrelsen föreslårkommunfullmäktige beslutaatt ansöka hos regeringen om att Trosa kommun ska anslutas till finsktförvaltningsområde.____________SammanfattningGenom att ansluta sig till det finska förvaltningsområdet utökar Trosa kommunsitt åtagande gentemot kommunens finsktalande befolkning. Som en del i detfinska förvaltningsområdet åtar sig kommunen bland annat att erbjudaförskoleverksamhet och äldreomsorg helt eller delvis på finska. Enskildamedborgare får också möjlighet att använda sitt minoritetsspråk i kontakter medkommunen och dess myndigheter.Kommunen får statsbidrag för de merkostnader som beslutet innebär.Kommuner som inte redan ingår i ett förvaltningsområde kan ansöka hosregeringen om att få ingå i ett sådant. Ansökan ska ha inkommit tillRegeringskansliet senast den 1 april för att hinna behandlas samma år.För att en kommun ska kunna bli förvaltningsområde krävs att en sådan önskanär tydligt uttryckt hos berörd minoritetsgrupp. I Trosa kommun har en sådanönskan framförts genom Trosa- Vagnhärad Finska förening samt genom ennamninsamling bestående av 181 underskrifter från medborgare. Frågan haräven behandlats i en motion från Socialdemokraterna, Miljöpartiet ochTrosaradikalerna samt i en interpellation från Socialdemokraterna.1


ÄrendetDen 15 april 2010 lämnade Trosa- Vagnhärad Finska förening in en hemställantill kommunen om frivillig anslutning till finskt förvaltningsområde. Förslagetskickades på remiss till socialkontoret, vård- och omsorgskontoret ochskolkontoret för att få kontorens synpunkter i ärendet. I remissvaren uttryckteberörda kontor att man till stor del ansåg sig möta den efterfrågan som fannsavseende stöd till finskspråkiga. Behovet av att ingå som finsktförvaltningsområde ansågs därför vara begränsat.Socialdemokraterna, Miljöpartiet och Trosa radikalerna väckte den 21 december2010 en motion om att kommunen skulle ansöka om att tillhöraförvaltningsområdet för finska. Motionen avslogs i kommunfullmäktige den 10november 2011 med motiveringen att Trosa kommun inte borde ansökan omanslutning till finskt förvaltningsområde innan bilden av åtagandets innebördblivit tydligare.Den 10 november 2011 mottog kommunen 181 underskrifter från medborgaresom vill att kommunen ska ansöka om att anslutas till förvaltningsområdet förfinska. Ärendet har därefter behandlats i en interpellation ställd av Ari Heikkilä(S) till kommunstyrelsen ordförande Daniel Portnoff (M) den 15 oktober 2012.Kommunkontoret har under våren 2013 handlagt ärendet och redogör i dennaskrivelse för en samlad bild av förutsättningar, effekter och åtaganden som ärförknippat med att vara en del i det finska förvaltningsområdet.Nationella minoriteters rättigheterI december 1999 beslutade riksdagen att Sverige skulle ansluta sig tillEuroparådets ramkonvention om skydd för nationella minoriteter och deneuropeiska stadgan om landsdels- eller minoritetsspråk. Den 1 januari 2010trädde Lagen om nationella minoriteter och minoritetsspråk i kraft i Sverige.Minoritetslagen består av ett grundskydd som består av allmänna bestämmelsersom gäller i hela landet och för samtliga fem nationella minoriteter. Lagenomfattar också bestämmelser om förstärkt skydd för samiska, finska ochmeänkieli i förvaltningsområdena.De fem nationella minoriteterna i Sverige är judar, romer, samer, sverigefinnaroch tornedalingar. Minoritetsspråken i Sverige är jiddisch, romani chib, samiska,finska och meänkieli. Gemensamt för de minoritetsgrupper som talar dessa språkär att de har befolkat Sverige under lång tid samt att de utgör grupper med enuttalad samhörighet. De har även en egen religiös, språklig och kulturelltillhörighet samt en vilja att behålla sin identitet.Antal med finsk anknytning i Trosa kommunEnligt statistik från Statistiska centralbyrån (SCB) finns det 1 640 personer 1 medfinsk anknytning i Trosa kommun. Detta motsvarar 14,3 % av kommunens totalabefolkning (se bilaga 1).460 personer är födda i Finland. (ca 4 % av kommunens befolkning)1 Uppgifterna gäller 31 december 2011.2


612 personer är inte födda i Finland men har minst en förälder som är född iFinland. (ca 5,3 % av kommunens befolkning)568 personer är inte födda i Finland, har ingen förälder som är född iFinland, men har minst en far/morförälder som är född i Finland. (ca 4,9 %av kommunens befolkning)Viktigt att notera är att Statistiska centralbyråns statistik inte anger hur mångaav individerna med finskt påbrå som är finskspråkiga. Uppgifterna visar inteheller hur många av de med finsk påbrå som identifierar sig med den finskaminoritetsgruppen.Lagen om nationella minoriteterLagen om nationella minoriteter och minoritetsspråk trädde i kraft den 1 januari2010. Sveriges internationella förpliktelser innebär att vissa minoritetsrättigheterska förverkligas i hela landet. Alla fem nationella minoriteter omfattas av dennya lagen (2009:724). Det som ingår i grundskyddet är alla kommuner skyldigaatt följa, oavsett om man ingår i ett förvaltningsområde eller inte. 2GrundskyddDet så kallade grundskyddet innebär bland annat att:förvaltningsmyndigheter ska informera de nationella minoriteterna pålämpligt sätt om deras rättigheter när det behövs,det allmänna har ett särskilt ansvar för att skydda och främja de nationellaminoritetsspråken och ska även främja de nationella minoriteternasmöjligheter att behålla och utveckla sin kultur i Sverige,barns utveckling av en kulturell identitet och användning av det egnaminoritetsspråket ska främjas särskilt,förvaltningsmyndigheter ska ge de nationella minoriteterna möjlighet tillinflytande i frågor som berör dem och så långt det är möjligt samråda medrepresentanter för minoriteterna i sådana frågor.Särskilda rättigheterDessutom gäller särskilda rättigheter för finsk- samisk- och meänkielitalandeinom respektive förvaltningsområde. Dessa rättigheter är bland annat att:enskilda har rätt att använda språken vid muntliga och skriftliga kontaktermed myndigheter i enskilt ärende där myndigheten är beslutsfattare,myndigheten är skyldig att ge muntligt svar på samma språk samt att påbegäran ge en skriftlig översättning av beslut och motivering. Myndighetenkan bestämma särskild tid och plats där servicen ges på minoritetsspråk,2 I syfte att öka medvetenheten om minoritetslagstiftningen har en handbok om nationellaminoriteters rättigheter sänts till alla kommunens förvaltningar i juni 2012. Frågan har därefterdiskuterats i kommunens ledningsgrupp.3


förvaltningsmyndigheter ska verka för att det finns tillgång till personal medkunskaper i minoritetsspråken,kommunerna har särskilda skyldigheter att anordna äldre- och barnomsorg,helt eller delvis på minoritetsspråken om någon i förvaltningsområdet önskardetta.Ansökan om anslutning till finskt förvaltningsområdeKommuner som inte redan ingår i ett förvaltningsområde kan ansöka hosregeringen om att få ingå i ett sådant. Ansökan ska ha inkommit tillRegeringskansliet senast den 1 april för att hinna behandlas samma år. OmTrosa kommun blir ansluten till finskt förvaltningsområde kommer beslutetsannolikt att gälla från och med den 1 februari 2014.Förutsättningar för att ingå i ett förvaltningsområdeVid prövning av kommunens ansökan tas hänsyn till om det finns ett uttalatintresse från berörda minoriteter om att kommunen ska ingå iförvaltningsområdet. Hänsyn tas också till om det finns en politisk förankringkring åtagandet om att bli förvaltningsområde samt om det finns en vilja attlångsiktigt arbeta med detta åtagande.Utträde ur förvaltningsområdeKommuner som ansöker om att ingå i ett förvaltningsområde har tagit ett aktivtbeslut att långsiktigt engagera sig i skyddet av finska, samiska eller meänkieli.Frågan om möjlighet till utträde ur ett förvaltningsområde har inte behandlats ipropositionen (prop 2008/09:105) som ligger till grund för dagens minoritetslagoch saken har heller aldrig prövats. Arbetsmarknadsdepartementet har dockuppmärksammat frågeställningen och överväger behovet av en översyn avregelverket i detta avseende.StatsbidragKommuner som ingår i ett förvaltningsområde får varje år statsbidrag frånregeringen. Grundbeloppet för en kommun är 660 tkr (2013). Kommuner medmindre än 50 000 invånare får 1 grundbelopp.Statsbidraget ska användas i samråd med minoriteterna och syftar till attfinansiera merkostnader i samband med minoritetslagens tillkomst, inte tillsådant som kommunen sedan tidigare är skyldig att göra, som till exempel attanlita tolk enligt förvaltningslagens bestämmelser eller till att dela ut ordinarieföreningsbidrag. Statsbidraget kan bland annat användas för att täcka kostnaderför:Dialog och samråd med minoriteterKartläggningInformationsinsatser och översättningarOrganisationsöversyn och förändringarKultur- och språkinsatserSynliggörande av minoriteter och minoritetsspråk, t.ex. skyltning4


