LUM nr 9 - 24 oktober (PDF 1,3 MB - Nytt fönster) - Humanekologi ...

www4.lu.se
  • No tags were found...

LUM nr 9 - 24 oktober (PDF 1,3 MB - Nytt fönster) - Humanekologi ...

LUNDSUNIVERSITETMEDDELAR----------------NUMMER 9OKT 2003ÅRGÅNG 36ProfessornLU får ettåttondeområdesom blevdoktorand”Manligsvågerpolitikstoppar kvinnorna”I


L UNDS UNIVERSITETMEDDELAR-------------------------------InnehållLunds universitets tidskrift LUM utkom förstagången 1968. Den når i dag samtliga anställda ochnästan lika många utanför universitetet. LUM har enupplaga på 12.400 ex och utkommer med 11 nr per år.LUM erhöll 1999 och 2001 hedersomnämnanden itävlingen Sveriges bästa personaltidning.Adress: LUMInformationsenheten Lunds universitetBox 117, 221 00 LundFax: 046-222 47 11Internpost: Hs 31E-post: LUM@info.lu.seIXLUM på nätet: www.lu.se/info/lum/Lum.htmlRedaktion:Maria Lindh, t f redaktör och layout insidor046-222 95 24, Maria.Lindh@info.lu.seChrister Hjort, ansvarig utgivare046-222 70 08, Christer.Hjort@info.lu.seIngela Björck, forskningsjournalist046-222 76 46, Ingela.Bjorck@info.lu.seBritta Collberg, journalist046-222 31 58, Britta.Collberg@info.lu.sePetra Francke, journalist och layout färgsidor046-222 03 16, Petra.Francke@info.lu.seGöran Frankel, forskningsjournalistnaturvetenskap,046-222 94 58, Goran.Frankel@info.lu.seUlrika Oredsson, journalist046-222 70 28, Ulrika.Oredsson@info.lu.seSolveig Ståhl, forskningsjournalist046-222 70 16, Solveig.Stahl@info.lu.seAnnonser:tomat annonsbyrå, tel 046-13 74 00/02www.tomat.sefax 046-5400150e-post PC: info@tomat.see-post Mac: material@tomat.sePrenumerationer, notiser, meddelanden:Eva Mattisson: 046-222 70 10e-post: Eva.Mattisson@info.lu.seAnställda vid LU får LUM gratis.Enskilda abonnenter – 190 kr/11 nr. Inbetalas påpostgirokonto 15650-5 med angivande av”Prenumerationsavgift för LUM” samt namn & adress.Adressändring:Anställda anmäler ändringar till katalogansvariga vidinstitutionen (motsv). Övriga skickar ändringsuppgiftertill LUM, gamla adressrutan bifogas.Tryck: Wallin & Dalholm Boktryckeri AB, LundNästa LUM: 21 nov. Manusstopp: 10 nov.ISSN: 0345-7354Omslag: Tonsättaren Hans Gefors.Foto: Kennet Ruona.III För tidigt uteIdag kan man rädda foster från att deär 22 veckor gamla. Men är det i allalägen meningsfullt att hålla liv demycket för tidigt födda barnen? Ochvilken framtid väntar dem? Det är frågorsom professorerna Karin Stjernqvistoch Vineta Fellman arbetar med.VI Splittrade cheferDagens chefer får allt högre krav på sigatt vara skickliga på att skapa kontakterutåt och bygga nätverk. Det gårdock ofta ut över medarbetarna, somges allt mindre tid. Det kan vara en orsaktill de många sjukskrivningarna,spekulerar den nyblivna doktorn BirgittaAhltorpXIVXIIX Bakvänd karriärHans Gefors hör till landets främstaoperakompositörer och har tretton årbakom sig som professor på Musikhögskolani Malmö. Nu vill han fördjupaförståelsen för musikdramaturgioch har blivit en av de första konstnärligadoktoranderna vid LU.XI Drömmar om böckerFör ett år sedan startades en författarskolavid LU. Här har alla studentersamma dröm om att skriva och blipublicerade, och gemenskapen har blivitstarkare än vad den vanligtvis blirpå universitetskurser.XIV Historiska klimatstudierI februari landsteg en grupp kvartärgeologerfrån Lund på Tristan da Cunhai Sydatlanten och började ta uppborrkärnor ur marken. Tanken är attman från dessa ska kunna bilda sig enuppfattning om klimatförändringarnai Atlanten de senaste 10 000–20 000åren.XVI Hallå Gun Malmgren……nyinstallerad litteraturprofessor somhöll installationsföreläsningen om mötetmellan text och läsare.II


▲”Barn och handikapp” är temat för årets Forskningens Dag, som ordnas av Medicinskafakulteten den 3 november i Lund och den 4 november i Malmö. Temat täcker detmesta från graviditetsövervakning till behandling av hjärtfel, tal- och språkstörningar,CP-skador och olika sjukdomar.Vineta Fellman och Karin Stjernqvist deltar båda vid Forskningens Dag, och berättarhär om sitt forskningsområde: vården och uppföljningen av för tidigt födda barn.Hur blir framtiden förfågelbarnen?Vi har säkert alla sett dem på bild: de små rödavarelserna, som ligger med mössa på huvudet ikuvösen, omstoppade som fågelungar i ett bo.Men hur går det sedan för desa barn som inteväger stort mer än ett mjölkpaket när de kommertill världen?Vården av mycket för tidigt födda barn väckermånga frågor. Här möts liv och död vid en gränssom blir allt tunnare. Foster under 20 graviditetsveckorfår aborteras, men foster över 23 veckorkan idag räddas till livet.De mest omogna nyfödda får dock ofta skadorav olika slag, och här är en annan gräns som läkarnatvingas dra. Vid vilken grad av skador bör manavstå från eller avbryta den intensivvård utan vilkendet mycket för tidigt födda barnet inte klarar sig?40 veckor är den normala längden för en graviditet.Barn som kommer till världen före 37veckor räknas som för tidigt födda, och de somföds före 27 veckor eller väger under 1000 gramkallas extremt för tidigt födda. I Sverige födsungefär 200 levande sådana barn per år.Barn som lämnar moderlivet i förtid hamnarofta i kuvös och övervakas med en mängd medicinskapparatur. Men det innebär inte att derasmiljö måste vara helt steril, kall och fri frånmänsklig kontakt. När LUM besökte Universitetssjukhusetsnyföddhetsavdelning låg det tresmå knyten i ett rum med var sin vuxen bredvidsig – två mammor och en personal. De små varinsvepta i pastellfärgade filtar, hade napp iVineta Fellman tilsammans medSusanna Magnusson och henneslille son Felix, 1500 gram stor.III


▲Karin Stjernqvist arbetarbl a med att följa uppde för tidigt föddabarnens utveckling.FOTO: INGELA BJÖRCK.”Det är ingetlätt beslut. Åena sidan villvi rädda liv,men å andrasidan bör detvara ett gottliv.”munnen och höll sina miniatyrfingrar fast slutnaom varsitt vuxet finger.– Man får lov att vara här så mycket man vill, såjag sitter här hela dagarna, förklarar Susanna Magnussonmed en kärleksfull blick på sin lille son Felix,1500 gram stor. Hon har stuckit in handen genomen öppning i Felix’ kuvös, en plastlåda omhöljdav ett bomullstäcke som avskärmar ljud och ljus.Vården av de för tidigt födda i Lund är enblandning av högteknologi och mjuk omvårdnad.Man övervakar barnens tillstånd med olika apparatermen försöker störa dem så lite som möjligt,bl a genom att samla nödvändiga åtgärder somvägning och blöjbyte till samma tillfälle. Man försökerockså anpassa vården till barnens individuellamognad, som kan skilja sig åt även hos jämngamlabarn.– Arbetet sker enligt en amerikansk metod sommin forskargrupp fört in till Sverige. Den byggerpå noggranna observationer av barnen enligt ettvisst schema, förklarar professorn i psykologiKarin Stjernqvist, som specialiserat sig på för tidigtfödda barn.Små signalerObservationerna gäller t ex om barnet är avslappnatoch behåller sin balans eller verkar spänna sigunder en vägning. Små signaler som oroliga rörelsereller ansträngd andning är tecken på att vårdarnamåste anstränga sig ännu mer för att minskaallt som kan störa eller överstimulera barnet.Mycket för tidigt födda barn behöver hjälpmed andningen, eftersom deras lungor inte är tillräckligtutvecklade. Det sker i Lund så långtmöjligt med övertryck i stället för med respirator.De tre små knytena på Universitetssjukhuset haralla en sorts propp i näsan, ansluten till en maskinsom skapar övertryck i luftvägarna för att underlättaandningen.God vård och modern teknologi kan ändå intehelt ta bort riskerna med en för tidig födsel, framförallt om barnet fötts extremt för tidigt. Av barnfödda mellan vecka 22 och 25 klarar sig ungefärhälften bra, men runt 25 procent får lindriga handikappoch 25 procent drabbas av svåra skadorsom cerebral pares, kroniska lungsjukdomar, utvecklingsstörningeller näthinneskador.Ändå måste, enligt läkaretiken, utgångspunktenalltid vara att rädda barnens liv.– Varje barn som föds har rätt att få andningsstödom det har omogna lungor. Om det sedanvisar sig att barnet är alldeles för omoget och harför många komplikationer, så avbryter vi andningsstödet,säger Vineta Fellman, professor ineonatologi, nyföddhetsvård.– Det är inget lätt beslut. Å ena sidan vill virädda liv, men å andra sidan bör det vara ett gottliv. Vi vill inte påverka en hel familjs framtid genomatt ge den ansvar för ett flerhandikappatbarn med obotliga, svåra skador.Detta dilemma lär vara här för att stanna. Attsätta gränsen för intensivvård vid t ex 25 graviditetsveckorär ingen lösning, eftersom det innebäratt döma ut de yngre barn som faktiskt skullekunnat klara sig utan skador. Och även om mannumera med läkemedel skulle kunna hejda förtidig spontan förlossning, så finns det alltid fostersom av olika skäl växer så dåligt i livmodernatt de måste tas ut i förtid med kejsarsnitt.– Det vi i varje fall kan slå fast är att arbetetmed extremt för tidigt födda barn grundar sig påhänsyn till barnen och familjen. Det är inte frågaom någon sorts medicinsk tävling efter rekord itidig överlevnad, understryker Vineta Fellman.Födelsens mirakelHon arbetar inte bara med de för tidigt föddautan som nyföddhetsläkare i allmänhet, och haraldrig upphört att fascineras av födelsens mirakel.– Det är egentligen häpnadsväckande att det iregel går precis som det ska i fosterlivet! Jag kännerdet som ett privilegium att få göra den förstaoch kanske viktigaste läkarundersökningen i enmänniskas liv, och få berätta för föräldrarna hurdet står till med deras nya lilla barn.Även Karin Stjernqvist är entusiastisk över sittarbete. Hon var klinisk psykolog inom primärvårdennär hon på 80-talet hamnade på sjukhusetsnyföddhetsavdelning.– Det var det bästa som kunde hända. Jagstortrivdes från första början! säger hon och berättarom hur hon följde sköterskor och läkare ihälarna, var med på natten och själv lärde sig atthandskas med de extremt för tidigt födda småliven. Sedan dess har hennes kliniska arbete ochhennes forskning handlat om för tidigt föddabarn: om vårdmetoder, om barnens utvecklingoch om stöd till föräldrarna.I Lund har man satsat på att stödja de mycketför tidigt födda barnens föräldrar, som lätthamnar i en kaotisk situation. Släktingar ringeroch frågar, det blir trassel med arbetet som manju inte tänkt ta ledigt från så tidigt, det nyföddabarnets oroliga syskon måste tas om hand, ochså vill man ju vara med på sjukhuset fast detIV


kanske känns både främmande och skrämmande.För kvinnorna kan en för tidig födsel ocksåmedföra känslor av både skuld och skam.– Vi är ju biologiska varelser, och fortplantningär den viktigaste uppgiften för allt liv. Därför ärdriften att få barn så djupt rotad även hos ossmoderna människor, menar Karin Stjernqvist.– En kvinna som fött barn mycket för tidigtkänner det ofta som ett misslyckande: Varförhände detta? Gjorde jag något fel? Var min kroppinte ett gott hem för mitt lilla barn?Leendet dröjerTill dessa bekymmer kommer det mycket lilla barnetsbrist på signaler. En fullgången baby visar oftasttydligt med minspel, ljud och rörelser vad haneller hon tycker om omvärlden. Ett för tidigt föttbarn däremot ger mycket svagare signaler – det kandröja fem-sex månader innan föräldrarna får detefterlängtade första svarsleendet. Därför är det såviktigt att föräldrarna kan få dels stödsamtal, delsträning i att lära sig tolka sitt barns nästan osynligatecken på välmående eller missnöje.Karin Stjernqvist har också arbetat med att följaupp de för tidigt födda barnens utveckling. Även desom inte har någon klar utvecklingsstörning visar sigligga lite efter jämnåriga som fötts i normal tid. 9av 10 barn som fötts efter i genomsnitt 27 graviditetsveckorvar vid 10 års ålder fria från störrefunktionsnedsättningar, men låg på en 8-åringsnivå i vissa test. De hade också både större skolsvårigheteroch större risk för beteendeproblem.Forskargruppen ska nu följa upp barnen somidag är 18 år gamla för att undersöka om skillnadernakvarstår i vuxen ålder. En annan fråga ärförstås hur skillnaderna blir för 2003 års barn.Dagens för tidigt födda barn får ju en mildare ochmer genomtänkt omvårdnad än den grupp barnsom studerades som 10-åringar – kan det hjälpaderas framtida psykiska utveckling?Karin Stjernqvist tror dock att vissa skillnaderinte går att helt komma ifrån. De sinnesintryck ettfoster mottar dämpas av livmoderväggen och fos-tervattnet, medan för tidigt födda barn måsteutsättas för både ljus och ljud, smärta (vid t exblodprov) och beröring, hur försiktig vården änär. Detta borde påverka hjärnans utveckling, somär i full gång under den här perioden.Karin Stjernqvist jämför nu i ett samarbetemed professorn i neurofysiologi Ingmar Rosénhjärnans elektriska signaler hos för tidigt föddarespektive fullgångna barn vid tre, sex och niomånaders ålder. Om det är tekniskt möjligt, såskulle hon sedan vilja jämföra samma mönsterhos för tidigt födda barn och hos jämnåriga fosterinuti livmodern.Finns det skillnader, så bör nästa steg bli attförsöka se om det kan gå att motverka dessa olikheteri hjärnans utveckling. Även om vården avde mycket små nyfödda är bra idag, så finns detsäkert ändå utrymme för förbättringar.TEXT: INGELA BJÖRCKFOTO: KENNET RUONAArbetet med extremt förtidigt födda barn grundarsig på hänsyn till barnenoch familjen, påpekarVineta Fellman, professor ineonatologi.AnnonsV