Initiala mobiliseringsinsatser, till exempel inköp av litteratur, pedagogisktmaterialDel av personalkostnaderHandlingsplanKommunen ska årligen rapportera till länsstyrelsen i Stockholms län om hur ochtill vad statsbidraget har använts.Från och med bidragsåret 2013 kommer statsbidraget att kunna sättas ned omkommuner inte har förbrukat hela bidragsbeloppet för närmast föregåendebidragsår. Om en kommun visar att medlen kommer att användas för sådanasärskilda merkostnader eller åtgärder som inte täcks av nästföljande årsstatsbidrag ska dock ingen nedsättning ske.Förbrukning av statsbidragDet går idag inte att förutse vilka kostnader Trosa kommun kommer få genomatt ingå i förvaltningsområdet. För att bedöma kostnaderna behöver enkartläggning först göras av vilka behov minoritetsgruppen har. Kartläggningenska ske i dialog med minoriteterna och omfatta kommunens befintliga resursersåväl som de behov och önskemål som finns hos minoritetsgruppen. Delar avstatsbidraget kan användas till att finansiera kartläggningen.I Rapport om tillämpningen av lagen om nationella minoriteter ochminoritetsspråk år 2011 har länsstyrelsen i Stockholms län tillsammans medSametinget redovisat hur kommuner använt statsbidraget. Rapporten visar attendast ett litet antal kommuner förbrukar hela det statsbidrag som är möjligt atterhålla.Av de nitton kommuner i det finska förvaltningsområdet som har deltagit ikartläggningar, uppger tre att det finns större behov inom förskolan än vad detfinns resurser till. Även när det gäller äldreomsorgen uppger tre av kommunernaatt behovet av äldreomsorg inte är helt tillgodosett.I rapporten konstateras att det överlag läggs begränsade resurser på förskolanoch äldreomsorgen. Cirka 13 % av de förbrukade medlen för 2011 satsades påförskolan. Cirka 12 % av de förbrukade medlen för 2011 gick till äldreomsorgen.Rapporten visar att statsbidraget i stor utsträckning går till samordning, kultur,informationsinsatser och processer. Det är ännu oklart om detta leder till någrastrukturella förändringar när det gäller till exempel ökad tillgång till förskola ochäldreomsorg samt en hållbar språkrevitalisering.Trosa kommuns arbete med finskt förvaltningsområdeGrundläggande delar av förvaltningsmyndigheternas minoritetsarbete är attdiskutera behov, intressen och önskemål tillsammans med minoritetsgruppen.I Rapport om tillämpningen av lagen om nationella minoriteter ochminoritetsspråk år 2011 anges tre faktorer för ett framgångsrikt arbete:Att verksamheten har tydliga mål och en klar förankring i både den politiskaoch verksamhetsmässiga ledningen.Att en tydlig samordnande funktion för minoritetsverksamheterna finns.5


Att förekomsten av fungerande samråd med berörd nationell minoritet ärcentral.HandlingsplanTrosa kommun ska efter antagandet till finskt förvaltningsområde skapa enhandlingsplan utifrån kategorierna nedan.SamrådMinoritetsgruppen är själv bäst lämpad att se den egna gruppens behov ochönskemål. Det är därför viktigt att den dialog som äger rum mellan myndigheterockså förs tillsammans med minoritetsgruppen.Samråd bör ske på ett systematiskt och regelbundet sätt. Minoritetsgruppen skages ett reellt inflytande över de frågor som berör dem, inte minst de somhandlar om användandet av ekonomiska resurser avsatta för minoritetspolitiskaåtgärder.KartläggningKommuner som ingår i ett förvaltningsområde har krav på sig att kartlägga debehov som finns av åtgärder till stöd för användningen av finska. Inventeringenbör ge svar på:Vilka behov och önskemål minoritetsgruppen har.Vilka språkkunskaper som finns inom kommunens olika personalgrupper.Information och myndighetsbemötandeI minoritetslagen finns bestämmelser om förvaltningsmyndigheters skyldighet attinformera minoritetsgrupperna om deras rättigheter att få samhällsservice påminoritetsspråk. Om detta ska kunna ske på ett effektivt sätt måste det inommyndigheterna finnas både språkkunskaper och kunskaper omminoritetslagstiftningen.Främjande och synliggörandeI språklagen (2009:600) anges att det allmänna har ett särskilt ansvar för attskydda och främja de nationella minoritetsspråken. Det allmänna ska även iövrigt främja de nationella minoriteternas möjligheter att behålla och utvecklasin kultur i Sverige. Barns utveckling av en kulturell identitet och användning avdet egna minoritetsspråket ska främjas särskilt. Kravet på att främja denationella minoriteternas språk och kultur innebär att aktiva åtgärder ska vidtas.FörskolaKommuner i förvaltningsområden ska arbeta medvetet och planmässigt med attorganisera förskoleverksamhet helt eller delvis på finska. Lagen definierar intevad som avses med helt eller delvis, det måste avgöras från fall till fall.Skolinspektionen har i riktad tillsyn inom området visat på brister i hurkommuner inom förvaltningsområdena informerar om och erbjuder förskola påminoritetsspråk. Rapporten från Skolinspektionen kommer vara till hjälp förTrosa kommun i arbetet med att tillgodose minoritetsgruppens behov avförskoleverksamhet.6


ÄldreomsorgEn kommun i ett förvaltningsområde ska erbjuda den som begär det möjlighetatt få hela eller delar av äldreomsorgen av personal som behärskar finska. Dettaär särskilt viktigt då det är vanligt att äldre personer gradvis förlorar förmåganatt tala och förstå andra språk än modersmålet.SamordnareKommunen bör ha en tydlig samordnande funktion för minoritetsverksamheten.Den av kommunen utsedda samordnaren bör regelbundet finnas tillgänglig försåväl allmänheten som för kommunens olika verksamheter.Samordnare i andra kommuner använder en del av arbetstiden till utåtriktadverksamhet i form av medverkan vid olika aktiviteter och genomförande avuppsökande verksamhet. Andra viktiga uppgifter för samordnaren är att ansvaraför information och utbildningar externt och inom den kommunalaadministrationen. Samordnarens roll blir också att se till att kommunen följer detsom ingår i grundskyddet som gäller för samtliga nationella minoriteter.Kommunkontorets slutsatserDen finska minoriteten i Trosa kommun har tydligt yttrat ett önskemål om attTrosa kommun ska ingå i det finska förvaltningsområdet. Trosa kommun visardessutom en ambition om att långsiktigt vilja verka för att uppfylla det åtagandesom det finska förvaltningsområdet innebär. Kommunkontoret gör därförbedömningen att inga hinder föreligger för en ansökan hos regeringen om attTrosa kommun ska ingå i det finska förvaltningsområdet.Johan SandlundKommunchefHelena HåkanssonUtredareBilagor1. Statistik från SCB 2011-12-31 över andel med finsk anknytning i Trosakommun.2. Lag (2009:724) om nationella minoriteter och minoritetsspråk.3. Karta över nationella minoriteter i Sverige.Beslut tillKommunfullmäktige7


Statistiskacentralbyrån(SCB)Uppgifternagäller31december2011AntalföddaiFinlandAntalejföddaiFinlandochminstenförälderföddiFinlandAntalejföddaiFinland,ingenförälderföddiFinlandochminstenfar/morförälderföddiFinland SummaTotalbefolkningikommunenAndelföddaiFinland,procentAndelejföddaiFinlandochminstenförälderföddiFinland,procentAndelejföddaiFinland,ingenförälderföddiFinlandochminstenfar/morförälderföddiFinland,procentAndelmedfinskanknytning,procentkommunkod kommunnamn0488 Trosa 460 612 568 1640 11493 4,0 5,3 4,9 14,3


Lag (2009:724) om nationella minoriteter och minoritetsspråkLag (2009:724) om nationella minoriteter ochminoritetsspråkUtkom från trycket den 30 juni 2009utfärdad den 11 juni 2009.Allmänna bestämmelser1§Denna lag innehåller bestämmelser om nationella minoriteter, nationella minoritetsspråk, förvaltningsområdenoch rätten att använda minoritetsspråk hos förvaltningsmyndigheter och domstolar samtbestämmelser om vissa skyldigheter inom förskola, sådan pedagogisk verksamhet som avses i 25 kap.skollagen (2010:800) som kompletterar eller erbjuds i stället för förskola och äldreomsorg. Lagen innehållerockså bestämmelser om uppföljning av tillämpningen av lagen. SFS 2010:8652§Nationella minoriteter är judar, romer, samer, sverigefinnar och tornedalingar i enlighet med Sverigesåtaganden enligt Europarådets ramkonvention om skydd för nationella minoriteter (SÖ 2000:2) ochden europeiska stadgan om landsdels- eller minoritetsspråk (SÖ 2000:3).I språklagen (2009:600) anges att de nationella minoritetsspråken är finska, jiddisch, meänkieli, romanichib och samiska.3§Förvaltningsmyndigheter ska när det behövs på lämpligt sätt informera de nationella minoriteternaom deras rättigheter enligt denna lag.4§I språklagen (2009:600) anges att det allmänna har ett särskilt ansvar för att skydda och främja denationella minoritetsspråken.Det allmänna ska även i övrigt främja de nationella minoriteternas möjligheter att behålla och utvecklasin kultur i Sverige. Barns utveckling av en kulturell identitet och användning av det egna minoritetsspråketska främjas särskilt.5§Förvaltningsmyndigheter ska ge de nationella minoriteterna möjlighet till inflytande i frågor somberör dem och så långt det är möjligt samråda med representanter för minoriteterna i sådana frågor.Förvaltningsområden6§Med förvaltningsområdet för finska avses kommunerna Botkyrka, Eskilstuna, Gällivare, Hallstahammar,Haninge, Haparanda, Huddinge, Håbo, Kiruna, Köping, Pajala, Sigtuna, Solna, Stockholm, Södertälje,Tierp, Upplands Väsby, Upplands-Bro, Uppsala, Älvkarleby, Österåker, Östhammar och Övertorneå.Med förvaltningsområdet för meänkieli avses kommunerna Gällivare, Haparanda, Kiruna, Pajala ochÖvertorneå.Med förvaltningsområdet för samiska avses kommunerna Arjeplog, Arvidsjaur, Berg, Gällivare, Härjedalen,Jokkmokk, Kiruna, Lycksele, Malå, Sorsele, Storuman, Strömsund, Umeå, Vilhelmina, Åre,Älvdalen och Östersund.7§Andra kommuner än de som anges i 6 § kan efter anmälan få ingå i förvaltningsområdet för finska,meänkieli eller samiska. Beslut att en kommun ska få ingå i ett förvaltningsområde fattas av regeringen.Regeringen får meddela föreskrifter om sådan frivillig anslutning till ett förvaltningsområde.Rätten att använda finska, meänkieli och samiska hos myndigheter8§Enskilda har rätt att använda finska, meänkieli respektive samiska vid sina muntliga och skriftligakontakter med en förvaltningsmyndighet vars geografiska verksamhetsområde helt eller delvis sammanfallermed minoritetsspråkets förvaltningsområde. Detta gäller i ärenden i vilka den enskilde är part ellerställföreträdare för part, om ärendet har anknytning till förvaltningsområdet.Om den enskilde använder finska, meänkieli eller samiska i ett sådant ärende, är myndigheten skyldigatt ge muntligt svar på samma språk. Enskilda som saknar juridiskt biträde har dessutom rätt att på begäranfå en skriftlig översättning av beslut och beslutsmotivering i ärendet på finska, meänkieli respektivesamiska.Materialet kan vara skyddat av upphovsrätt. 1


Lag (2009:724) om nationella minoriteter och minoritetsspråkMyndigheten ska även i övrigt sträva efter att bemöta de enskilda på dessa språk.9§Utanför ett förvaltningsområde har enskilda rätt att använda finska, meänkieli respektive samiskavid muntliga och skriftliga kontakter i förvaltningsmyndigheters ärenden i vilka den enskilde är part ellerställföreträdare för part, om ärendet kan handläggas av personal som behärskar minoritetsspråket.10 § Enskilda har alltid rätt att använda finska och samiska vid sina skriftliga kontakter med Riksdagensombudsmän. Detsamma gäller vid enskildas skriftliga kontakter med Justitiekanslern, Försäkringskassan,Skatteverket och Diskrimineringsombudsmannen i ärenden i vilka den enskilde är part eller ställföreträdareför part.11 § Förvaltningsmyndigheter ska verka för att det finns tillgång till personal med kunskaper i finska,meänkieli respektive samiska där detta behövs i enskildas kontakter med myndigheten.12 § Förvaltningsmyndigheter får bestämma särskilda tider och särskild plats för att ta emot besök avenskilda som talar finska, meänkieli respektive samiska, samt ha särskilda telefontider.Rätten att använda finska, meänkieli och samiska hos domstolar13 § Den som är part eller ställföreträdare för part i ett mål eller ett ärende hos en förvaltningsrätt,tingsrätt, mark- och miljödomstol eller sjörättsdomstol med en domkrets som helt eller delvis sammanfallermed kommunerna Gällivare, Haparanda, Kiruna, Pajala och Övertorneå har rätt att användafinska eller meänkieli under målets eller ärendets handläggning, om målet eller ärendet har anknytningtill någon av dessa kommuner. Detsamma gäller samiska hos en sådan domstol med en domkrets somhelt eller delvis sammanfaller med kommunerna Arjeplog, Gällivare, Jokkmokk eller Kiruna, om måleteller ärendet har anknytning till någon av dessa kommuner.Rätten att använda finska, meänkieli respektive samiska omfattar också de domstolar dit en dom ellerett beslut i ett mål eller ärende som avses i första stycket överklagas. SFS 2010:94314 § Rätten att använda finska, meänkieli eller samiska i mål eller ärenden hos domstolar enligt 13 §omfattar rätt att ge in handlingar och skriftlig bevisning på detta språk, rätt att få de handlingar som hörtill målet eller ärendet muntligen översatta till detta språk och rätt att vid muntlig förhandling infördomstolen tala detta språk. Domstolen ska översätta handlingar och skriftlig bevisning till svenska, omdet inte är uppenbart onödigt.Även i övrigt ska domstolen sträva efter att använda minoritetsspråket i sina kontakter med parteneller dennes ställföreträdare.I alla mål och ärenden som omfattas av rätten att använda finska, meänkieli eller samiska hos domstolarenligt 13 § har en part eller ställföreträdare för part som saknar juridiskt biträde rätt att på begäran fådomslut och domskäl eller beslut och beslutsmotivering skriftligen översatta till detta språk.15 § Den som vill använda finska, meänkieli eller samiska under ett måls eller ett ärendes handläggningi domstol enligt 13 § ska begära detta i samband med att målet eller ärendet inleds eller första gångenparten ska yttra sig i målet eller ärendet.En begäran om att få en översättning enligt 14 § tredje stycket ska framställas inom en vecka från detatt domen eller beslutet meddelats, om en sådan begäran inte har framställts tidigare under handläggningenav målet eller ärendet.Om en begäran om att använda minoritetsspråk eller om att få en översättning framställs senare änvad som anges i första och andra styckena får den avslås. En sådan begäran får även avslås om det äruppenbart att den har ett otillbörligt syfte.16 § Om en part eller ställföreträdare för part har rätt att använda finska, meänkieli eller samiska i rättegång,ska tolk anlitas i enlighet med bestämmelserna i 5 kap. 6–8 §§ och 33 kap. 9 § rättegångsbalkenoch 50–52 §§ förvaltningsprocesslagen (1971:291).Materialet kan vara skyddat av upphovsrätt. 2