Birgitta Ahltorps studie bygger påsjälvskattningsformulär från chefer ochbedömningar från deras medarbetare.ILL: ANDRZEJ PLOSKI.Chefens bildav sig själv...Ökade krav på cheferna attvara omvärldsorienterade gerdem allt mindre tid att läggapå sina medarbetare, visarBirgitta Ahltorp i sinavhandling.Det räcker inte med att kunna strukturera, lyssnaoch vara bra på att förändra. Det blir alltviktigare för en ledare som vill nå framgång attockså vara skicklig på att skapa kontakter utåtoch bygga nätverk.– Följden blir att dagens ledare lägger alltmindre tid på sina medarbetare. Det kan varaen bidragande orsak till de många sjukskrivningarna,menar Birgitta Ahltorp, som doktoreratpå en avhandling om ledarskap i ämnet psykologivid Lunds universitet.Birgitta Ahltorp driver sedan tjugo år ett konsultföretagsom arbetar med ledar- och teamutveckling,karriärrådgivning mm. Kunderna är bådemindre företag och stora koncerner. Hon utbildarockså sedan många år chefer genom IFL – Institutetför företagsledning i Stockholm.Nu sällar hon sig alltså också till de många sompå senare år försökt formulera vad som utmärkerett gott ledarskap. Och hon gör det genom attjämföra chefers egen bild av hur de fungerar medhur medarbetarna ser dem.– I alla år har jag försökt hitta pedagogiskaverktyg för att diskutera ledarskap med praktisktverksamma chefer, med målet att få dem intresseradeav sådant som är användbart för dem i deraschefsroll. I början var jag alldeles för teoretisk,men nådde fram bättre sedan jag började användasjälvskattningstest, som är ett sätt för chefernaatt göra ett självporträtt. Styrkor och fallgroparblir tydligare, och man kan diskutera vad de skage akt på i samspelet med medarbetarna.Men ett riktigt genombrott i arbetet med chefernaupplevde Birgitta Alhtorp först 1996, då enuppdragsgivare bad henne konstruera ett instrumentsom innebar att cheferna fick feedback frånsina medarbetare. Birgitta skapade ett instrumentdär varje chefsprofil kompletteras med tio enkätsvarfrån medarbetarna. De senares svar strukturerasoch ställs mot chefens egen bild.– Det tog skruv. I regel är ju vi människor ganskaintresserade av vad andra tycker om oss.Genom att lägga profilerna över varandra, blevdet uppenbart på vilka områden cheferna överskattadeoch underskattade sig själva jämfört medmedarbetarna.Birgitta Ahltorps studie bygger på sammanlagt572 självskattningsformulär från chefer och bedömningarfrån totalt 3 772 medarbetare.Inga eldsjälarGenerellt beskriver sig cheferna inte som någraentusiastiska eldsjälar. De håller sig till vad somska göras, går inte utanför de givna ramarna ochframstår som försiktiga, kanske lite vaga, menrespektfulla och mänskliga när de beskriver sigsjälva. De ser sig som öppna för dialog och andrasidéer, och som kontaktskapare utåt. Mindrevanligt är att de försöker hantera känsliga situationer,ge och ta emot kritik och ge ”svåra besked”.Medarbetarna ser cheferna som betydligt merdisciplinerade än vad dessa själva gör. Chefernager varken information eller uppmuntran i sammautsträckning som de själva upplever, enligtVI


medarbetarna, och de är heller inte så lyhörda förmänniskors reaktioner som de tror. I gengäldanses cheferna bättre på att läsa tidens signaler,än vad de själva tycker, men de diskuterar framtidenmed medarbetarna i mindre utsträckning änvad de själva tror.Genomsnittschefen framstår som mer distanseradoch isolerad från hur medarbetarna upplever sinvardag på ett djupare plan. Samtidigt underskattarcheferna sin förmåga att informera och presenterasaker och ting, och medarbetarna upplever en störretydlighet hos cheferna än vad dessa själva gör.De konkreta råd som Birgitta Ahltorp kan gecheferna är att bli bättre på att ge beröm och ävenkritik, på att hantera konflikter och föra känsligasamtal, lyssna och föra en dialog, vara tydligarei sättet att leda och klargöra långsiktiga mål.Man brukar tala om två grundläggande egenskapersom krävs hos en bra chef: dels förmågan attstrukturera, dels förmågan att lyssna, ta in och övervägavad medarbetarna anser. En tredje egenskaphar uppmärksammats på senare år genom forskarenGöran Ekvall, nämligen förmågan till kreativitetoch förändringsarbete. Birgitta Ahltorp vill kompletteramed ännu en: den nätverkande förmågan.– Den är en effekt av den tid vi lever i. På gottoch ont måste alla i dag vara ”säljare”, vakna,öppna, hänga med sin tid och vara med ”där dethänder”. Men det innebär att chefer tillbringarallt mindre tid med dem de är satta att leda. Deär så upptagna av att vara ute och bygga nätverkatt coaching och stöd till medarbetarna blir väldigtlågprioriterat.Ont om tid”Tiden räcker inte till”. Så svarar många chefernär Birgitta Ahltorp påpekar bristerna. Det är ensanning i så motto att många chefer är hårt belastademed krav från ledning, intressenter och andrautomstående.– Ledarskap är en omöjlig uppgift för det mestaoch de chefer som har självgående medarbetarekan vara glada. Samtidigt kan fenomenet ”osynligtledarskap” vara förödande, särskilt i omställningstider.Med ökad osäkerhet behövs tid attdiskutera både information och bristen på information.Att cheferna inte hinner detta kan varaen ingrediens i de ökande ohälsotalen, även omdet inte är något som jag har utrett.Många chefer känner sig otillräckliga. De hinnerutöva det formella chefskapet, men inte detsom Birgitta Ahltorp menar är egentligt ledarskap,dvs att bygga team, och arbeta med relationeroch samspel på arbetsplatsen.Birgitta Ahltorps analys utmynnar i att detfinns fyra dominerande ledarstilar:• Teambyggarna – tillgängliga chefer som gersig tid att lyssna, stötta, berömma och utvecklamedarbetarna, men också har förmågan att gekritik på ett bra sätt.• Innovatörerna – omvärlds- och framtidsinriktade,ofta kontaktskapande entreprenörer, somdock sällan tar sig an medarbetarna på hemmaplan.• Nätverkarna – med en flexibilitet och socialkompetens som i första hand riktas utåt, inte motde egna medarbetarna.• Dirigenterna – chefer som styr med fast hand,gärna med hjälp av nyckeltal och vecko- och månadsrapportersom krävs in från medarbetarna.Dirigenter frågar inte efter andras åsikter, utanlägger upp sina planer på egen hand och är på detviset mycket tydliga i sina krav.Team med olika talangerEn chef behöver ha lite av alla fyra stilarna, menarBirgitta Ahltorp.– Samtidigt kan inte en enda person göra alltingsjälv. Och en lösning kan vara att skapa teamdär olika talanger lyfts fram och dit man knytermedarbetare som inte bara ser funktionen utanockså människan. Det kan ske inom ramen för enledningsgrupp, men också mer informellt.Den nätverkande chefen kommer vi att se alltmer av, tror Birgitta Ahltorp. Det finns de nätverkaresom lyckas bra i kontakten med medarbetarna,genom att vara oerhört närvarande närde väl är på plats, genom att ha rutiner för hur dekan nås eller t o m genom att synas ofta i pressen.Men den teambyggande ledarstilen hamnar alltsåalltmer i bakgrunden.– De flesta chefer ser sig främst i framträdarrollen.Få är bra på djupkontakt, säger BirgittaAhltorp, som närmare vill studera hur de cheferbär sig åt som trots allt lyckas skapa god och närakontakt med sina medarbetare. Det är nämligendåligt utforskat.BRITTA COLLBERGFOTNOT: Birgitta Ahltorps avhandling heter ”Ledarskapur ett ledningsstilsperspektiv. Teambyggare, innovatörer,nätverkare och dirigenter.””Cheferna är såupptagna av attvara ute ochbygga nätverkatt coaching ochstöd till medarbetarnablirväldigt lågprioriterat.”...och medarbetarnasChefens bild av sig själv ochmedarbetarnas går inte alltid ihop.ILL: ANDRZEJ PLOSKI.VII


INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNAAngela Cenci-Nilsson, neurobiolog och Parkinsonforskare får årets lokala Fernströmpris. FOTO: KENNET RUONAForskning om Parkinsonledde till FernströmprisetAngela Cenci-Nilsson, neurobiologoch Parkinsonforskare,har utsetts till Lunds universitetsmottagare av Eric K Fernströmspris till ”yngre, särskiltlovande och framgångsrikaforskare”. Priset delas ut tillen forskare vid varje medicinskfakultet i landet, med enprissumma på 100 000 kronorvar.Angela Cenci-Nilsson har redantidigare i år fått mycketuppmärksamhet för sin forskning.Hon har fått två storaanslag från den amerikanskastiftelsen Michael J Fox Foundation,en av världens störstabidragsgivare till forskningenom Parkinsons sjukdom.DyskinesiDet område Angela Cenci-Nilsson arbetar med ärdyskinesi, ofrivilliga rörelser,vid Parkinson och andra liknandeneurologiska sjukdomar.Dyskinesierna vid Parkinsonär en sorts stora ochflaxiga rörelser som inte berorpå sjukdomen i sig utan är enbiverkning av medicineringenmed läkemedlet L-dopa. Ävencelltransplantationer till hjärnan,som setts som en möjligframtida bot för sjukdomen,har i vissa försök gett upphovtill dyskinesier.– För tio år sedan var detingen som riktigt förstod problemetsvidd. Men nu inserman att ingen behandling motParkinsons sjukdom blirframgångsrik om den gerdessa besvärliga ryckningarsom en bieffekt, säger AngelaCenci-Nilsson.Den nyblivna Fernströmpristagarenär ursprungligenfrån Italien, men flyttade tillLund i slutet av 1980-talet.Parkinsonforskningen hadedå hunnit bli en lundaspecialitetoch Angela Cenci-Nilsson,som var verksam somneurolog, hade hört talas omdetta arbete.Jämställdheten godDe lokala Fernströmprisernagår till sex eller fler pristagareper år (priset kan delas) ochhar delats ut sedan 1979. Underdessa år har hittills bara13 kvinnor fått priser, varavtvå i Lund. Det här året ärdock jämställdheten god: prisernagår till tre kvinnor ochtre män. De kommer att delasut i samband med ForskningensDag i Lund den 3 november,och ett Fernströmseminariummed samtliga pristagareges den 4 november kl10–12 på Universitetssjukhuseti Lund.INGELA BJÖRCKFrånBolognatill Lundsid 2INSIDORNARomanskatänker nyttsid 9En röstför ungaforskaresid 121


Eva Åkesson”En milstolpeför pedagogiken”Som en milstolpe för pedagogiken,betraktar Eva Åkesson universitetsstyrelsensbeslut ommålet att alla lärare vid Lundsuniversitet ska ha genomgått tioveckors utbildning i högskolepedagogik.Eva Åkesson som är pedagogisk konsultoch projektledare vid UCLU,(utvecklingscentrum för lärande ochundervisning) har i 30 år kämpat för attöka pedagogikens status i högskoleundervisningen.I början av 90-talet fickhon och hennes kollega Eva Falk Nilssondraghjälp av dåvarande rektorHåkan Westling i en utredning – dens k Grundbulten – där man förordadesex veckors grundläggande högskolepedagogiskutbildning för behörighet,och därefter successiv utbildning medtvå veckor per år under fem år.– Då var det ett programförslag ellersnarare en vision, men nu har vi fåttmål och behörighetskrav fastställda,säger Eva ÅkessonEn förstärkning med andra ord, ochen välkommen sådan:– Det är väldigt glädjande och vi ärmånga som har hjälpts åt att få framdet. Det känns som ett väl underbyggtoch realistiskt mål.Ansvaret för att lärarna genomgårutbildningen ligger på respektive områdeoch tillämpningen av beslutet skaredovisas för universitetsstyrelsen hösten2005. Men att målet skulle varauppfyllt då tror knappast Eva Åkesson.– Nej, det kommer att ta längre tidän så. Det stora hindret nu är intelängre attityden till högskolepedagogikenutan lärarnas hårda arbetsbördatillsammans med det kärva ekonomiskaklimatet.MARIALINDHFOTNOT: För exaktformulering av beslutetom högskolepedagogiskautbildningensewww.lu.se/aktuelltEva Åkesson. FOTO:KENNET RUONABolognaprocessen gårvidare i Europa och LundI slutet av september träffades 40 europeiskautbildningsministrar i Berlin somett led i den så kallade Bolognaprocessen.Vid mötet diskuterades bland annatkvalitetssäkring, examensstruktureroch ett effektivare system för att erkännaexamina från andra lärosäten.– Frågor om examensstrukturenkommer att sysselsätta Sveriges universitets-och högskolesektor under denärmsta åren. Det sade statssekreterareAgnetha Bladh när hon nyligen hemkommenfrån Berlin besökte Lunds universitet.Bolognaprocessen kallas uppföljningenav en deklaration som antogs av 29 europeiskaländer i Bologna 1999. Detövergripande målet är att göra europeiskutbildning mer konkurrenskraftig.Detta ska uppnås genom ökad rörlighetmellan universiteten. Studenter, lärareoch forskare ska enkelt kunna flyttamellan olika lärosäten och medlemsländernasuniversitetsexamina ska bligångbara på hela den europeiska arbetsmarknaden.För att detta ska bli möjligtmåste det bli lättare att jämföra olikaexamina och betyg och det måste finnasnågon form av kvalitetssäkring. År 2010har man satt som slutår då medlemsländernasuniversitet ska vara färdigamed europeiseringen.Diploma SupplementEtt konkret resultat av Bolognaprocessenär att alla examensbevis idag försesmed ett så kallat Diploma Supplement.Det är en engelskspråkig bilaga påtre till sex sidor som beskriver vad detär för sorts examen och hur det svenskahögskolesystemet fungerar.Ett viktigt redskap för att få störrerörlighet mellan universiteten är ECTS,European Credit Transfer System, ettbetygssystem inom Erasmusprogrammetsom skapades för att det ska blienklare att tillgodoräkna sig utlandsstudier.ECTS handlar främst om överföringav universitetspoängen men ocksåom hur övrig utbildningsinformationska struktureras.Bertil Holmberg, prodekan vid Na-turvetenskapligafakulteten,var på uppdragav EU-kommissionenmed ochutveckladetransfereringssystemet.– Under 90-talet låg Lund iframkanten närdet gällde attinföra ECTS, Bertil Holmbergsäger BertilHolmberg. Men nu har vi halkat efter.– Jag tror att det ska till ett rektorsbeslutoch pengar till informationsinsatserom ECTS ska kunna införasöver hela universitetet. Som det ser ut idag tillämpas systemet bara vid vissa institutioner.När det gäller Bolognaprocessenskrav på kvalitetssäkring menade statssekreterareAgneta Bladh att Sverige redanhar ett väl utvecklat system. Däremottrodde hon att den svenska högskolevärldenskulle få en hel del att göra närdet gäller översynen av examensstrukturenunder de närmaste åren.I februari kommer Utbildningsdepartementetmed en utredning som Sverigesuniversitet och högskolor måste ta ställningtill. Utredningen ska behandlaexamensstrukturer och eventuella förändringari den svenska betygsskalan.Bland annat diskuteras om det går attinföra en sjugradig betygsskala enligteuropeisk modell och om fler utbildningarska delas in i kandidat- och magisternivå.En etappindelning i kandidat-och magisternivå underlättar nämligenför den som vill förlägga en del aven utbildning till ett annat universitet.Hittills har det bara varit den förstaoch andra cykeln i universitetens utbildningar,det vill säga kandidat- ochmagisterutbildningarna som har varitföremål för Bolognaprocessen. Närutbildningsministrarna möttes i Berlin iförra månaden bestämdes att även dentredje cykeln, det vill säga forskarutbildningen,måste inkluderas.ULRIKA OREDSSON2


Svårt att nå doktorandernaForskarutbildningen är en plattform förframtidens chefer. Bland annat därför ärdet viktigt att facket ser över doktorandernaslivspussel. Det sade företrädareför Statstjänstemännen och TCO när dehöll ett seminarium under rubriken ”Livetsom doktorand”.I augusti kom ST/TCO ut med en rapportöver de forskarstuderandes livssituation.Deras resultat bekräftade tidigareundersökningar som gjorts:Doktoranderna är pressade och kvinnornaupplever det så i högre grad änmännen.Under oktober månad besökte utredarnade olika universiteten för att berättaom de lokala variationerna. FrånLunds universitet hade160 doktoranderdeltagit i undersökningen och deras svarvisar att Lund varken är bättre ellersämre än andra universitet på att tahand om sina forskarstuderande.– Doktoranderna är något av en fackligparadox, sa Ing-Marie Nilsson somär Statstjänstemännens ordförandeinom universitet och högskolor. De verkarbehöva mer stöd än andra yrkesgrupper,samtidigt som de är svårare attnå ut till. Detta beror delvis på doktorandensdubbla identitet som både studentoch anställd.Oro efter examenEn uppgift som utredarna framhöll somsärskilt alarmerande var att så mångasom 60 procent av alla doktoranderoroar sig för att inte få ett arbete efterdoktorsexamen.– Dessa människor får ju både spetskompetensoch landets högsta utbildning,sa Ing-Marie Nilsson.Tvärtemot vad man hade kunnat troär det naturvetare och tekniker som ärmest oroliga. Om oron är befogad kundeutredarna inte svara på, men de menadeatt universiteten var dåliga på att visaandra karriärvägar än den akademiska.– Inte en enda av de svarande vidLunds universitet uppgav att de hadehaft praktik eller möten med företag,myndigheter eller organisationer infördet framtida yrkeslivet.I Lund var 37 procent av de svarandeföräldrar. Nästan hälften av dessa tyckteatt deras institution gav dem goda möjligheteratt kombinera föräldraskap medforskarstudier. Samtidigt uppgav 16procent att de väntat med att skaffabarn på grund av forskarstudierna. Närdet gällde uttag av föräldraledighet lågLund procentuellt sett lägre än andrauniversitet i undersökningsgruppen.Kvinnorna tyckte, inte särskilt förvånande,att det var svårare med föräldraledighetän männen. Svårast var det förde ensamstående föräldrarna där hela70 procent hade övervägt att hoppa avstudierna. Utslaget på hela undersökningsgruppeni Lund var siffran 37 procent.ULRIKA OREDSSONSå ger man ris och rosUniversitetets administratörer ägnadeen eftermiddag i början av oktober åtatt förkovra sig i kommunikation ochkonflikthantering.– Alla kan bli bättre på att hantera konflikter,menade organisationskonsultenAgnete Nilsson. Av deltagarna att dömavar det dock mest kvinnor som tyckteatt de hade något att lära. Endast fyraav 120 deltagare var män.Agnete Nilsson gav administratörernakonkreta tips om kommunikation ochkonflikthantering i arbetslivet.– En administratör som inte är ichefsposition kan fungera som stödpersoni konfliktsituationer, sa AgneteNilsson. Man blir ofta en sorts containerför brister inom organisationen.Därför är det viktigt att lära sig att ställaupp som lyssnare och lotsa konfliktenvidare till rätt nivå, utan att själv blidelaktig i den.Mottagandet av nyanställda och vikariersäger en hel del om klimatet ochkommunikationen på en arbetsplats,ansåg Agnete Nilsson. Åhörarna fickdiskutera under ett par minuter hur desjälva togs emot när de började arbetavid universitetet. Erfarenheterna varieradefrån nedskrivet introduktionsprogramoch blommor på skrivbordet tillkommentarer i stil med:– Ojdå, var det idag som du skullekomma.Många av Agnete Nilssons tips handladeom sunt förnuft. Hur man ger rosoch ris till exempel. Ris utdelas på tuman hand, medan ros blir än mer uppskattatom det ges inför en grupp. Sakersom borde vara självklara men ändå inteär det.Agnete Nilsson är flitigt anlitad somorganisationskonsult inom Lunds universitetoch brukar bland annat gelängre kurser i konflikthantering föruniversitetets chefer. Ingrid Estrada-Magnusson, personalutvecklare vidLunds universitet, tycker det är viktigtatt all personal får ta del av chefernaskunskaper.– Om båda parter har gått kursenbrukar effekten bli bättre, säger hon.Annars blir det lätt en ”Jaha-nu-harchefen-varit-på-kurs-igen-inställning”till försöken att ändra på gamla invandabeteenden.Kommunikationskursen för administratörerär en fortsättning på en föreläsningsserieförra året som gick undernamnet Administratörens år 2002.– Det finns ett sug efter fler kurser föradministratörer, tror Ingrid Estrada-Magnusson, och berättar att nästa kurstillfällekommer äga rum i februari. Detska handla om etik och hållas av univer-– En administratörsom inte är i chefspositionkan fungerasom stödperson ikonfliktsituationer, saAgnete Nilsson. Manblir ofta en sorts containerför brister inom organisationen.FOTO:ULRIKA OREDSSON3


Valprocessen införnya styrelsen igångMandatperioden för lärarrepresentanteroch externa ledamöteri universitetsstyrelsen löper utden 31 december i år. Det är regeringensom utser externa ledamöteroch ny ordförande och enelektorsförsamling som utser detre lärarrepresentanterna. Studenternautser sina representantersjälva.Elektorsförsamlingen ska bestå av sammanlagt50 ledamöter varav tolv frånLTH, sju från Naturvetenskapliga fakulteten,tio från Medicinska fakulteten,två från Juridicum, åtta från Samhällsvetenskapligafakulteten, två frånKonstnärliga området, en från Trafikflyghögskolanoch en från Campus Helsingborg.Det är kanslichefen vid varjefakultet/område som ansvarar för attval av elektorer sker. Elektorsförsamlingenska ha sitt första sammanträdeden 24 november och ska då utse envalberedning i vilken båda könen skavara jämnt representerade. Elektorsförsamlingenbestämmer tid för valsammanträdesenast andra veckan i december.Valberedningens förslag skavara klart senast fem dagar före valsammanträdet.Ny ordförandeRegeringen är på gång med att utse desex externa ledamöterna samt ny ordförande.Informella samtal mellanUtbildningsdepartementet och LU pågår.Sittande ordförande Lennart Nilssonhar suttit i två perioder, dvs sammanlagtsex år, och var dessförinnanvanlig ledamot. Han är LUs första externaordförande, en post som rektordessförinnan alltid haft.Några spekulationer om vem somskulle kunna vara lämplig som efterträdarevill rektorsämbetet inte ge sig in i.Det har dock, från departementsnivå,talats om ett ambulerande ordförandeskapmellan landets universitet ochhögskolor, exempelvis att Lund ochUppsala universitet byter ordförande.Ett argument som talar mot det systemetär att det är värdefullt med en styrelseordförandesom är förankrad i regionenoch kan finnas på plats underarbetsintensiva perioder.MLBlandade känslor på halveFrån 1 januari får Lunds universitet ytterligareett område. Då delas Samhällsvetenskapligafakulteten så att Ekonomihögskolan(EHL) blir egen fakultet.Ekonomerna blir område nummer åttaoch här är glädjen stor. I den nya halverades-fakulteten är stämningen mersplittrad. Ledningen talar om att gillaläget. Andra ser chansen att stärka vikänslanoch få en fakultet med tydligareidentitet.Göte Hansson, professor i internationellekonomi, har varit dekan för samhällsvetarnai fyra år och suttit i fakultetsstyrelsensedan 1984. Han kan som ekonominte fortsätta som samhällsvetardekan,och återgår i januari på heltid tillden forskning han under flera år bedrivitpå halvtid.– Det ska bli roligt, men jag har trivtsmed fakultetsarbetet och delningen äringet jag har önskat. Jag tror på denstora fakulteten och har kämpat för denhela tiden – men nu gäller att gilla lägetoch ge järnet.Det avgörande beslutet togs egentligenredan 2000, menar Göte Hansson,då ekonomerna beviljades ökad autonomioch bildade en egen sektion inomfakulteten.– Jag trodde de skulle nöja sig meddet, och är besviken på mig själv för attjag var så naiv. Men kanske var det en”mission impossible” – ekonomerna varStudentkåren LundaEkonomerna är mycketglad åt den nya organisationen och hoppas atten självständig ekonomihögskola ska få enännu tydligare identitet utåt.Studenterna i Samhällsvetarkåren är däremotnegativa. Ordförande Maria Noleryd ochvicen David Ganrot, studentrepresentant ifakultetsstyrelsen, hade hellre sett en samhållens-fakultet.– Det är bredden som är styrkan, och ökatsamarbete mellan institutionerna kring t exutbildningsprogrammen hade gynnat oss studenter,säger David Ganfot.De är också missnöjda med hur ärendetskötts. Remisstiden löpte över sommaren vilketinnebar att många studentrepresentanter påså inriktade på att bli sina egna, sägerGöte Hansson.Samhällsvetarnas kanslichef TarmoHaavisto, tidigare studierektor i nationalekonomi,lämnar också sin post vidårsskiftet, och blir ny chef för Studerandeenheten.Vilka som efterträder Hanssonoch Haavisto kommer att stå klartsenast i början av december. Då ska nyafakultetsstyrelser och dekaner ha hunnitväljas.Risk för dubbelarbeteProdekanen Sune Sunesson, professor isocialt arbete, tycker inte att den nyafakultetsuppdelningen ligger riktigt i tiden.– Det finns en risk för ökat dubbelarbeteoch det blir väl trots allt litelängre mellan folk som borde samarbeta.Samtidigt är delningen ett faktumoch nu ska vi se vad vi kan göra av det,säger han.Gamla s-fakulteten hade drygt 8000helårsstudenter, och de nya fakulteternadelar dessa ungefär lika inom grundutbildningen.Inom forskarutbildningenär samhällsvetarna större, både till volymoch produktion.Statsvetare och kulturgeografer varmest negativa till en delning vid denremissrunda som gjordes inom dengamla storfakulteten under sommaren.– Redan existerande mötesplatser börbevaras, tyckte statsvetarnas Lars-Gö-Positiva ekonomstudenter– negativt inom Samhällsvetarkåreninstitutionerna inte deltog i remissvaren.Maria Noleryd och David Ganfot tycker detär en konstlad delning, också med tanke på attämnen som informatik och statistik hamnarinom Ekonomihögskolan medan ekonomiskgeografi hamnar utanför.– EHL har sitt hus, sitt varumärke och harvärnat sina intressen mer. Övriga institutionerhar inte haft samma mötes- och beslutsfora,och inte kunnat ta ett helhetsgrepp på fakultetsarbetet,säger Maria Noleryd.Det positiva är att nu finns utrymme för nytänkandeinom s-fakulteten:– Jag hoppas man tar den chansen!BC4