Lag (2009:724) om nationella minoriteter och minoritetsspråkFinska, meänkieli och samiska i förskola, viss annan pedagogiskverksamhet och äldreomsorgBeträffande rubriken, se SFS 2010:86517 § När en kommun i ett förvaltningsområde erbjuder plats i förskola eller sådan pedagogisk verksamhetsom avses i 25 kap. skollagen (2010:800) som kompletterar eller erbjuds i stället för förskola, ska kommunenerbjuda barn vars vårdnadshavare begär det plats i sådan verksamhet där hela eller delar avverksamheten bedrivs på finska, meänkieli respektive samiska. SFS 2010:86518 § En kommun i ett förvaltningsområde ska erbjuda den som begär det möjlighet att få hela eller delarav den service och omvårdnad som erbjuds inom ramen för äldreomsorgen av personal som behärskarfinska, meänkieli respektive samiska. Detsamma gäller kommuner utanför ett förvaltningsområde, omkommunen har tillgång till personal som är kunnig i språket.Undantag19 § Om det finns särskilda skäl får regeringen meddela föreskrifter om att en viss myndighet som lyderunder regeringen ska undantas från tillämpningen av 8 §. Motsvarande gäller efter regeringens bemyndigandeför landsting och kommun i fråga om kommunala myndigheter.Uppföljning m.m.20 § Förvaltningsmyndigheters tillämpning av denna lag ska följas upp. Regeringen meddelar föreskrifterom vilken eller vilka myndigheter som ska ansvara för uppföljningen. Detta uppföljningsansvar innebäringen inskränkning i det tillsynsansvar som vilar på andra myndigheter.21 § En myndighet med uppföljningsansvar ska dessutom genom rådgivning, information och liknandeverksamhet bistå andra förvaltningsmyndigheter vid tillämpningen av lagen.2009:0724Denna lag träder i kraft den 1 januari 2010 då lagen (1999:1175) om rätt att använda samiska hosförvaltningsmyndigheter och domstolar och lagen (1999:1176) om rätt att använda finska och meänkielihos förvaltningsmyndigheter och domstolar ska upphöra att gälla.2009:0857Denna lag träder i kraft den 15 februari 2010.2010:0865Denna lag träder i kraft den 1 juli 2011.2010:0943Denna lag träder i kraft den 2 maj 2011.Materialet kan vara skyddat av upphovsrätt. 3


VISSTE DU ATT?Kanske var tionde av Sveriges invånare tillhör någon av våranationella minoriteter samer (även urfolk), sverige finnar, tornedalingar,romer och judar.Nationella minoriteter i SverigeFrån den 1 januari 2010 har vi en ny lag om nationella minoriteteroch minoritetsspråk som anger minoriteternas rättigheter.Lagen fastslår rätten till inflytande i samhället och stöd för dehistoriska minoritetskulturerna och till minoritetsspråken i dessolika varieteter.Lagen omfattar alla myndigheter och gäller i hela landet.64 kommuner och 12 landsting och regioner ingår i dagsläget iså kallade förvaltningsområden för samiska, finska och meänkieli.Även andra kommuner kan ha möjlighet att ingå i ett förvaltningsområde.Ansökan om frivillig anslutning ska lämnas tillRegeringskansliet senast den 1 april.JokkmokkKirunaGällivare PajalaÖvertorneåTORNEDALINGAR Det finns cirka 50 000 tornedalingar i Sverigeframförallt bosatta i Norrbotten. Minoritetsspråketheter meänkieli. Kommuner som ingår i förvaltningsområdetför meänkieli är:Inom förvaltningsområdena finns ett utökat ansvar att erbjudaservice på samiska, finska och meänkieli. En del förvaltnings -om råden omfattar flera av språken.I förvaltningsområdena omfattas även statliga myndigheter avdet utökade ansvaret.Läs mer på www.minoritet.seStorumanSorseleArjeplogArvidsjaurÄlvsbynPiteåBodenLuleåÖverkalixKalixKalixHaparandaMalåNorsjöVilhelminaLyckseleSkellefteåDoroteaVindelnRobertsforsÅseleStrömsundBjurholmVännäsUmeåSAMER Det finns 20 000–35 000 samer i Sverige som talar blandannat nordsamiska, lulesamiska, pitesamiska, sydsamiskaoch umesamiska. Kommuner som ingår i det samiskaförvaltningsområdet är:ROMER Det finns 50 000–100 000romer och resande i Sverige bo sattaöver hela landet. Minoritetsspråketheter romani chib.JUDAR Det finns 20 000–25 000judar i Sverige bosatta överhela landet. Minoritetsspråketär jiddisch.Eda MunkforsF ilips tadSkinnskattebergNorrtäljeHälleforsSurahammarKnivstaArvikaForshagaEnköpingLindesbergVästeråsK ilKöping HallstahammarHåboGrumsStorfors NoraKarlstadÅrjängKungsörKarlskogaArbogaS äffleHammaröEskils tuna SträngnäsÖrebroK ristinehamn LekebergBengtsforsDegerfors KumlaStrömstadVingåkerF lenG nesta SödertäljeHallsbergDals-Ed ÅmålG ullspångK atrineholmLaxåT rosaAskersundNyköpingT anumMariestadFinspångMellerudF ärgelandaT örebodaOxelösundMotalaMunkedalGöteneKarlsborgNorrköpingSotenäsV änersborgLidköping Skövde T ibroLysekilUddevallaSöderköpingGrästorp SkaraVadstena LinköpingHjoMjölbyTroll-VaraOrust hättanLilla tÖdes högÅtvidaberg Valdemars vikEdeEssungaF alköping TidaholmAlingsåsBoxholmT jörnHerrljungaAle V årgårdaT ranåsStenungsundHaboKindaKungälvMullsjöLerumG öteborgUlricehamnAneby YdreVästervikÖckeröBollebygdPartilleBoråsJ önköpingHärrydaVimmerbyMölndalEksjöT ranemoNässjöKungsbackaMarkVaggerydGotlandVarbergF alkenbergBåstadHalmstadT orsbySunneS venljungaLaholmG islavedHylteÅreÄlvdalenMalung-SälenGnosjöMarkarydBergHagforsLjungbyHärjedalenVärnamoÄlmhultOsbyMoraKrokomVansbroSävsjöAlvestaOrsaLeksandGagnefVäxjöVetlandaT ingsrydÖstersundR ättvikBorlängeLesseboÄngelholm ÖrkelljungaOlofströmRonnebyHöganäsÖstra GöingePerstorpÅstorp HässleholmKarlshamnHelsingborgKlippanB romöllaBjuvSölvesborgHöörSvalövK ristianstadLandskronaEslövHörbyKävlingeLommaStaffans torpLundBurlövSjöboMalmöT omelillaSvedalaSimrishamnVellingeYstadT relleborg SkurupBräckeLjusdalSäterUppvidingeÅngeOvanåkerFalunHultsfredHögsbyKarlskronaHedemoraBollnäsLudvikaAvestaSmedjebackenNorbergLjusnarsberg F agersta SalaNybroEmmabodaT orsåsRagundaOskarshamnMönsteråsKalmarOckelboSandvikenHoforsSollefteåSundsvallNordanstigHudiksvallSöderhamnHebyBorgholmMörbylångaTimråHärnösandG ävle ÄlvkarlebyT ierpUppsalaÖrnsköldsvikKramforsÖsthammarNordmalingSVERIGEFINNAR Det finns 450 000–600 000 sverigefinnar i Sverige. Minoritetsspråketär finska. Många bor i Stockholm–Mälardalen. Kommuner som ingår idet finska förvaltningsområdet är:NykvarnS ödertäljeUpplands-BroUpplands VäsbyÖsteråkerTäbySollentunaJ ärfällaDanderyd VaxholmSundbybergEkerö Solna LidingöNackaStockholmSalemSigtunaB otkyrkaNynäshamnHuddingeV allentunaHaningeTyresöNorrtäljeV ärmdö


TjänsteskrivelseKommunstyrelsenDnrKS 2011/752013-02-11KommunkontoretTorbjörn UnnebäckTel. 0156-520 13torbjorn.unneback@trosa.seFördjupad analys och handlingsplan för en ökadsysselsättningsgrad bland kommunens medarbetareFörslag till beslutKommunstyrelsen föreslårkommunfullmäktige beslutaatt anta fördjupad analys och handlingsplan för en ökad sysselsättningsgradbland kommunens medarbetare.att inleda ett pilotprojekt under 2013 inom ett särskilt boende och LSS i syfte attuppnå en ökad sysselsättningsgrad.att ge KSau i uppdrag att följa upp och besluta om vidare åtgärder inom ramenför handlingsplanen.SammanfattningPersonalchefen har fått i uppdrag att göra en fördjupad analys och enhandlingsplan för att uppnå en ökad sysselsättningsgrad bland kommunensmedarbetare.I analysen framgår att det främst är inom vård- och omsorg som kommunen hardeltidsanställda. Inom denna verksamhet är ca 40 procent av personalenheltidsanställda. Analysen pekar också på att det finns många kommuner somhar misslyckats med satsningar för att uppnå en ökad sysselsättningsgrad ellerrätt till heltid. Med anledning av detta föreslås nu att Trosa kommun genomförett pilotprojekt under 2013 inom ett särskilt boende för att ta fram en eller fleraarbetstidsmodeller och arbetssätt som kan leda till att medarbetarna kanerbjudas en ökad sysselsättningsgrad.Johan SandlundKommunchefBilagaTorbjörn UnnebäckPersonalchef1. Fördjupad analys och en handlingsplan för en ökad sysselsättningsgrad blandkommunens medarbetare, 2013-02-05


Bilaga 1Fördjupad analys och handlingsplan för enökad sysselsättningsgrad bland kommunensmedarbetare2013-02-05Dokumentkategori: StyrdokumentDokumenttyp: Handlingsplan1(6)


Bilaga 1Fördjupad analysBakgrundDen fördjupade analysen ger en tillbakablick och beskriver hur verksamheternatidigare har arbetat med frågan om ökad sysselsättningsgrad. Skrivelsenbehandlar frågan ur flera perspektiv: ekonomi, jämställdhet, hälsa och brukare.Avslutningsvis ges en beskrivning av risker, möjligheter och förslag på hurkommunen kan få uppnå en ökad sysselsättningsgrad.Antalet tillsvidareanställda som har heltidsanställningar i Trosa kommun (bokslut2012):Vård och omsorgSkola/förskolaKultur, fritid, teknik och serviceÖvriga verksamheterca 40 procentca 75 procentca 60 procentca 85 procentPersonalenheten har under drygt tio års tid följt upp sysselsättningsgraden ikommunen och kan konstatera att sysselsättningsgraden varit förhållandevisoförändrad över tid. Inom förvaltningen pågår ett ständigt arbete, att genomgivna budgetramar, verka för en förbättrad och effektiv verksamhet medkundnyttan i fokus. Verksamheternas (brukarnas) behov av service styr oftavalet mellan att ha flera personer anställda på deltid jämfört med ett färre antalpersoner på heltid. Verksamheterna anser sig behöva påverka hur de anställeroch schemalägger sin personal och det ligger även i verksamheternas intresseatt kunna erbjuda attraktiva anställningar för att ha möjlighet att konkurrera omarbetskraft. I alla verksamheter och särskilt inom vård- och omsorg, sombedriver dygnetruntverksamheter, pågår ett ständigt arbete med att fåarbetstidsscheman att fungera. Lag och avtal ska följas och verksamheten skadrivas så att brukare och medarbetare är nöjda. I det kollektivavtal, AB -Allmänna bestämmelser, som arbetsgivaren är bunden till regleras deltidanställningarenligt följande ”Vid behov av arbetskraft ska det, innan nyanställningsker, prövas om arbetstagare som är anställd på arbetsstället och som anmältintresse ska erbjudas höjd sysselsättningsgrad.” Detta är något som alltid görsinnan tillsättning.NulägeÅr 2000 hade 62 procent av Trosa kommuns kvinnliga medarbetareheltidstjänster. Idag är denna siffra i stort sätt oförändrad eller något lägre. Setttill ett omvärldsperspektiv ligger Trosa kommun i paritet eller ibland något lägreän andra jämförbara kommuner. Inom Vård och omsorg är det ca 40 procentsom arbetar heltid och den andelen har varit tämligen konstant under de senastefem åren.2(6)


Bilaga 1Under våren 2012 gick personalenheten ut med förfrågningar till alla anställda föratt få en mer samlad bild av hur situationen såg ut. Utifrån undersökningen kankonstateras att det var totalt 32 medarbetare som ville ha ökadsysselsättningsgrad. Av dessa angav 18 medarbetare att de bara kan tänka sig attgå upp i sysselsättningsgrad om det sker inom den avdelning som man idagarbetar på. Endast 8 medarbetare sade dig vara beredda att gå upp isysselsättningsgrad om de blir tvungna att arbeta inom flera olika verksamheter.Av de 32 medarbetare som har visat intresse av ökad sysselsättningsgrad är det18 stycken som vill arbetare heltid och 14 stycken som vill jobba deltid mellan 75-90 procent. Samtidigt anger majoriteten av de svarande att de har dentjänstgöringsgrad som de finner önskvärd. Vid den senaste inventeringen visadedet sig att 70 % är nöjda med sin tjänstgöringsgrad och att de återstående 30 %önskar en utökning, dock ej alltid till heltid (många önskar arbeta ca 90 %).Frågan om låga sysselsättningsgrader berör således huvudsakligenverksamheten Vård och omsorg och det är också där som denna skrivelsehuvudsakligen har sitt fokus.EkonomiEn övergripande uppskattning av de ekonomiska konsekvenserna anger att enbruttoårskostnad skulle uppgå till ca 25-30 mkr om alla deltidsanställningar inomvård- och omsorg skulle omvandlas till heltidsanställningar. Eftersom det finnsbesparingsmöjligheter på sikt, genom minskat behov av timvikarier, lägre kostnaderför övertid, fyllnadstid och mindre tid för rekryteringsarbete och mindre tidför introduktion, så är den verkliga kostnaden väsentligt lägre än denna bruttokostnad.Erfarenheter från andra kommuner som har erbjudit heltidstjänster visar tydligtatt förändringar mot att alla tjänster ska vara heltidstjänster i grunden innebärökade ingångskostnader. Flera kommuner som har fattat beslut om heltider hardock på senare år fått göra avsteg från beslutet, då det har blivit för kostsamt.Vid uppföljning av eventuellt beslut i frågan bör därför de ekonomiskakonsekvenserna följas upp och jämföras utifrån kostnader för timavlönade samtkostnader för mertid och övertid. Likaså har andra kommuner rekommenderatatt hålla utbildning i bemanningsekonomi för chefer, arbetsgrupper och fackligaorganisationer vid införandet.Av ovanstående resonemang kan konstateras att ett brett införande av högresysselsättningsgrad är förknippat med stora risker, inte minst vad avserkostnader för berörda verksamheter. Erfarenheterna säger därför att det iställetär klokt att börja med några få arbetsgrupper i en pilotstudie och viaverksamhetsuppföljning och ekonomisk uppföljning dra lärdom inför ett bredareinförande av en höjd sysselsättningsgrad.3(6)


Bilaga 1JämställdhetDeltidsfrågan är ett exempel som tydligt belyser män och kvinnors olika villkorpå arbetsmarknaden. Det handlar i grunden om möjligheten att påverka sinarbetstid men också om makt och inflytande hos män och kvinnor generellt. Detär inom de kvinnodominerade verksamheterna som vi återfinner den högaandelen deltidsanställningar. Inom kommunerna ligger den på ca 60-70 %. Inomdetaljhandeln som också är en starkt kvinnodominerad bransch arbetar 50-60 %deltid. I offentliga verksamheter har införandet av flexibla arbetstidsmodellerskapat större möjlighet att kunna erbjuda deltidsanställda önskad arbetstid.Flexibla arbetstidsmodeller som utgår från verksamhetens behov och deanställdas individuella önskemål framhålls också som ett sätt att öka yrketsattraktivitet. Oavsett livsfas är olika arbetstidsmodeller en faktor som anses nogså viktigt inför de stora rekryteringsbehov som finns inom framför allt vården.HälsaDet finns begränsad forskning kring hälsoeffekter av att arbeta deltid kontra heltid.Resultaten av de olika studierna är dessutom delvis motstridiga. Vissastudier visar att det finns ett samband mellan hälsa och tjänstgöringsgrad. Dethar bl.a. visat sig att deltidsarbetande löper ökad risk för sjukfrånvaro jämförtmed heltidsarbetande. Bland annat kan det bero på att deltidsanställda fårsämre ekonomi, sämre tillfredsställelse i arbetet och en högre total arbetsbelastning(oavlönat arbete). Andra studier visar att deltidsarbetande har bättre hälsaän heltidsarbetande. Detta gäller dock främst för de som har jobb med dåligfysisk arbetsmiljö. En heltidsanställning, men framför allt en tillsvidareanställningskapar bättre förutsättning för stabilitet i tillvaron. Att överhuvud taget kunnapåverka sin schemaläggning är av stor betydelse. Ibland är det att ha rätten attjobba heltid och ibland är det möjligheten till att ha flexibilitet som upplevstillfredställande.Delaktighet är en viktig ingrediens i hälsofrämjande arbetsplatser. I Trosa har vien tradition på att ha ganska få arbetstidsmodeller. Genom att erbjuda fler olikaarbetstidsmodeller ges medarbetarna möjlighet att själva påverka sin arbetstidoch schemaläggning på ett tydligare sätt.Brukarperspektiv – Genom högre sysselsättningsgrad skulle våra vårdtagare intebehöva möta så många nya ansikten. Detta medför mer kontinuitet och högrekvalitet i verksamheten, vilket i sin tur bidrar till ökad trygghet för de boendeinom äldreboenden och gruppboenden. Personalen lär känna vårdtagaren ochhans/hennes specifika behov. Men en höjd sysselsättningsgrad utesluter inte atttimanställda och deltidsanställda behövs för att klara verksamheten.Arbetsgivarperspektiv – Genom att erbjuda högre sysselsättningsgrad bedömskommunen uppfattas som en ännu mer attraktiv arbetsgivare. Det kanunderlätta vid kommande rekryteringsbehov och även göra att det blir lättare attrekrytera män till dessa yrken.4(6)