ad fakultetran Stenelo, som var rädd att delningenskulle spä på ett ”vi och dom”-tänkande.– Politik och ekonomi bör inte separerasvare sig när det gäller analys ellerorganisation, skrev Stenelo i remissen,men är nu dock beredd att göra detbästa av situationen.Hurrade inteSocialhögskolan hurrade inte för en delning,men hade heller inte mycket attinvända, medan pedagogoger, psykologeroch sociologer var minst negativa.De senare skrev ett gemensamt yttrandeoch påpekade att den organisation somgällt sedan 2000, med EHL som en egensektion, inte gynnat övriga institutioner.– Fakultetens arbete har kännetecknatsav administrativt dubbelarbetesamt otydliga och i vissa fall inkonsekventabesluts- och ansvarsområden,menade prefekterna Tina Kindeberg,pedagogik, Jitka Lindén, psykologi, ochMats Beronius, sociologi.Medan EHL fortsatt att bygga upp enegen infrastruktur, har den fakultetsgemensammaidentiteten urholkats,menade de tre i sitt remissvar. De varinte emot en stor sammanhållen s-fakulteti princip, men ansåg att fakulteten irealiteten redan var tudelad.De tre prefekterna började på egetinitiativ träffas regelbundet i våras, delvisför att kompensera bristen på mötesplatserför institutioner utanför Ekonomihögskolan.– Det hade legat oss i fatet på fakultetsmöten,att vi inte hunnit förberedaärenden på samma sätt som Ekonomihögskolansrepresentanter, säger TinaKindeberg till LUM.De informella prefektträffarna harresulterat i en samarbetsanda, som TinaKindeberg och hennes två kolleger gärnaser spridd till hela den nya s-fakulteten.– Fakulteten blir nu en mindre ochmer homogen miljö och då ökar möjligheternatill samarbete, säger psykologprefektenJitka Lindén.Det är själva organisationen som haltatde senaste tre åren, understrykerhon:– Ingen skugga ska falla över fakultetsledningensom verkligen gjort detbästa av situationen!Göte Hansson kansom ekonom intesitta kvar som dekanusför den samhällsvetenskapligafakkulteten.– Delningen äringet jag har önskat,säger han.–Vi valde att tillstyrkadelning.Som ny fakultethar vi chansen attskapa något heltnytt och bättre,säger Tina Kindeberg,prefekt förPedagogiska institutionen.I augusti hölls ett slags hearing omdelningsförslaget inom fakulteten.– Vi hade begärt den, för vi visste förlite, berättar Tina Kindeberg. Men vityckte inte vi fick tillräckligt starka argumentmot en delning. Ekonomernadäremot var tydliga med vilka fördelardet skulle innebära för dem. Vi valde atttillstyrka delning av det skälet, menockså för att den tidigare blandmodelleninte fungerade. Som ny fakultet har vichansen att skapa något helt nytt ochbättre.Sammanhållen organisationPå Ekonomihögskolan hoppas man atten mer sammanhållen organisation skagöra verksamheten tydligare både inåtoch utåt. Det blir tydligare beslutsvägaroch besluten kommer närmare verksamheten,menar rektor Olof Arwidi.Han tycker att det har fungerat brasedan Ekonomihögskolan fick ökad autonomiför tre år sedan. Arwidi är bereddfortsätta som rektor och tar därmedförmodligen säte i universitetets informellaledningsgrupp dekanrådet.Olof Arwidi ser ingen fara för ökadisolering i förhållande till andra ämnen.Tvärtom har det tvärvetenskapliga samarbetetförstärkts på senare år mellanekonomerna och andra ämnen, inteminst inom LTH. Mångfalden och möjlighetentill samarbete över ämnesgränsernaär den stora fördelen med atttillhöra Lunds universitet menar han.BRITTA COLLBERGTvå nya magisterprograminrättasRektor har beslutat att inrätta två nyamagisterexamina med ämnesbredd.Den ena blir i kognitionsvetenskap,där man tänker starta en magisterkursom 40 poäng med innehåll från fleraämnesområden.Den andra magisterutbildningen bliri geografiska informationssystem, GIS.Det är ett kvalificerat verktyg för atthantera geografiska data, vilket användsav flera olika yrkesgrupper. Detmångvetenskapliga GIS-centrum, somsorterar under Naturvetenskapliga fakulteten,ska hålla i programmet. Detska omfatta 80 poäng och är tänkt gespå distans. Undervisningsspråket blirengelska för att möjliggöra utländsktdeltagande.Nytt instrumenttill astronomiDen grupp som sysslar med atomär astrofysikvid Institutionen för astronomihar i dagarna fått tre miljoner kronorfrån Knut och Alice WallenbergsStiftelset till ett nytt instrument. Det ären Fourriertransformspektrometer förundersökningar inom det infrarödavåglängdsområdet. Man har tidigare ettsådant instrument för att arbeta medsynligt ljus och UV-ljus.– Men inom astronomin finns ettväxande intresse för analyser i detinfraröda våglängdsområdet. VLT, deneuropeiska samarbetsorganisationenESO:s jätteteleskop i Chile, har utrustatsmed spektroskop för infraröd strålningoch det finns planer på att skjuta uppett nytt rymdteleskop som arbetar påsamma våglängder. Därför behöver vihär i Lund genom laboratorieexperimentlära oss mer om karakteristiskalinjer i sådana spektra, säger professorSveneric Johansson till LUMMålet är att det nya instrumentetska vara på plats i Sveneric Johanssonslaboratorium kommande vår.Högskoleprovet populärtFler än någonsin skriver Högskoleprovet36.605 personer har anmält sig till höstenshögskoleprov den 25 oktober. Detär en ökning med 11 procent jämförtmed provet förra hösten.5


Internationalisering måste inte vara forskningsutbyte och nyasamarbetspartner utan kan även innebära att man ger sig ivägbortom Sveriges gränser för att få egen forskartid i lugn och ro.Malin Åkerström berättar om en ”sabbatstermin” med sin familj iNya Zeeland. Hon skriver om febril förberedelse, äventyr ochomväxling, och – inte minst – färdigskrivna dåliga samveten.Gästkrönikan”Slitet före äventyret är mödan värd””INTERNATIONALISERING” harunder något decennium varit ett slagordi svensk forskningspolitik.Som enskild forskare kan man meddess hjälp – idén har materialiserats genomgenerösa stipendier och möjligheteratt söka anslag – bjuda in gästforskare,men man kan också själv ge sigiväg utanför Sveriges gränser.Sådana vistelser kan ha olika syften.I internationaliseringens paroller ingår”att skapa samarbeten”. Framföralltgäller det att ha kontakt med ”spetsforskning”– ett annat av dessa tidstypiskauttryck.JAG HAR NYLIGEN återvänt från enlängre forskningsvistelse utomlands. Imitt fall stämde inte någon av dessa paroller.Jag vistades inte vid ett berömtuniversitet och resan har ännu inte resulterati något samarbete. Jag ville iställetfå egen forskningstid, komma iväg föratt skriva samman de utkast som samlatsunder flera år. Det kan man då tyckaatt man kan göra i sin egen miljö. Menhemma är det svårt att inte, som detheter idag, bli ”splittrad”. Det viktigasteskälet till att jag och min man bestämdeoss för att med alla fyra barnen ge ossiväg på en åtta månaders sejour till NyaZeeland var emellertid att vi, genomförmånen ”sabbatstermin”, kunde förverkligaen längtan efter omväxling ochäventyr.EN SAK ÄR SOM bekant att bestämmasig för att något är en trevlig idé, enannan att konkretisera den. Hur skullevi hålla verksamheten flytande härhemma – doktorandernas handledning,vad göra med våra löpande räkningar,vem ska passa katten? Skulle vi ha råd?Eftersom min man ägnar sig åt laborativvetenskap, som kräver ett närasamarbete, fick hans val av universitetscentrumbestämma. Själv lyckades jagbli inbjuden till en institution i sammastad; institutionen bjöd inte på någonspetsforskning men verkade välkomnandeoch erbjöd ett kontor, bibliotekskortoch tillgång till internet.UNDER DENNA TID av febril aktivitethände det att vi undrade om det helavar mödan värt. Med facit i handen kanvi konstatera att det verkligen var värtallt besvär. För min del innebar det attjag i stort skrev samman de halvfärdigautkast jag länge haft dåligt samvete över.Dessutom fick vi vårt äventyr. Nya Zeelanderbjöd tillräckligt av det annorlunda,som ett skarpt sociologiskt ögakunde iaktta, förbryllas över och roasav. Hur skulle t ex den svenska skolanställa sig till att anordna tivolin för attförbättra sin ekonomi, där ett av inslagenvar att den lokala mc-klubben skjutsaderunt barnen i livlig trafik på sinaHarley Davidsons?VI KOM OCKSÅ att uppskatta delar avdet svenska som vi förr tagit för givet.Nya Zeeland har ärvt mycket av det positivai engelsk kultur: artighet,konversationskonst och trevliga pubar.Men också oförmågan att värma sinahus: isolering är något rätt okänt och viförstod plötsligt vitsen med dessa underligaelektriska filtar, varmvattenflaskoroch nattmössor, när vindarna från Sydpolenblåste som snålast under höstenoch vintern.Vissa inslag utföll också till Sverigesnackdel. Husens utanverk – arkitekturen– var betydligt mer fantasifull, lekfulloch färgrik. Nya Zeelands bostadspolitikvar dessutom betydligt mer flexibel.Min nittonåring var grön av avundöver hur lätt hans jämnåriga kunde hittalägenheter eller hyra hus att dela medkamrater. Även arbetsmarknads- ochinvandringspolitiken tycktes mer flexibel;den gav inte intryck av samma”Generous Betrayal” som den norskaantropologen kallat vår politik.DET JAG KORT VELAT förmedla äratt ”internationalisering” på en mer vardagligicke-glamorös nivå än den där”spetsforskning” diskuteras också ärvärdefull. Att, som intellektuell, via konkretapersonliga erfarenheter få nya perspektivoch intryck där man tvingastampas med de egna fördomarna är berikande.Men det är också värdefullt attse hur forskningsområden färgas avsammanhanget ( i Nya Zeeland var t exrugby och frågor om maorier viktiga),att se vilken typ av seminarier som ges,hur anställningsprocedurer fungerarosv. Slitet före avfärden är med andraord, mödan värd!MALIN ÅKERSTRÖMPROFESSOR I SOCIOLOGI6


Samhällsvetare på sopbergetSamhällsvetarna har en självklar platspå sopberget. Det pläderade åtminstoneetnologen Lynn Åkesson för när honföreläste på Samhällsvetenskapens dagden tionde oktober.– En välutbildad och innovativ tekniskexpertis är nödvändig för att komma tillrätta med välfärdsstatens avfallsproblem.Men även samhällsvetarna har enviktig roll för att förstå sopornas moraliskaimpregnering, sa Lynn Åkesson närhon berättade om varför hon vill forskamer kring sopor och hanteringen avdessa.Hon hävdade att vår tids intensivasopsorterande påminner om en slagsbesvärjelse, något som vi gör för attblidka det samhälle som vår överkonsumtionför med sig.– Experterna är oeniga om vikten avsopsortering men vi fortsätter ändå, saLynn Åkesson som tror att vårt handlandehar att göra med skuldkänslor förvår livsstil.Miljö har blivit vår tids modeord påsamma sätt som hygien var ett modeordpå trettiotalet och kultur hörde sjuttiotalettill.Det var en 10-åring med många intressenoch förgreningar som Lynn Åkesson,prefekt vid Etnologiska institutionen,gratulerade vid ett jubileumsseminariumden 1 oktober.Att humanekologerna skulle placerasvid just hennes institution var inte ensjälvklarhet då avdelningen såg dagensljus för första gången för tio år sedan.Men så blev det, och såväl etnologersom humanekologer verkade tycka attdet var en lyckosam placering.Lynn Åkesson var imponerad överhur mycket humanekologerna fått gjortunder sin korta tid i Lund.– Ni har byggt upp ett livligt studentklimat,ni har mycket på gång ochlyckas locka till er storheter från när ochfjärran, sa hon och syftade bland annatpå den stora internationella konferensensom humanekologerna höll på GrandSophanteringen och de växande sopbergentar sig många uttryck som är intressantaför kultur- och samhällsvetare,menade Lynn Åkesson. Ett är dennya tidens chockturism i exempelvisEstland, där välbärgade människor åkerut och tittar på landskap som ödelagtsunder Sovjetperioden. Ett annat uttrycksom är intressant ur ett etiskt perspektivär exporteringen av sopor till fattigareländer.Samhällsvetenskapens dag gick underrubriken Kris och expertis. FörutomLynn Åkesson talade rektor GöranBexell om universiteten i risksamhället,Gustav Holmberg från Forskningspolitiskainstitutet talade om forskarlarmoch framtidsvisioner beträffandeden högteknologiska maten, WilhelmAgrell, också från Forskningspolitiskainstitutet, talade om förvarning ochsamhällshot och Peter Sylwan, professorvid Institute of Communication taladeom vetenskap och journalistik.Den samhällsvetenskapliga halvdagenavslutades med paneldiskussiondär fd universitetskansler Carl-GustafAndrén, Wilhelm Agrell, Peter Sylwanoch Gustaf Holmberg diskuterade omHumanekologerna firadeshotell, bara någon vecka tidigare.Hon avslutade sitt gratulationstalmed presenter; lego som alla 10-åringarvill ha men som kan vara knepigt att fåihop ibland, och så en äkta skånsk spettekakasom fick symbolisera identitetoch tradition.Sedan var det dubbeljubilaren AlfHornborgs tur. Han installerades nämligensom professor också den 1 oktober1993. Nu, tio år senare, gladde han sigåt det ökade söktrycket och konstateradeatt man har fler studenter än någonsin.Han ville gärna se humanekologinsom en mötesplats mellan människaoch miljö och mellan många olikavetenskaper. Alf Hornborg medgav attman under årens lopp ibland haft svårtmed metoderna, men å andra sidanmötts av stor välvilja från grannvetenskapernaoch forskningsfinansiärer.– Det är inte så dumt att ha många attLynn Åkesson talade om sopor på S-dagen ochgratulerade humanekologer(se artikel nedan).FOTO: MARIA LINDHvetenskapen och tekniken ska ses somfrälsare eller som mardröm.ULRIKA OREDSSONvälja mellan. Från de som stöder skogsochjordbruk till humanistiska forskningsrådet,sa Alf Hornborg.Ebba Lisberg Jensen tog vid efterHornborg och hon är både den förstasom började läsa humanekologi i Lund,och med att disputera här. Hon höll ettuppskattat tal om varför man blir humanekolog.Humanekologi är ett tillstånd,eller till och med en sjukdom,som utvecklas redan i barndomen, menadehon– En treårings ständiga varför – konserverashos en humanekolog.Under jubileumsseminariet presenteradessedan en mängd forskningsprojektoch inriktningar. Allt från kameler tillCadillacs och experimentell agrarhistoriai Östarp till fotavtryck i hållbarhetsdebatten.– Hoppas att ni kan se en röd tråd idenna mångfald – det är i så fall humanekologi,sa Alf Hornborg.MARIA LINDH7