Bilaga 1RiskerMånga kommuner har haft en hög ingångskostnad vilket inneburit attmålsättningen med att införa t.ex. heltidstjänster har bromsats eller avslutas.Det har tagit lång tid innan effekterna syns ekonomiskt, även om det samtidigthar inneburit färre timanställda och minskad mertid/övertid. Låg datormognadoch dåliga verksamhetssystem (datastöd) har försvårat införandet. Att ha såkallade delade turer och att arbeta på flera arbetsplatser har varit skäl till attmånga tackat nej till heltid. Vidare har flera kommuner underskattat att detkrävs nya arbetssätt, förändrade attityder hos medarbetare och chefer och attgamla strukturer behöver omprövas.Att få till en höjd sysselsättningsgrad är så mycket mer än schemaläggning. Höjdsysselsättningsgrad innebär att färre medarbetare ska dela på oattraktivaarbetstider, d.v.s. måste vara beredda att jobba fler helger och kvällar. Attbrukarna ska vara i centrum torde vara självklart och det finns risker att dennaaspekt tonas ned i dessa processer. Gamla strukturer visar dessutom att mångakvinnor fortfarande känner krav att anpassa sina arbetstider efter sin partner,vilket också påverkar möjligheterna att öka sin sysselsättningsgrad.MöjligheterEtt beslut om höjd sysselsättningsgrad bedöms kunna öka benägenheten atttänka i nya banor, förändra arbetssätt och utmana rådande strukturer, t.ex. omhur arbetsuppgifter ska utföras under dygnet och förändra invanda genusstrukturer.Det finns erfarenheter från många kommuner och hos befintligpersonal som kan nyttjas och Trosa kommun kan därmed dra fördel av andraserfarenheter. Exempel på kommuner som arbetat aktivt med arbetstidsfrågan ärPiteå, Luleå, Falun, Norrköping, Nynäshamn, Uddevalla, Hofors, och Marks. I vilkengrad de varit framgångsrika varierar dock.Ytterligare framgångsfaktorer är ett väl utvecklat samarbete med Kommunal,som har drivit frågan under många år. Att tidigt involvera chefer ocharbetsgrupper, ha en återkommande dialog på arbetsplatserna vid arbetsplatsträffaroch återkoppla frågan politiskt är viktiga delar i processen. För attytterligare stödja och intensifiera frågan om höjd sysselsättningsgrad kan manbörja med ett antal pilotgrupper för att identifiera framgångsfaktorer och riskerinnan man går vidare inom hela Vård och omsorg och övriga förvaltningar inomkommunen.Kommunen har redan ett schemaprogram (Besched) som planeringsinstrumentoch det vore önskvärt om medarbetarna kan nå det hemifrån. Detta underlättarflexibilitet och tillgänglighet för såväl medarbetare som chef, vilket även gagnarbrukaren. Kunskapen och erfarenheterna av fler arbetstidsmodellerna som finns ivårt närområde och torde vara en bra grund för att uppnå en höjdsysselsättningsgrad. Riktlinjer med vilken regelbundenhet man kan ändra sintjänstgöringsgrad måste tas fram, med en tydlighet för dem som vill antingensänka eller höja sin tjänstgöringsgrad. Medarbetarna måste vara beredda på attarbeta på flera enheter/arbetsställen.5(6)


Bilaga 1HandlingsplanFörslag till fortsatt processUtifrån ovanstående analys och erfarenheter av andra kommuner föreslåsföljande handlingsplan:Förslagsvis prioriteras arbetet inom vård och omsorg då de största vinsterna ochutmaningarna finns just där.Arbetet inleds med en pilotgrupp under våren. Pilotgruppen består av enpartgemensam arbetsgrupp bestående av en enhetschef inom särskilt boendeoch LSS, en eller ett par medarbetare och en facklig företrädare samt enrepresentant från personalenheten. Representanten från personalenheten blirprojektledare. Samtidigt inrättas en styrgrupp bestående av vård- ochomsorgschef/ äldreomsorgschef, kommunchef och personalchef.Återkoppling av arbetet redovisas under året till KSau som därefter fattar beslutom vidare åtgärder.6(6)


TjänsteskrivelseKommunstyrelsenDnr KS 2012/1072013-02-06KommunkontoretJakob EtaatTel. 0156-520 06Fax. 0156-520 17Jakob.etaat@trosa.seRevidering av arvodes- och ersättningsreglemente förkommunalt förtroendevalda i Trosa kommunFörslag till beslutKommunstyrelsen beslutar föreslåKommunfullmäktige beslutaatt godkänna förslag till arvodes- och ersättningsreglemente för kommunaltförtroendevalda i Trosa kommun, daterat 2013-02-06.att reviderat arvodes- och ersättningsreglemente träder i kraft från och med1 april år 2013._________SammanfattningKommunfullmäktige ansvarar enligt Kommunallagen för att fastställa arvodenoch ersättningar för kommunens förtroendevalda. Efter genomlysning av nugällande arvodes- och ersättningsreglemente (antaget av fullmäktige2011-04-06, § 16, bilaga reviderad 2012-12-05, § 99) föreslås ändringar ireglementet avseende begäran om ersättning för förlorad arbetsinkomst.ÄrendetKommunfullmäktige beslutade 2012-12-05, § 99 att anta reviderad bilaga tillarvodes- och ersättningsreglemente, avseende årsarvoden och begränsadeårsarvoden för förtroendevalda i Trosa kommun. Vid sammanträdestillfälletbeslutade fullmäktige även att återremittera förslag till ändrat arvodes- ochersättningsreglemente för vidare beredning.1


Förändring avseende begäran om ersättning för förlorad arbetsinkomst (§ 1, 3, 11, 15)Föreliggande förslag rör förändringar avseende begäran om ersättning förförlorad arbetsinkomst. Ersättning för förlorad arbetsinkomst föreslås som idagutbetalas till anställda efter uppgift om arbetsinkomst från arbetsgivaren, samttill egenföretagare efter redovisning av slutskattsedel eller intyg frånFörsäkringskassan.För att likställa ersättningen för anställda med de för egenföretagare föreslås attårsinkomst för egenföretagares och fria yrkesutövare, i likhet med för anställda,omvandlas till timlön via omräkning genom sysselsättningsgrad.Ersättning för förlorad arbetsinkomst fastställs i likhet med nuvarandereglemente till max 0,45 % av riksdagsmannaarvodet per timme och tillmax 3,6 % av riksdagsmannaarvodet per dag. (Riksdagsmannaarvodet ärfastställt till 58 300 kronor för år 2013.)Intyg/ begäran om förlorad arbetsinkomst lämnas som idag vid varje enskilttillfälle då ersättning begärs. En förenkling blir dock att intyget/ begäran endastbehöver innehålla uppgift om hur många timmar som förlorats i arbetstid.Uppgift om inkomst och sysselsättningsgrad, samt om datum och tid för förloradarbetsinkomst, redovisas genom kommunens särskilda blanketter.Johan SandlundKommunchefJakob EtaatKanslichefBilagor1. Förslag till arvodes- och ersättningsreglemente för kommunaltförtroendevalda i Trosa kommun, 2013-02-06Beslut tillKommunfullmäktige2


Arvodes- och ersättningsreglementeför kommunalt förtroendevalda i Trosa kommun(Förslag 2013-02-06)(Tillkommande text är markerad med understrykning. Utgående text är markerad medgenomstyrkning.)


2Giltighetstid§ 1Dessa bestämmelser gäller från och med 2011-01-01 20xx-xx-xxTillämpningsområde§ 2Dessa bestämmelser gäller för förtroendevalda som avses i 4 kap 1 § kommunallagen(1991:900) dvs. ledamöter och ersättare i fullmäktige, nämnder ochfullmäktigeberedningar samt revisorer. Dessutom gäller bestämmelserna för ledamöteroch ersättare i beredningar och utskott som tillsätts i kommunstyrelsen och i kommunensövriga nämnder.Ersättningsformer§ 3Ersättning kan utgå såsom årsarvode, begränsat årsarvode, sammanträdesarvode ochförrättningsarvode. För dessa ersättningsformer beräknas semesterersättning ingå.Vidare kan ersättning utgå för rese- och traktamentskostnader, för styrkt förloradarbetsförtjänst inkomst, för styrkt förlorad semester, för styrkt förlorad pensionsförmånoch för styrkta speciella kostnader.Ersättningarnas storlek§ 4Arvodes- och ersättningsbeloppen utgår från procent av riksdagsmannaarvodet per 1januari. Årsarvodenas och de begränsade årsarvodenas omfattning avriksdagsmannaarvodet fastställs särskilt av kommunfullmäktige.Ersättningsberättigade sammanträden§ 5Tjänstgörande ledamöter, närvarande ersättare och andra förtroendevalda, sommedgivits medverka, har rätt till ersättning för följande sammanträdena) sammanträden med kommunfullmäktige, kommunstyrelsen och övriga nämnder,nämnds- eller fullmäktigeutskott/beredningar samt revisorernas sammanträden,b) sammankomster med kommunalt samrådsorgan/intressesammansatt organMed sammanträde avses i dessa bestämmelser sammanträde med de organ som angettsi § 2, där skriftlig kallelse utgått och där protokollföringsskyldighet föreligger enligtkommunallagen. För revisorernas sammanträden godkänns även minnesanteckningar.


3Ersättningsberättigade förrättningar§ 6Förtroendevald har rätt till ersättning vid förrättning som förtroendevald blivit kallad till.Med förrättning avses i dessa bestämmelser deltagande i:a) Presidemöten.b) Förhandling eller förberedelser för förhandling med personalorganisation ellerannan motpart till kommunenc) Överläggning med företrädare för annat kommunalt organ än det denförtroendevalde själv tillhör.d) Besiktning eller inspektion.e) Överläggning med utomstående myndighet, organisation eller företag.f) Konferens, informationsmöte, studiebesök, kurs eller liknande, som rör kommunalangelägenhet och som har ett direkt samband med det kommunalaförtroendeuppdraget.Förrättning som avser konferenser, informationsmöten, kurser och studiebesök underdenna paragraf ska i förväg godkännas av ordförande.Förtroendeuppdrag§ 7Hel- och deltidsengagerad förtroendevaldHel- och deltidsengagerad förtroendevald har rätt till årsarvode med belopp somkommunfullmäktige beslutar, se bilaga.Som heltidsengagerad enligt detta reglemente avses kommunalråd, oppositionsråd ochden som uppbär ett årsarvode uppgående till minst 80 % av riksdagsmannaarvodetSom deltidsengagerad enligt detta reglemente avses den som uppbär ett årsarvodeuppgående till minst 36 % men inte till 80 % av riksdagsmannaarvodet.För hel- och deltidsengagerad gäller även- fullmäktiges särskilda beslut om pension för hel- och deltidsengagerade- resekostnadsersättning och traktamente, § 10 detta reglemente- sociala förmåner i form av GLF (grupplivförsäkring) och TFA-KL(arbetsskadeförsäkring)Förtroendevald med rätt till begränsat årsarvodeBegränsat årsarvode utgår till förtroendevald enligt av kommunfullmäktige särskilt fattatbeslut, se bilaga. Med begränsat årsarvode avses arvode som är lägre än 36 % avriksdagsmannaarvodet.Förtroendevald som uppbär begränsat årsarvode för flera uppdrag i styrelser ochnämnder skall summera dessa arvoden. Om summan av arvodena motsvarar årsarvode,skall den förtroendevalde hos kommunfullmäktige begära att bli betraktad somförtroendevald med årsarvode.För förtroendevald med rätt till begränsat årsarvode gäller även- sammanträdesarvode § 8 (gäller ej överförmyndare)


4- förrättningsarvode § 9 (för överförmyndare endast vid kurser och konferenser)- resekostnadsersättning och traktamente § 10- förlorad arbetsinkomst § 11- förlorad pensionsförmån § 12- förlorad semesterförmån § 13- sociala förmåner i form av TFA-KL (arbetsskadeförsäkring)Förtroendevald ledamot/ersättare i kommunfullmäktige, styrelse, nämndErsättning utgår enligt följande- sammanträdesarvode § 8- förrättningsarvode § 9- resekostnadsersättning och traktamente § 10- förlorad arbetsinkomst § 11- förlorad pensionsförmån § 12- förlorad semesterförmån § 13- sociala förmåner TFA-KL (arbetsskadeförsäkring)Sammanträdesarvoden§ 8a) GenerelltSammanträdesarvoden utgår som timarvoden.b) TimarvodeSammanträdesarvode per timma uppgår till 0,44 % av ett riksdagsmannaarvode.Lägsta sammanträdesarvode motsvarar 2 timmars arvode, dvs. 0,88 % av ettriksdagsmannaarvode. Efter de första två timmarna utgår för varje därefter påbörjadhalvtimme arvode med 0,22 % av ett riksdagsmannaarvodec) SammanläggningVid beräkning av sammanträdesarvoden skall ersättningsberättigade sammanträdenmed skilda organ räknas som ett sammanträde om det senaste sammanträdetpåbörjas inom 2 timmarFörrättningsarvode§ 9a) FörrättningsarvodeFörrättningsarvode utgår som timarvode.b) TimarvodeFörrättningsarvode per timme uppgår till 0,30 % av ett riksdagsmannaarvode. Lägstaförrättningsarvode motsvarar två timmars arvode dvs. 0,60 % av ettriksdagsmannaarvode. Efter de två första timmarna utgår för varje därefter påbörjadhalvtimme arvode med 0,15 % av ett riksdagsmannaarvode.


5c) ArvodestidArvodestiden är maximerad till 10 timmar per dag vid endagsförrättning och till 8timmar per dag vid flerdygnsförrättning.För tid mellan klockan 00.00 och 06.00 utgår ej arvode. Gäller ej valnämnden vid valnattResekostnadsersättning och traktamente§ 10Inom kommunenResekostnadsersättning i samband med sammanträde eller förrättning utgår endast ommerkostnader uppstått jämfört med ordinarie dagliga resor. Ersättning utgår för billigasteresa med buss, tåg eller bil. För resa med bil utgår ersättning om resan överstiger 5 kmenkel resa från bostaden eller från den ordinarie arbetsplatsen. Maximal färdväg enkelresa som ersätts är 100 km. Ersättningen utgår enligt Riksskatteverkets anvisningar förskattefri ersättning. Sådan ersättning utgår även för justeringssammanträden omsärskild tid och plats beslutas för detta.Utom kommunenResekostnadsersättning och traktamenten i samband med sammanträde eller förrättningutbetalas enligt det kommunala reseavtalet.Ersättning för förlorad arbetsinkomst m mFörlorad arbetsinkomst§ 11Förtroendevald har rätt till ersättning för förlorad arbetsinkomst baserat på aktuelltimlön, styrkt av arbetsgivaren. Ersättning för förlorad arbetsinkomst vid varje tillfälle avarbetsgivare eller dess representant styrkt förlorad arbetsinkomst. Sådan ersättning ärmaximerad till 0,45 % av riksdagsmannaarvodet per timme och får per dag ej överstiga3,6 % av riksdagsmannaarvodet.Förtroendevald som är egenföretagare eller fri yrkesutövare intygar egen timlön, samtstyrker denna genom intyg från Försäkringskassan alternativt senaste slutskattsedeln.kan visa att en arbetsinkomst förlorats men inte till vilket belopp har rätt tillschablonersättning beräknad på grundval av den senaste slutskattsedeln omräknat itimlön enligt följande:Årsinkomst / (12mån*165timmar).Yrkande om ersättning för förlorad arbetsinkomst ska på särskild blankett styrkas/intygas för varje tillfälle då ersättning begärts.Yrkandena skall framställas senast inom 1 år från dagen för sammanträde ellermotsvarande till vilken förlusten hänför sig.