”Jämställdhet handlar om moral”I slutet av september, 130 år efter attden första kvinnan fått tillträde till akademin,hölls en nationell jämställdhetskonferensvid Lunds universitet.– Om universitetsledningen driverfrågan om jämställdhet kan den genomföraspå ett par år, sa Agnes Wold. I annatfall fortsätter vi som idag och detkan dröja precis hur lång tid som helstinnan akademin blir jämställd.Agnes Wold, debattör och immunologvid Sahlgrenska sjukhuset i Göteborg,efterlyste en nationalekonomisk vinkeli debatten.– Det är ju ett fruktansvärt slöserimed samhällets resurser att det finns såfå kvinnor på ledande positioner inomakademin. Mer än hälften av studenternapå grundnivån är kvinnor, menfortfarande är antalet kvinnliga professorerskrämmande lågt.Manlig svågerpolitikFör ett par år sedan gjorde Agnes Woldtillsammans med GöteborgsforskarenChristine Wennerås en uppmärksammadundersökning om hur Medicinskaforskningsrådet fördelade sina anslag.De visade bl a att männen hade 2,3gånger större chans att få igenom sinaansökningar än deras kvinnliga kollegeroch att en kvinnlig forskare i snitt måsteha producerat 2,6 gånger mer än sinmanlige kollega för att ha samma chanstill forskningspengar.Agnes Wold menar att det är manligsvågerpolitik som ligger bakom kvinnornaslångsamma genomslag i akademin.– Det är en myt och en pseudofrågaatt barn och familj är det huvudsakligahindret i kvinnors karriär, sa hon ochvisade siffror på att kvinnliga, och manligaockså för den delen, akademikermed barn och familj snarare lyckasbättre i karriären än ensamstående.Den nationella jämställdhetskonferensenär ett årligt återkommande evenemangsom främst vänder sig till högskolevärldensjämställdhetsarbetare. Iår, när Lunds universitet höll i stafettpinnen,bjöd man till konferens underrubriken Kultur och natur– möjligheteratt mötas. Arrangörerna hade alltsåäven bjudit in föreläsare som talade ombiologiska skillnader mellan män ochAgnes Wold suckade över manlig svågerpolitik.FOTO: ULRIKA OREDSSONkvinnor. En av dessa var Nils Uddenberg,docent i psykiatri vid KarolinskaInstitutet, med intresse för biologi, etikoch samhälle.Han inledde med att säga att biologerinte har något intressant att säga omjämställdhet mellan könen.– Evolutionsteorin har inte ett skvattmed jämställdhet att göra. Jämställdhethandlar om moral, slog han fast.Det finns emellertid mönster i samhälletsom kan förklaras av biologin:hannar och honor föds med olika förutsättningar.Bland oss människor tar detsig uttryck i att män slåss mer, de bryrsig mer om makt och de vill kontrollerakvinnornas sexualitet.– Men, sa Nils Uddenberg och höjdeett pekfinger, jag vill passa på att hissavarningsflagg för ordet naturlig. Baraför att det finns förklaringar inom biologinbehöver det inte betyda att någotär rätt och riktigt.Att män har högre löner än kvinnorkan följdaktligen ses som ett primitivtuttryck för att de faktiskt vill behålla1873 Efter en hård riksdagsdebatt får kvinnortillträde till akademin. Studier i juridik undantasfrån beslutet.1880 Första kvinnliga studenten vid Lundsuniversitet.1883 Ellen Fries blir den första kvinnan somdisputerar i Sverige.1897 Elsa Eschelsen blir den första kvinnligadocenten i Sverige.1925 Efter ändringar i behörighetslagen fårkontrollen över kvinnornas sexualitet.– Man skulle kunna likna det vidpåfågelhannens fina stjärtfjädrar, sa NilsUddenberg.Den liknelsen gillades inte av AgnesWold som tyckte att han trivialiseradefrågan.– Man kan inte tala om människorslika värde så länge de inte får samma lönför samma arbete.Det höll Nils Uddenberg med ommen poängterade också att det kan finnasbiologiska förklaringar till att mänoch kvinnor väljer olika yrken.– Problemet uppstår när vi värderar”kvinnoyrken” lägre än yrken som väljsav män.Kvinnorna tjänar mindreBland Lunds doktorander, forskare ochlärare tjänar kvinnorna mellan 100 och2000 kronor mindre sina manliga kollegertrots att de har samma befattning.– Vi håller just nu på att analysera omlöneskillnaderna är försvarbara ellerinte, säger universitetets jämställdhetshandläggareKajsa Widén, som tillsammansmed ledningsgruppen för jämställdhetsarbetetvid LU arrangeradejämställdhetskonferensen.ULRIKA OREDSSONFOTNOT: Vid konferensen som höll på i tvådagar medverkade även Anna-Klara Bratt, tidningenArbetaren, Sigbrit Franke, Högskoleverket,Hillevi Ganetz, Linköpings universitet,Pernille Gooch, Lund, Lars Jalmert, Stockholmsuniversitet, Ann Numhauser-Henning,Lund, Tiina Rosenberg, Stockholms universitetoch Torbjörn von Schantz, Lund.Viktiga årtal för kvinnors inträde i akademinkvinnor rätt att söka professurer.1927 Kvinnor får rätt att ta studentexamen vidallmänna läroverk.1949 Gerd Enekvist vid Uppsala universitet blirden första kvinnliga professorn i Sverige.1964 Carin Boalt blir den första kvinnliga professornvid LTH (som då inte tillhörde Lundsuniversitet).1965 Birgitta Odén blir den första kvinnligaprofessorn vid Lunds universitet.8


Intresset för spanskaär stort. Mendet är inte baraspråket som lockarutan även kunskaperom den spansktalandevärlden.Vid Romanska institutionenharInger Enkvistman försökt tänkaom, och till våren startar ett nytt programi Latinamerikakunskap och enkurs om spanskt arbetsliv.– Det har länge funnits ett sug efter mersamhällsinriktade kurser, säger professorni spanska Inger Enkvist. Spansktalandelärare vid universitetet har underflera års tid bett mig att starta något,men först nu har det äntligen blivit av.Latinamerikaprogrammet börjarmed 20 poängs nybörjarstudier på halvfartunder kvällstid. Därefter följer entermins heltidsstudier med ekonomiskSamhällskunskap på spanskageografi, ekonomisk och social utvecklingoch latinamerikansk populärkulturpå schemat.– Kurserna ska ha en hög akademisknivå eftersom lärarna har disputerat i deämnen de ska undervisa i, säger IngerEnkvist. Programmets sista 20 poängkommer återigen att ges på halvfart ochdå är det bland annat latinamerikanskidéhistoria, historia och identitet somstuderas. Tanken är att utbildningen skagå att kombinera med andra studier.Inger Enkvist tror att det finns ettbrett intresse för det nya programmet.– Dels har våra ordinarie språkstudenterofta ett stort samhällsintresse,men vi tror också att kursen kommer attlocka barn till latinamerikaner bosattai Sverige, svenskar som vill jobba i Latinamerikaoch utbytesstudenter.När kursdeltagarna går den tredjeterminen kommer den språkliga svårighetsgradenatt motsvara spanska på 40poängsnivå. Det nya latinamerikaprogrammetär dock inget alternativ förden som går lärarutbildningen. Däremotkan det fungera som en energiinjektionför trötta språklärare, tror Inger Enkvist.Även de studenter som föredrar Spanienframför Latinamerika kan få sittlystmäte till våren.– Det har blivit otroligt populärt attjobba i Spanien och i vår ger vi en tiopoängskursi spanskt arbetsliv i samarbetemed Madrid-universitet, EscuelaContemporanea de Humanidades, berättarInger Enkvist. När kursen är avslutadkommer studenterna att erbjudastio veckors praktik på företag medsvensk anknytning i Madrid med omnejd.Målet är att studenterna ska kunnafungera i en spansk arbetsmiljö.Kursen och praktiken ska utgöra sistadelen i ett program om spanskt arbetslivsom man i sin helhet inte kommer attkunna söka till förrän nästa höst.ULRIKA OREDSSONFull fart på bygget avmedicinska CRC i MalmöNu ska Lunds BMC, Biomedicinskt Centrum,få en motsvarighet i Malmö somförenar klinisk och experimentell forskning.Motsvarigheten heter CRC ochstår klart om några år. Nyligen lades”första stenen” till bygget av detta ClinicalResearch Center som ska rymmalokaler för laboratorier, patientmottagning,bibliotek, studenter med mera.Bygget av CRC började planeras år2000 av Lunds universitet och RegionSkåne, och den första etappen ska varafärdig år 2005. Det har alltså gått snabbt– så snabbt att man, som chefsläkaren vidUniversitetssjukhuset MAS Carl-DavidAgardh sa, inte ens haft tid med någontraditionell spadtagsceremoni. Grävskopornaär redan i full gång.Det LUs rektor Göran Bexell ochRegion Skånes regionråd Uno Aldegreni stället fick göra var att lägga ”förstastenen”, en symbolisk sten av cementmed en ingjuten metallplatta vars textberättar om invigningen. Teamet Bexell-Aldegren övervakade gjutningen ifördabygghjälmar, medan en gigantisk cementblandarbilmed tjock slang gjordegrovjobbet.CRC-projektet omfattar tre nyabyggnader och två gamla som ska renoveras.Sammanlagt rör det sig om nära27 000 kvm lokalyta och en kostnad på450 till 500 miljoner kronor. Etapp Iomfattar de nya byggnaderna för grundutbildning,bibliotek och forskningslaboratorier,medan etapp II är tänkt attinnehålla renoveringen av de två befintligabyggnaderna för samhällsmedicin,patientundersökningar och administration.Alla byggnader ska sammanbindasav ett inomhustorg med kafé, restaurangoch reception.Region Skånes Uno Aldegren sågCRC som den enhet som ska göraUMAS till ett fullvärdigt utbildningsochforskningscampus. Alldeles i närhetenligger Wallenberglaboratoriet ochLUs rektor Göran Bexell (t v) och Region Skånesregionråd Uno Aldegren lägger första stenen tillClinical Research Center i Malmö. FOTO: KENNETRUONAMalmö högskolas nya institution förhälsa och samhälle, och ett nyttdiagnostiskt centrum blir klart nästa år.CRC blir basen för de nära 300 läkarstuderandefrån LU som gör sin praktiskadel av utbildningen i Malmö, samtför lika många forskarstuderande ochdessutom sjuksköterskor, biomedicinskaanalytiker och andra grupper.INGELA BJÖRCK9


NYA PROFESSORERFrämre raden:Solveig Melin Petersson, hållfasthetsläraLydia Sorokin, vävnadsbiologiKarin Stjernqvist, tillämpad psykologi sskklinisk psykologiVineta Fellman, pediatrik ssk neonatologiRektor Göran BexellAnita Sjölander, cellpatologiShirley Booth, högskolepedagogikGun Malmgren, litteraturvetenskap meddidaktisk inriktningAndra raden:Rupert Hallman, medicinskinflammationsforskningLars-Gunnar Lundh, klinisk psykologiBertil Johansson, klinisk genetikLars Hermerén, engelska med språkvetenskapliginriktningBo Baldetorp, experimentell onkologiStefan Yard, företagsekonomiIngvar Holmér, klimatfysiologiMats Ohlin, immunteknologiTredje raden:Fredrik Mertens, klinisk genetikBjörn Karlsson, tillämpad solenergiteknikDick Harrison, historiaBjörn Martinson, musikteoriFredrik Andersson, nationalekonomiJan Eric Larsson, informationsteknologiLars-Olof Nilsson, byggnadsmaterial”Det krävs en nationellsatsning på forskningen”Den 10 oktober fick universitetet 23nya professorer. Av dessa är åtta medicinare,tre humanister, fem samhällsvetare,sex teknologer och en professor imusikteori från det konstnärliga området.Det handlade förstås mycket om forskningnär rektor Göran Bexell välkomnadede 23 professorerna till deras nyaämbeten.Han talade om behovet av en nationellsamling kring ökade satsningar påforskningen. Han tog upp användningenav forskningsresultat till samhälletsgagn som han menade är underutveckladi vårt land.– Men det ska bli bättring, lovaderektor, och berättade om LU Innovationsom tillsammans med Vinnova ska generera150 miljoner kronor på sex år. Helainnovationskedjan från idé till företagska utvecklas.– Det blir nya professurer, ny utbild-ning och ökad information och serviceunder hela processen från idé till företag.Rektor glömde dock inte den akademiskaintegriteten.– Allmänheten ska kunna lita på atten forskare eller lärare vid ett universitetinte är styrd av speciella intressen, avläkemedels- eller tobaksföretag, politiskaeller religiösa rörelser.– Om universiteten skyddar sin integritetfår de också en vitaliserande samhällseffekt,betonade Göran Bexell.ApplåderJan Eric Larsson, ny professor i informationsteknologifick applåder för sitttacktal till studenter och lärare. Hanfilosoferade bland annat kring titelnprofessor:– Den tillåter oss att uttala oss medyttersta kompetens om vad som helst.Är man professor så vet man, konstateradehan.ML10


Kvinnornas installationAv de 23 nya professorerna är sju kvinnor.Det är nästan en tredjedel vilket ärunikt i installationssammanhang.– En slump, menade Göran Bexell, –men i alla fall, en lycklig sådan. Och universitetetarbetar medvetet för att fåfler kvinnliga professorer.Två av kvinnorna samarbetar över ämnesgränsernakring för tidigt föddabarn. Karin Stjernqvist, ny professor iklinisk psykologi och Vineta Fellman,ny professor i pediatrik (se reportagesidan III).Ytterligare två medicinare är AnitaSjölander, ny professor i cellpatologi ochLydia Sorokin, ny professor i vävnadsbiologi.LTHs stora institution för maskinteknologimed sex avdelningar har fåttsin första kvinnliga professor, SolveigMelin Petersson i hållfasthetslära.Lunds första professor i högskolepedagogikblev Shirley Booth, verksamvid Pedagogiska institutionen och föreståndareför nätverket Lärande Lund.Nya professorn i litteraturvetenskap,Gun Malmgren,höll installationsföreläsningen(seseparat intervju sidanXVI).MLYngsta damen på”kvinnoinstallationen”satt i pappas knä blandåhörare, nära och kära.En fika vid samlingen före klädombytet. VinetaFellman, Lydia Sorokin och Shirley Booth passar påatt tittar på sina artiklar i installationsbroschyren.Så ska den fotsida talaren krånglas på. Det är ingaproblem för nya professorn i högskolepedagogik,Shirley Booth.Färdigklädda – i väntan på att bli professorer!FOTO: KENNET RUONAPer-Erik Ljung, Eva Lindell-Frantz ochTorgny Roxå. FOTO: KENNET RUONAPrisadepedagogerLUs pedagogiska pris på 15.000kronor delas varje termin ut tillpersoner som utmärkt sig försina pedagogiska insatser.I höst går priserna till docentPer-Erik Ljung vid Litteraturvetenskapligainstitutionen och tillpedagogiska konsulten TorgnyRoxå vid Utvecklingscentrumför lärande och undervisning(UCLU).Per Erik Ljung har varit lärarei litteraturvetenskap sedan1970-talet och uppmärksammasför den energi som han mobiliserarför att förnya utbildningenoch det engagemang hanlägger ner på att stödja studenternaslärande.Modell för andraTorgny Roxå har byggt uppLTH:s pedagogiska utbildning,som även tjänat som modell förandra utbildningar. Han harmedverkat till att förändramånga lärares förhållningssätttill pedagogik vilket satt igång enlång rad pedagogiska utvecklingsprojekt.Studenternas pedagogiskapristagare är universitetslektorEva Lindell-Frantz på Juridicum.Hon är kursansvarig för termintvå på juris kandidatprogrammetoch får priset för att hon levandegörundervisningen på ettvärdefullt sätt. Hon delar medsig, lika mycket av sina lyckadefall som av sina misslyckanden,en egenskap som tyvärr är alltförovanlig hos föreläsare, motiverarstudenterna.11


Hur ska Medicinska fakulteten utvecklas i framtiden? Det diskuterasjust nu livligt med utgångspunkt från den s k Bell-rapporten, skrivenav Oxfordprofessorn John Bell. Rapporten har orsakat en flodav inlägg på en webbsida som satts upp enkom för detta.Bell-rapporten orsakarfloder av debattinläggBell-rapporten (se LUM 5/03) utmynnari flera delvis kontroversiella rekommendationer.Fakulteten är för stor och föråldrad,menar Bell-gruppen bland annat.Anställda över 55 år bör kunna gesförtida pension så att det blir pengaröver för fler post doc-tjänster. Samtidigtborde antalet doktorander, nu ca 900,minskas.De s k ALF-medlen, som anslås till kliniskforskning på universitetssjukhusen,borde enligt rapporten spridas mindrebrett än idag. De borde också kunnasökas även av icke-kliniker som gör”translational research” (forskning somöverbrygger gapet mellan vård och laboratorium).Förslagen att minska i toppen ochbotten har berörts i en del av de över 40inlägg som kommit in till diskussionssidanmed adress www.medfak.lu.se/personal.php. Skulle det verkligen lönasig med förtida avgång, undrar t exUnga forskare har fått en röst– Vi vill föra fram de yngre experimentellaforskarnas röst inom Medicinskafakulteten. Detta är viktigt inte minstnu, när fakulteten troligen står införstora förändringar.Det säger fysiologen Maria Gomez, enav initiativtagarna till NYES, Networkof Young Experimental Scientists. NYESbildades i våras, då gruppen uppvaktadeVetenskapsrådet och Medicinska fakultetenmed skrivelser om de yngre forskarnassituation i Lund (se LUM 6/03).I skrivelserna påpekades bl a att ungefärhälften av de nära 800 forskarnavid Medicinska fakulteten saknar fasttjänst, något som särskilt drabbar deyngre forskarna. Det finns också inomöverskådlig tid mycket få nya tjänsterför dessa yngre forskare att söka. Dennågra skribenter från Yrkesmedicinskakliniken – skulle det inte bara ge enmycket obehaglig situation och dåligstämning? Att minska antalet doktoranderär däremot en tanke som får ettvisst stöd.Mest engagemang ägnar skribenternaåt Bell-rapportens möjliga följder förklinisk forskning. Kliniska forskare ibåde Lund och Malmö har upprörts avförslagen om ändrade regler för ALFmedlen.En sådan förändring skulle försvagaden redan hårt åtgångna kliniskaforskningen och på sikt hota både sjukvårdensoch undervisningens kvalitet,menar man. Det talas om ”djup oro”och att resultaten ”på lång sikt torde bliförödande”.Alltför vinkladFlera inlägg påpekar också att Bell-gruppeninte är allsidigt sammansatt: gruppenkommer från samma lärosäte ochhör åtminstone delvis hemma inomåldersmässigt ”övertunga” organisationenvid Medicinska fakulteten har ävenkritiserats i Oxfordrapporten.Debatt om yngres karriärSedan sommaren har NYES haft ettmöte där man valt en styrgrupp och startaten hemsida (www.medfak.lu.se/future_faculty/nyes). Man planerarockså en paneldebatt den 6 novemberom yngre medicinska forskares karriärmöjligheter.Mötet ska ledas av professorPatrik Brundin, och dekanus ochprodekanus för forskning är inbjudna.Att tala för de yngre experimentellaforskarnas sak, inte minst i sambandmed diskussionerna efter Oxfordrapporten,är en av de uppgifter NYES åtagitsig. En annan är att föra ut debattenom den medicinska forskningens fram-området molekylär medicin. Därför ärrapporten enligt kritikerna alltför vinkladmot den biomedicinska, pre-kliniskaforskningen, och inser inte fakultetensplikter gentemot både den kliniskaforskningen och läkarutbildningen (sombehöver forskarutbildade läkare somlärare).Även den pre-kliniska forskningenborde för övrigt ta avstamp i den kliniskaverkligheten, påpekar sjukhusledningenvid Universitetssjukhuset iLund. Man borde utgå från ”frågeställningarom olösta kliniska problem,sjukdomars epidemiologi, diagnostik,behandling, uppföljning och omvårdnad.Styrkan i en medicinsk fakultetborde ligga i att de kliniska problemenkan bearbetas även med preklinisk metodologi”,skriver ledningen, där bl aprofessorerna Leif G Salford, IngemarIhse och Karin Prellner ingår.Omöjligt att förutsägaAtt satsa mer på färre forskargrupperoroar också. Om fakulteten går in förnågra få områden, så är risken stor attman missar oförutsägbara upptäckterfrån andra håll.“Nu som alltid är det omöjligt attförutsäga framtidens medicinska genombrottoch inom vilka forskningsområdende kommer att inträffa. Flera avLunds kliniskt mest betydande innovationer,som ultraljud, dialys, modernMaria Gomez är med och för de unga forskarnastalan. FOTO: MARIA LINDHtid till allmänheten, och en tredje uppgiftär att hålla medlemmarna informeradeom nya tjänster, stipendier etc.NYES ingår i det större nätverk somkallas Future Faculty, ett nytt forum föryngre forskare vid Medicinska fakulteten.Förhoppningsvis kommer ävenunga kliniska forskare och vård-12


espiratorvård och goda röntgenkontrastmedelär sprungna ur på sin tidej prioriterad forskning”, skriver enrad professorer från KPRE-institutionen,bl a Bertil Olsson, Björn Jonsonoch Göran Hermerén.Berömmer ledningenSom en positiv notering kan nämnasatt många inlägg berömmer Medicinskafakultetens ledning för att den velatta upp en diskussion om fakultetensinriktning. Möjligen är också motsättningenmellan klinisk och pre-kliniskforskning, när turbulensen väl lagt sig,inte lika stark som den verkar just nu.Det tror i varje fall professorn i molekylärpatogenes Lars Björck:”Något som har förvånat mig i debattenär polariseringen mellan kliniskoch experimentell forskning. Det finnsi medicinsk forskning inget motsatsförhållandemellan grundforskningenskrav på hög abstraktionsnivå och denpatientnära forskningens mer konkretaresultatinriktning. Tvärtom visar all erfarenhetatt det är i gränsytan mellandessa arbetssätt som många av de storakliniska genombrotten har kommit”,skriver han.Debatten går nu vidare både på nätetoch i form av två stora personalmötenpå Scandic Hotell 23 oktober,dit hela fakulteten blivit inbjudna.INGELA BJÖRCKvetenskapsforskarna att bilda sammanslutningarliknande NYES inomdenna ram. Future Faculty är tänkt attutgöra ett debattforum och en informationskanalsamt ta del i mentorsutbildningoch karriärrådgivning.Future Faculty i sin tur är ett resultatav utvecklingsprogrammet LeKA,Ledarskap i en Kreativ Akademi (seLUM 2/02). Inom LeKA har äldre ochyngre forskargruppsledare fått åta sigett visst uppdrag (den tredje LeKAomgångenhade just skapandet avFuture Faculty i uppdrag) samtidigtsom man arbetat med frågor omkonflikthantering, utveckling och samarbete.LeKA-programmet har hittills drivitsmed en ny omgång per år, men intressethar varit så stort att det troligenkommer att dubbleras.INGELA BJÖRCKVad vet vi om diabetes?Vad är det vi vet, och vad är det mer vibehöver veta inom diabetologins område?Och hur ska enskilda läkare kunna fåfotfäste i den strida strömmen av forskningsrapporteroch avgöra vad som ärvetenskapligt pålitligt att gå efter?Om dessa frågor handlade en diabeteskonferensnyligen i Malmö, anordnadav Svensk Förening för Diabetologi.Temat var evidensbaserad diabetologi,dvs vård byggd på vetenskapligt beprövaderfarenhet. Mats Eliasson från Luleåredogjorde bl a för den evidensbaserademedicinens principer och gavtips på hur de kan tillämpas.Men hur pålitlig är egentligen dennavetenskapligt beprövade erfarenhet? Detundrade mötets utländske gästtalareprofessor Harold Lebovitz från NewYork. Han hade åtagit sig rollen avifrågasättare, och visade många exempelpå brister även i till synes korrekt planeradeoch utförda undersökningar.I kliniska studier kan forskarens subjektivauppfattningar påverka urval ochutgångspunkter, medvetet eller omedvetet.Stora epidemiologiska studier verkarsäkra, men är det inte alltid. Östrogent.ex tycktes enligt de första studiernahindra inte bara klimakteriebesvär utanockså många andra problem, men visarsig nu tvärtom öka risken för bl a hjärtkärlsjukdomar.”The gold standard”, den säkrastetypen av studier, är stora s k blindstudierdär patienterna slumpats till antingenbehandling eller placebo. Sådana studierhar å andra sidan nackdelen att de tartid att slutföra.– Om vi skulle väntat på svaret frånstudier enligt ”the gold standard” innanvi började använda insulin, så hademängder av patienter dött för oss! saHarold Lebovitz.Han är inte emot evidensbaseradmedicin, utan ville bara framhålla viktenav att kritiskt granska även publiceradeoch till synes säkra forskningsresultat.På diabetesområdet har forskningenkommit långt på senare år. Men vad ärdet vi inte vet och skulle behöva veta?frågade Peter Nilsson, universitetslektori medicin och en av arrangörerna avkonferensen. Han gav själv några exempelpå obesvarade frågor:– Hur bra är på lång sikt de nya ochdyra medicinerna glitazoner?– Kan gruppvård i ”diabetesskolor”,som förekommer bl a i Malmö, ge likagoda resultat som individuella mötenmellan patienter och läkare/sköterskor?– Vilka bevis finns det för att medvetenviktminskning hos feta diabetespatienter,som ju brukar uppmanas attgå ner i vikt, verkligen minskar riskenför hjärt-kärlsjukdom och död?Just hjärt-kärlsjukdomar har uppmärksammatsallt mer i samband meddiabetes. Peter Nilsson tror att den traditionellafokuseringen på socker – ettarv sedan 1600-talet, då läkarna smakadepå de ”sockersjukas” urin och fannden onormalt söt! – kanske lett tankarnafel. Förändringar i blodfetter, blodtryckm m visar sig uppkomma långt innan enpatient får de typiska diabetessymtomen,vilket tyder på att sjukdomenkanske skulle kunna motverkas på etttidigare stadium.På grundforskningssidan har manfunnit vissa gener som ökar risken fördiabetes, men det finns inga enkla samband.– Diabetes är en sjukdom där mångagener och många faktorer är inblandade,förklarade professorn i endokrinologiLeif Groop. Han är en av författarnatill en studie som publicerades iNature Genetics i somras, och somhandlar om en av dessa gener.– Men för att sjukdomen ska brytaut krävs också rätt – dvs ”fel” – miljöoch livsstil. Generna i sig räcker inte.Professorn i endokrinologiLeifGroop menade attmiljö och livsstilhar stor betydelseför diabetes.INGELA BJÖRCK13