6Förlorad pensionsförmån§ 12Fr o m 2007-01-01 har förtroendevald rätt till ersättning för styrkt förloradpensionsförmån. Ersättningen utgör 4 % fram t o m 2010-12-31 och fr o m 2011-01-014,5 % av den sammanlagda ersättningen för förlorad arbetsinkomst som denförtroendevalde erhåller. Ersättningen utbetalas direkt till förtroendevald i samband medutbetalning av förlorad arbetsinkomst. För att ersättningen ska utbetalas krävs intyg somstyrker vilket pensionsavtal den förtroendevalda omfattas av i sin anställning. Detta kanlämpligen göras vid första tillfället på året som den förtroendevalde begär ersättning förförlorad arbetsinkomst.Genom utbetalning av ersättningen har kommunen fullgjort sin lagliga skyldighet attersätta den förtroendevalde för förlorad pensionsförmån.Förtroendevald som bedriver aktiv egen näringsverksamhet utan att inneha anställningoch som kan styrka att pensionsförmån har förlorats har rätt till ersättning för förloradpensionsförmån med verifierat belopp.För förlorad pensionsförmån fram tom 2006-12-31 gäller vid samma tidpunkt gällandearvodesreglemente § 12 ”Förtroendevald har rätt att hos kommunfullmäktige yrkaersättning för styrkt förlorad pensionsförmån. Kommunfullmäktige äger rätt att beslutaom ersättning i varje enskilt fall. Anspråk på ersättning skall inlämnas tillnämndens/styrelsens sekreterare senast ett år efter det kalenderår som ersättningenavser.”, och § 15 tredje stycket ”Yrkande om ersättning för förlorad pensionsförmån skallframställas senast inom två år från pensionstillfället.”Förlorad semesterförmån§ 13Förtroendevald, som på grund av uppdrag åt Trosa kommun gått miste om betaldsemesterdag/semesterersättning har rätt till ersättning för detta.Yrkanden om ersättning för förlorad semesterförmån skall styrkas av arbetsgivare ellerdess representant och framställas senast året efter det förlusten uppkommit. Intyg somstyrker förlorad semesterförmån inlämnas årsvis till kommunstyrelsens kansli.Ersättning för speciella kostnader§ 14För andra kostnader som orsakats av uppdraget än de som anges ovan utgår ersättningom den förtroendevalde kan visa att det finns särskilda skäl för dessa.Sådana kostnader är t ex:Ersättning för uppkomna extrakostnader för vård och tillsyn av barn, som vårdas i denförtroendevaldes familj och som under kalenderåret inte fyller 12 år.Ersättning för vård och tillsyn av funktionshindrad person, som vistas i denförtroendevaldes bostad, utgår ersättning för kostnad som föranletts av uppdraget.


7Ersättning till funktionshindrad förtroendevald för de särskilda kostnader som föranlettsav uppdraget, t ex resor, ledsagare, hjälp med inläsning av handlingar.Ersättningskrav enligt denna paragraf skall prövas av ordförande i styrelse/nämnd.Yrkanden om ersättningar enligt dessa bestämmelser skall framställas senast inom ett årfrån dagen för sammanträdet eller motsvarande till vilken kostnaden hänför sig.Gemensamma bestämmelserGemensamma bestämmelser för ersättning§ 15Sekreteraren i respektive kommunalt organ skall upprätta förteckning över närvarandeledamöter och ersättare som grund för utbetalning av arvoden.Ledamöter och ersättare skall före sammanträdets slut till respektive sekreterare lämnauppgift om resekostnadsanspråk, intyg som styrker anspråk om förlorad arbetsförtjänstinkomst mm som grund för utbetalning av ersättning.Uppgifter om sammanträdes/förrättningsersättning skall av respektive sekreterarelämnas till lönekontoret på särskild blankett och attesteras av styrelsen/nämndensordförande.Övriga ersättningar enligt dessa bestämmelser utbetalas efter på särskild blankettupprättad räkning från den förtroendevalde. Räkningen skall attesteras av respektivefullmäktige/styrelse/nämnds ordförande.Utbetalning§ 16Årsarvoden och begränsade årsarvoden, utbetalas utan föregående anmälan, månadsvismed en tolftedel per månad.Utbetalning av övriga ersättningar och arvoden sker månaden efter rapportering.Särskilda bestämmelserEkonomiska förmåners upphörande§ 17Rätten till ekonomiska förmåner upphör när förtroendeuppdraget upphör. Det sker närden förtroendevalde upphör att vara valbar eller när fullmäktige befriar en förtroendevaldsom önskar avgå från uppdraget eller när kommunfullmäktige skiljer en ledamot frånuppdraget.


8Nämnd och respektive ordförandes ansvar§ 18Vid antagandet av varje års budget ska respektive nämnd i sin budget besluta omsärskilt belopp för sammanträdeskostnader. Ordföranden har sedan ansvar för att eftersamråd med presidiet i övrigt hålla nämndens sammanträdesbudget.Tolkning av bestämmelser mmTolkningsfrågor§ 19Arvodeskommittén bereder ärenden om antagande av nytt reglemente respektiveändringar i befintligt reglemente. Frågor om tolkning och tillämpning av bestämmelsernaavgörs av arvodeskommitténs presidium. Avgörandena ska dokumenteras.Arvoden och ersättningar för representanter i externa organ§ 20Förtroendevalda som av kommunfullmäktige utsetts som representanter i externa organhar rätt till arvode och ersättningar för protokollförda sammanträden i dessa organ.Regeln gäller dock inte om arvoden och ersättningar utgår direkt från det externaorganet till representanten från Trosa kommun.Ersättningar samt arvoden för deltagande i förrättningar inom externt organ utgår endastom dessa godkänts på förhand av kommunstyrelsens ordförande.


9Bilaga: Procent av riksdagsmannaarvodet för förtroendevalda med årsarvoden ochbegränsade årsarvoden samt gruppledararvoden.Arvodesbilaga, årsarvoden och begränsade årsarvodenKommunfullmäktigeOrdförande 10%1:e vice ordf. 3%2:e vice ordf. 3%KommunstyrelsenOrdförande 120%1:e vice ordf. 30%2:e vice ordf. 95%Ordförande Ksplan 10%Vice ordf. 5%Ordförande KSeko 15%Vice ordf. 5%Humanistiska nämndenOrdförande 40%1:e vice ordf. 10%2:e vice ordf. 10%Ordf. IFO 10%Vice ordf. 5%Kultur- och fritidsnämndenOrdförande 20%Vice ordf. 8%Vård- och omsorgsnämndenOrdförande 35%Vice ordf. 10%SamhällsbyggnadsnämndenOrdförande 35%Vice ordf. 15%


10Teknik- och servicenämndenOrdförande 25%Vice ordf. 10%MiljönämndenOrdförande 20%Vice ordf. 8%Överförmyndaren 10%RevisorernaOrdförande 10%Vice ordf. 5%TroboOrdförande 20%Vice ordf. 10%


TjänsteskrivelseKommunstyrelsenDnr KS 2013/12013-02-20KanslienhetenLotta UddbergTel. 0156-520 58lotta.uddberg@trosa.seAnmälan av delegationsbeslutFörslag till beslutKommunstyrelsen beslutaratt lägga anmälningarna till handlingarnaAnmälningar1. Ekonomichefen (dnr KS 2012/4)- 3.6, Avskrivning av fordranLöpnr: 23/122. Ekonomichefen (dnr KS 2013/5)- 3.6, Avskrivning av fordranLöpnr: 1-2/133. Ekonomichefen (dnr KS 2013/5)- 3.5, Utse attesträttsinnehavareLöpnr: 2/134. Kanslichefen (KS 2012/135)- 1.12, Beslut att inte yttra sig över remissen av promemoria ang.myndigheters tillgång till tjänster för elektronisk identifiering.4. Kommunchefen (dnr KS 2012/3)- 2.2, Beslut om tillfälligt förordnande av samhällsbyggnadschef2013-01-28 – 2013-07-31, Björn WieslanderLotta UddbergNämndassistent


TjänsteskrivelseKommunstyrelsenDnr KS2013/22013-02-20KanslienhetenLotta UddbergTel. 0156-520 58lotta.uddberg@trosa.seAnmälningsärenden till kommunstyrelsenFörslag till beslutKommunstyrelsen beslutaratt lägga anmälningarna till handlingarna____________Anmälningsärenden1. Kommunstyrelsen (KS 2013/9)- Konsumentstatistik 2012 för Trosa kommun2. Kommunstyrelsen (KS 2012/132)- Överlåtelsehandling av material från Myndighetenför samhällsskydd och beredskap3. Regionförbundet Sörmland- Delårsrapport januari – augusti 2012- Kallelse till regionstyrelsen 2012-12-06- Verksamhetsplan och budget för 20134. Transport & Trafik, nyhetsbrev nr 145. Sveriges Kommuner och Landsting- Överenskommelse mellan staten och SKL om stöd till riktade insatserinom området psykisk ohälsa 2013- Överenskommelse för 2013 mellan staten och SKL om stöd tillevidensbaserad praktik för god kvalitet inom socialtjänsten- Överenskommelse mellan staten och SKL om sammanhållen vård ochomsorg om de mest sjuka äldre 2012- Verksamhetsplan och budget 20136. Samordningsförbundet RAR- Protokoll 2012-11-297. Nämnd för vård, omsorg och hjälpmedel- Missiv, kompetenskrav för förskrivare för inkontinenshjälpmedelLotta UddbergNämndassistent

More magazines by this user
Similar magazines