Fortbildningsdagardrar lärare till LUCirka 160 högstadie- och gymnasielärareinom naturvetenskap kommer tillLund den 27 till 29 oktober för att deltai årets Vetenskapsdagar inom naturvetenskap.Den 27 oktober är det tvåfortbildningsteman som tas upp, ”Kostoch hälsa – ny nutidsmat och gammalstenålderskost?” samt ”Mobiltelefoni”,det senare i samarbete med Resurscentrumför fysik och med tonvikten påradiofysiska frågor.Den 28 oktober presenteras keminsidéhistoria med experiment samt ”Marinbiologii Öresund”, något som ocksåinnefattar en exkursion med marinbiologernasforskningsfartyg Sabella.Den 29 november är ämnet ”Förutsättningaroch möjligheter för liv i universum.”– Deltagarna kommer i huvudsakfrån södra Sverige men vi har också endel långväga gäster, t ex från Kungälv,Visby och Gävle. Intresset för de olikainslagen är rätt jämnt fördelat med ca50–70 anmälningar per fortbildningskurs– detta med undantag för denmarinbiologiska kursen där vi vi harbegränsat deltagarantalet till ett mindreantal platser. Somliga deltar i mer än enkurs, berättar Anna-Maj Balsberg-Påhlsson på Naturvetenskapligafakultetens kansli som håller i Vetenskapsdagarna.GÖRAN FRANKELOm vårdforskning”Morgondagens vårdforskning” är tematför en kongress i Lund den 4–5 november.För arrangemanget står Vårdalstiftelsen,KI, Nationella forskarskolani vård och omsorg samt Vårdalinstitutet,som finansieras av Vårdalstiftelsen,Göteborgs och Lunds universitet,Västra Götalandsregionen ochRegion Skåne.Kongressen riktar sig till doktorander,juniora forskare och alla som ärintresserade av pågående vård- ochomsorgsforskning i Sverige. Denna beskrivsi föredrag och posterpresentationersom handlar om bl a barn medkronisk artrit, äldre människors syn påvårdens prioriteringar, fall och benbrottbland ”äldre-äldre” och problemförlossningarsinverkan på mödrarnas inställningtill fler graviditeter.Svåra men intressantamatteproblem vid LTHOmkring 200 gymnasieeleverfrån Ystad till Malmbergetbesökte Lund och LTH:skårhus den 10 och 11 oktober.För andra året i rad stodMatematikcentrum värd förSonja Kovalevskydagarna.Eleverna var utvalda av sinaskolor för sitt stora matematikintresseoch i Lund blevdet verkligen två heldagarkring matte.Professor Peter Jones frånYale berättade på svenska (!)om hur matematiken kanlösa problem genom att”söndra och härska”, d v s dela uppstörre problem i mindre.– Rätt svårt men intressant, kommenteradeMarkus Andersson från Jönköping,Förutom en rad föredrag ägnade sigungdomarna åt att med faddrar frånMatematikcentrum se film, demonstrationer,datorprogram, en matematikhistoriskbokutställning från Uppsala(historieprofessor Staffan Rodhe deltog)och inte minst att lösa problem.Arrangör är Vetenskapsakademiensnationalkommitté för matematik samtSvenska matematikerförbundet. Spons-När borden avsedda för problemlösning tog slutslog sig ungdomarna ner på golvet med sinablock. Och lärarna med professor Gunnar Sparr ispetsen njöt.rade gjorde bl a Ericsson och IdeonföretagetDecuma, landets största privataarbetsgivare för matematikdoktorander.Ma-tema-tikEn cd-rom som försöker förklara detfascinerande och användbara i matematikenhar fabricerats av Matematikcentrum.Den delades ut till gymnasisternapå Kovalevskydagarna.Här har författarna Claus Führer,Lena Zetterqvist, Klas Modin och MarioNatiello valt att förklara hur populationsdynamik(t ex antalet fiskar i en sjö)kan studeras med hjälp av differentialekvationeroch differensekvationer ellerstokastiska (statistiska) metoder.Den intresserade kan prova att självlösa några ekvationer och fundera påhur man kan bedöma om det går att litapå resultatet.Hur rör sig en orm? Den frågan kanman studera med modellering och endifferentialekvation. CD:n är produceradav Madeleine von Hausswolff ochMaria Hedberg vid UCLU.TEXT & FOTO:MATS NYGRENPeter Jones är en livlig och engagerad föreläsare.14


Lund knyter avtal medkinesisk forskningsakademiLunds universitet har skrivit under ettutbytesavtal med Kinas SamhällsvetenskapligaAkademi, som besökte LU meden delegation i oktober. Avtalet handlarom utbyte på doktorand- och forskarnivå.– Det är första gången som vi har ettutbyte med en kinesisk forskningsakademi,säger Henrik Hofvendahl,som är Asienhandläggare på Internationellasekretariatet.I Kina skiljer man på universitet ochakademier. Enligt de traditionella uppgifternaska universiteten utbilda,medan akademierna står för forskningen.– Nu för tiden forskas det även vidflera av Kinas över tusen universitet,men akademierna, som lyder direkt underregeringen, spelar en viktig roll somkommunistpartiets tankesmedja, sägerHenrik Hofvendahl.Ekonomi och demokratiVid Kinas Samhällsvetenskapliga Akademitacklas bland annat frågor om hurKina ska kombinera ekonomisk utvecklingoch demokrati med kommunism.Universitetets samarbete med Finlandska uppmärksammas och stärkas. Den19–20 april 2004 arrangeras Finlandsdagari Lund med fokus på samverkanmellan Finland LU och regionen. Initiativettill detta togs när rektor GöranBexell hade besök av Finlands ambassadöri Sverige Pertti Torstila.– Vi vill öka kunskapen om Finland häroch om Sverige och Lund i Finland.Tanken är också att uppmärksamma detsamarbete som forskargrupper vid LUhar med finska kollegor. Både påEkonomihögskolan, inom Medicinskafakulteten och andra områden har mansamarbete och utbyte av olika slag.Språkämnet kommer naturligtvis attuppmärksammas speciellt, säger GöranBexell.Det är forskning som framför allt statsvetare,ekonomer och sociologer kan varaintresserade av, tror Henrik Hofvendahl.EU-programDet nya avtalet med Kinas SamhällsvetenskapligaAkademi blir särskilt intressanti belysningen av att Lunds universitetnu har ansökt om att få ansvara föruppföljaren till det EU-Kina-programsom var förlagt till LU under åren 1997och 2001. I programmets första omgångstod det kinesiska utbildningsdepartementetsom motpart, men i uppföljareska Kinas SamhällsvetenskapligaAkademi ta över den rollen.Fler avtalÄven på andra områden bygger Lundsuniversitet ut sitt samarbete med Kina.Under oktober månad slöts ett avtalmed universitetet i Nanjing.– Det innebär att vi nu har avtal medfyra av Kinas bästa universitet, sägerHenrik Hofvendahl. De övriga tre ärPeking-universitetet, Tsinghua-universitetetoch Fudan-universitetet.Finlandsdagar nästa årULRIKA OREDSSONEtt önskemål från Finland är att ökautbytet både med LU och regionen.Näringslivskontakter blir därför ett givetinslag i programmet för tvådagarskonferensen.– Universitetets kontakter med Finlandhar historiska rötter. Många kändaLU-forskare kommer från Finland.Helsingfors universitet är ett framståendeuniversitet som vi gärna samarbetarmed. Det gäller också andra lärosätensomt ex Åbo akademi, säger GöranBexell som tillsammans med Finlandsambassad i Sverige ska lägga uppprogrammet för de första Finlandsdagarnai Lund. Tarmo Haavisto, kanslichefpå Samhällsvetenskapliga fakulteten,är också engagerad i arbetet och targärna emot förslag.S.S.Nya alternativför naturvetareHöstterminen 2004 utökas naturvetarprogrammetvid Lunds universitetmed två nya ingångareller utbildningsvägar. Den enaär meteorologi och biogeofysik,den andra en utbildning i miljöochhälsoskydd.Meteorologi och biogeofysik är närbesläktadeämnen eftersom ävenbiogeofysiken handlar om förståelsenav klimatet och båda ligger i ett tvärvetenskapligtgränsområde mellan fysikoch naturgeografi. Biogeofysik handlarockså om hur värme samt kol, vattenoch andra ämnen omsätts i hela detsystem som består av mark, växter ochatmosfär. Det är en ung vetenskap somtillkommit för att ge ett helhetsperspektivpå de komplexa samband som styrförhållandena i naturen.KöpenhamnIngången inleds med ett tvåårigt basblocki Lund. Den som väljer inriktningenmot meteorologi läser sedan itvå eller tre terminer vid Köpenhamnsuniversitet medan den blivandebiogeofysikern kan genomgå hela sinutbildning i Lund.Arbetsmarknaden för meteorologerser ljus ut då stora pensionsavgångar ärförestående. Arbetsgivare är de nationellabiologiska institutionerna i Nordenmen också en växande marknad för privataföretag med behov av meteorologiskexpertis, exempelvis inom jordbruksochtransportsektorn. Biogeofysiker kanarbeta på statliga verk som SMHI ochNaturvårdsverket, inom industri, inomklimat- och energisektorn samt inomskogs- och jordbruksnäringen.Utbildningen i miljö- och hälsoskyddriktar sig till den som vill arbeta medsådana frågor inom företag och myndigheter,exempelvis som miljö- ellerhälsoskyddsinspektör. I utbildningeningår förutom miljövetenskap bl a kurseri samhällsplanering och förvaltning,djurskydd, miljökemi, toxikologi, livsmedelshygien,miljömedicin ochhälsoskydd. Utbildningen omfattar 180poäng, dvs 60 poäng mer än en naturvetenskapligkandidatexamen.GÖRAN FRANKEL15


irgitta.borafia@soch.lu.se. Se även:www.soch.lu.seSocialhögskolan i Lund ger kursenSOA 203 Magisterkurs i socialtarbete, 20 poäng, med start1 januari 2004. Info 046-2229415el Hans.Sward@soch.lu.se. Se ävenwww.soch.lu.seSvenska Läkaresällskaptet delarut stipendier.Svenska Läkaresällskapet delar årligenut stipendier till medicine studerandevid Karolinska institutet samt Lundsoch Uppsalas universitet som ”visatsärskild flit och gott resultat och harekonomiska svårigheter”. Ansökanskall vara Svenska Läkaresällskapet,Box 738, 101 35 Stockholm, tillhandasenast den 15 januari 2004 och innehålla:forskningsuppgifter, om studieavbrottskett eller forskningenhindrat förvärvsarbete under feriereller liknande, ekonomisk deklarationsamt studieresultat. För merinformation, 08-4408887,eva.kenne@svls.se. Se även:www.svls.seForskarutbildning i socialt arbetevid Lunds universitet.Doktorander kommer att antagas tillforskarutbildningen i socialt arbete.Utbildningen omfattar 160 poäng ochleder fram till filosofie doktorsexamen.Ansökan på särskild blankett skallvara Socialhögskolan tillhanda senast15 nov. Info 046-2229389 el19 nov: Konferens ”Av liv och avdans och om mat för gamla”. Omforskningsprogrammet Kultur i vårdenoch vården som kultur. Plats: Medicinhistoriskamuseet, hörsalen, Karolinskasjukhusets område, Stockholm.Info 08-6906930.Av utrymmesbrist har LUM inte någoninformation om stipendier & forskningsanslag.Aktuella listor hittasdäremot på www.eken.lu.se/stipendieroch www.lu.se/intsek/EU:eu.htmlUtbildningsbidrag i biologi, inriktningmot genetik. Ref nr 571, ans3 nov. Info 046-2227857.Utbildningsbidrag för nyantagningav en doktorand i litteraturvetenskap(film och medier) / medieochkommunikationsvetenskap.Ref nr 4373, ans 3 nov. Info 046-2228487.Universitetslektor i svenska språket.Ref nr 4927, ans 7 nov. Info 046-2229606.Universitetslektor i nordiska språkalternativt svenska språket. Refnr 4926, ans 7 nov. Info 046-2229606.Universitetsadjunkt i svenska språket.Ref nr 4925, ans 7 nov. Info 046-2229606.Universitetsadjunkt i svenska språket,50%. Ref nr 4924, ans 7 nov.Info 046-2229606.Forskarassistent i historia. Ref nr4923, ans 7 nov. Info 046-2227955.24 okt:Mikael Gyllström i limnologi:”Ecology of zooplankton communities:climate, dormancy and benthicpelagiccoupling”. Kl 10.00 i Blå hallen,Ekologihuset, Lund. Anna Stenstami fysikalisk kemi: ”Association andinteractions in proteinsurfactantsystems”. Kl 10.15 i hörsal B, KC,Lund. Madis Kiisk i kärnfysik:”Improvement of the ams-techniqueand applications to 3 hand 59 nimeasurements”. Kl 10.15 i föreläsningssalB på Fysiska institutionen,Lund. Liv Nilsson Stutz i arkeologi:”Embodied rituals & ritualized bodies.Ritual practices in late mesolithicburials”. Kl 10.15 i Carolinasalen,Kungshuset, Lund. Annika Nilssoni trafikteknik: ”Utvärdering avcykelfälts effekter på cyklisters säkerhetoch cykelns konkurrenskraftmot bil”. Kl 10.15 i hörsal V:A, JohnEricssons väg 1, Lund. Per Gustafsoni infektionssjukdomar:”Epidemiological aspects oftuberculosis in Guinea-Bissau, WestAfria”. Kl 09.00 Patologiska institutionensföreläsningssal, UMAS, Malmö.Annons16


25 okt:Erik Nordenström i kirurgi: ”PrimaryHyperparathyroidism aspects on skeletalinvolvement and PTH levels aftersurgery”. Kl 09.00 Carolinasalen,Kungshuset, Lund. Eva Westin ifranska: ”Le récit conversationnelen situation exolingue de français –Formes, types et fonctions”. Kl 10.15i sal 201, Institutionen för kulturvetenskaper,Lund. Monica DofsSundin i litteraturvetenskap (filmoch medier): ”Rödluvan i filmenstidsålder – sagospår och filmversioner1901– 2001”. Kl 10.15 i Edens hörsal,Lund.29 okt:Nadia Ljungberg i kemisk teknologimed inriktning mot poly-merteknologi:”Plasticized Poly (latic acid)Films”. Kl 10.15 i sal B, KC, Lund.30 okt:Helene Jönsson i radiofysik:”Radioiodine therapy of hyperthyroidism”.Kl 10.15 i Wallenberglaboratoiretsföeläsningssal Medelhavet,ing 46, MAS, Malmö.31 okt:Rebecka Johansson i experimentellklinisk farmakologi: ”Regulationof inducible nitric oxide synthaseconsequences in experimental modelsof bladder disease”. Kl 09.00 i föreläsningssal3,Centralblocket, Lund.Urban Rydin i finansrätt: ”Inkomstav näringsfastighet i enskild näringsverksamhet– arbetsinkomst eller kapitalinkomst?”.Kl 10.15 i Carolinasalen,Kungshuset, Lund. Arieh Coheni analytisk kemi: ”Investigation ofmodified cellulose and starch viahydrolysis and mass spectrometry”.Kl 13.15 i hörsal B, KC, Lund. BjörnNilsson i arkeologi: ”Tingens ochtankarnas landskap. Försök i naturrumgängetsarkeologi med exempelur Blekinges och Smålands förflutna”.Kl 10.15 i Kulturens hörsal, Lund..7 nov:Claes Thelander i fasta tillståndetsfysik: ”Quantum devices fromthe assembly of Zero- and one-dimensionalbuilding blocks”. Kl 10.15 ihörsal B, Fysiska institutionen, Lund.11 nov:Eva-Lotta Grantén i etik: ”Patternsof Care: Relating altruism insociobiology and the Christian traditionof agape”. Kl 10.15 i Samarkand hörsal,AF, Lund.15 nov:Stig Fred i gamla testamentetsexegetik: ”Varför säger Herren så?Profeterna, kontexterna, retoriken.En jämförelse mellan Amos ochMalaki”. Kl 10.15 i Palaestra hörsal,universitetsplatsen.Följande disputationer har ägt rum:Ylva Hellström i vårdvetenskapmed inriktning omvårdnad: ”Qualityof life in older people receiving adlhelp. Help, help providers, andcomplaints”. Anna Bjurman i teoretiskfilosofi: ”Empty names andreference”. Micael Runnström i naturgeografi:”Land degradation andmitigation in northern China. Evaluatedfrom the biological production”. HelenaWesterdahl i zooekologi:”Avian mhc: variation and selectionin the wild”. Peter Björk i radiofysik:”Absorbed dose determinationand characteristics of degradedelectron beams”. David de Léon ikogni-tionsforskning: ”Artefactualintelligence: The development anduse of cognitively congenial artefacts”.Miloslava Slavíìková i slaviskaspråk: ”Bohumil Hrabals litterära collage”.Terrence François Heathfieldi experimentell ortopedi: ”Thecollagen fibrillar network: SequentialDegradation of its constituents bytissue metalloproteinases”. ElisabetLindqvist i reumatologi:”Rheumatoid arthritis in a 10-yearperspective. Outcome for patientsfollowed from early disease”.ReidarWinter i kardiologi:”Echocardiography/doppler for theevaluation of coronary artery function,left ventricular diastolic function andthe relationship between early diastolicand systolic function”. Nora Fascettii cell- och molekylärbiologi, sskutvecklingsbiologi: ”The role of Tenaand Ten-m in drosophiladevelopment”. Gerardo González-Martinez i livsmedelsteknik: ”Heat-Induced cell membrane injury ofvegetable tissues”.Annons24-26/10 Konferens. The SecondSSAAPS Annual Conference: Inequlityin East and South-Esat Asia. Arr SSAAPSoch Centrum för Öst- och sydöstasienstudiervid Lunds universitet.Infowww.ace.lu.se/28/10 Öppen föreläsning vid Centrumför Öst- och Sydöstasien studier.Der Janet Sturgeon, The WatsonInstitute for International Studies,Brown University, ”Methods andResults: Discovering Quality Controlin Mengsong China”. Kl 15.15-17.00Java Hall, Scheelevägen 15, Alfa 1,Lund.28/10 Filosoficirkeln. ”Är du fri,lilla vän? – Om kön och sexualiteti samtida genus- och queerteori”, TiinaRosenberg. Kl 19.30 i universitetetsaula. Info 046-197700.29/10 Medicintekniskt ultraljudsmötei Lund. Den 29 oktober är detpå dagen 50 år sedan den förstaekokardiografiska undersökningengenomfördes i samarbete mellan IEdler och H Hertz. På jubileumsdagenarrangeras ett internationellt symposiummed bl a föreläsningar. Plats:Star Hotel i Lund. Info: www.edlerhertz.lu.se29-31/10 Conference. The 2003annual meeting of the Europé Chapterof the HFES ”Human Factors inDesign”. Info: http://utopia.ision.nl/users/hfesec/conf.htm29/10 Philip Sandblom 100 år. Medanledning av att Philip Sandblom skulleha blivit 100 år okt 2003 så anordnarMedicinska fakulteten och GraceS Sandbloms fond en sammankomst.Detta är den första i en serie årligaSandblomföreläsningar inom ”medicinhumaniora-programmet”.Kl 14.00-17.00 aulan i Universitetssjukhuset,Lund.29/10 Seminarium. ”Oroväckandebegär – kvinnor och suvar i denheterosexuella matrisen”, CatharinaLandström, vetenskapsteoretiker,Göteborgs universitet. Kl 14.15-16.00Centrum för genusvetenskap, MagleStora kyrkogata 12 B, Lund. Se även:www.genus.lu.se29/10 Semiotikseminariet: Kritikav Groupe µ:s retorikmodell. Kl 16.15-19.00 på Avdelningen för semiotik,Wrangelhuset, sal 117, Lund.30/10 SGB-seminariet. ”Apors ochbarns bildförståelse”. Kl 16.15-18.00på Avdelningen för kognitionsforskningi Lund. För mer information:www.arthist.lu.se/kultsem/pro/sgb.html30/10 Tvärvetenskaplig föreläsning.Tema: Miljö, Kultur och Utveckling.”Klimatförändringar och människorssårbarhet i ett Nord- Sydperspektiv”,Lennart Olsson, docentoch föreståndare för MICLU. Kl 18.00-19.00 Samarkand, AF, Lund. Se även:www.humecol.lu.se/17


3/11 Forskningens Dag i Lund. Tematär ”Barn och handikapp”. Kl 14.00-18.00, aulan, universitetssjukhuseti Lund. För fullständigt program:www.medfak.lu.se/forskningens_dag/4/11 Forskningens Dag i Malmö.Temat är ”Barn och handikapp”. Kl14.00-18.00 i Jubileumsaulan,Universitetssjukhuset MAS. För fullständigtprogram: www.medfak.lu.se/forskningens_dag/4/11 Seminarium. ”Hur säker ärlivsmedelssäkerheten?”. ArrLivsmedelskollegiet. Program finnspå www.livsmedelskollegiet.org.4/11 Filosoficirkeln. ”Biologism ellerkulturrelativism?”, Birgitta Tullberg.Kl 19.30 i universitetets aula, Lund.Info 046-197700.5-6/11 Konferens. ”The SwedishNeutron Scattering Society Meeting”.Info http://fy.chalmers.se/~code/snss/5/11 Fakultetsklubben. BimRiddersporre, utbildningsledare Malmöhögskola: ”Att möta det oväntade– tidigt föräldraskap till barn medDowns syndrom”. Kl 12.00-13.00,AF, Nya fest, Lund. Info 046-2223965,070-6769323.5/11 Lunchseminarium. AntoonGeels, professor, Centrum för teologioch religionsvetenskap, ”Undervisningsom ett möte – funderingarkring examination och en pedagogiskprofil”. Kl 12.15-13.00 UCLU:sseminarierum, Tornav. 9b, Lund.6-7/11 Konferens. ”InternationalSymposium on Surface and ColloidChemistry for the Life Sciences”. Infowww.ykoll.fkem1.lu.se6/11 Medicinskt månadsmöte. Kl16.30-17.30 i aulan, Blocket, Lund.11/11 Filosoficirkeln. ”Kan man fattaodemokratiska beslut i demokratiskordning?”, Lennart Lundquist. Kl 19.30i universitetets aula, Lund. Info 046-197700.12/11 Fakultetsklubben. MartinCarnerup, doktorand i yrkes- ochmiljömedicin: Yrkesmedicin och lösningsmedel.Kl 12.00-13.00 AF, Nyafest, Lund. Info 046-222395 el 070-6769323.12/11 Seminarium. ”Att integrerasvenskarna”, Susanne Johansson,kulturgeograf, Kalmar högskola. Kl14.15-16.00 på Centrum för genusvetenskap,Magle stora kyrkog, 12B, Lund. Info: www.genus.lu.se12/11 Semiotikseminariet: Kulturmötenasretorik, Anna RedeiCabak.Kl 16.15-19.00 Avdelningen försemiotik, Wrangelhuset, Lund. Se även:www.arthist.lu.se/kultsem/semiotics/semsem_ht03.htmlAtt leda Akademiska kapellet är ett attraktivt arbete. FOTO: BJÖRN NILSSONMånga vill bli Director MusicesMånga vill bli chef för Lunds universitetsofficiella orkester, dvs AkademiskaKapellet.– Vi har ett starkt startfält, berättarutbildningschef JohannesJohansson som leder rekryteringsgruppen.Det finns 27 seriösa sökande!Under två dagar i mitten avoktober har kandidaterna fått dirigeraoch instruera på prov och ävenintervjuats. Av de 27 sökande ärendast två kvinnor. Men de två externaledamöterna bland de sakkunnigaär kvinnor: dirigenten CeciliaRydinger-Alin och kammarmusikernMarianne Jacobs. Målsättningenär att den nye directormusices ska vara på plats i början avvåren.12/11 Studentafton. Gäst är advokatenoch författaren Leif Silbersky.Kl 19.00 AF, Lund. Info 0709-317990.13-14/11 SGB-seminariet: Minisymposiumom empati, intersubjektivitetoch språk. Kl 16.15-18.00,Institutionen för lingvistik, Absalon,sal 121. Info: www.arthist.lu.se/kultsem/pro/sgb.html13/11 Tvärvetenskaplig föreläsning.Tema: Miljö, kultur och utveckling.”Stenåldersmat, hälsa och humanekologi:en evolutionsmedicinskbetraktelse”, Staffan Lindeberg, meddr. Kl 18.00-19.00 Samarkand, AF,Lund. Se även: www.humecol.lu.se/14/11 Sveriges Neuropsykologersförenings riksstämma. ”Hjärnstimulanspå gott och ont”. Vad är godoch vad är ond stimulans för hjärnan?Hur hjärnan reagerar på olikatyper av stimulans är viktig kunskapinte bara för rehabiliteringen avhjärnskadade utan också för hur vilever och hur vi mår. Slagthuset, Malmö.Info 046-177900, 040-337697 elwww.neuropsykologi.org18/11 Föreläsning. Eva Österberg:”Vänskap som hot och skydd i medeltidensEuropa. En existentiell historia”.Arr: Historiska Föreningen. Kl 18.15Historiska institutionen, sal 3, Lund.18/11 Filosoficirkeln. ”Att kommuniceramed datorer”, Lars Philipson.Kl 19.30 i universitetets aula, Lund.Info 046-197700.19/11 Lunchseminarium. BertilHolmberg, prodekan, Naturvetenskapligafakulteten, ”Hur kommer användningenav ECTS-betygen att påverkaden pedagogiska praktiken?”. Kl 12.15-13.00 UCLU:s seminarierum, Tornav.9b, Lund. Se även: www.uclu.lu.se19/11 Semiotikseminariet: Ikonicitetoch kulturell identitet, Gunnar Sandin.Kl 16.15-19.00 Avdelning för semiotik,Wrangelhuset, sal 117, Lund. Info:www.arthist.lu.se/kultsem/semiotics/semsem_ht03.html19/11 Festsammankomst Fakultetsklubbenfirar 25 år. AF, Lilla salen,Lund. Kl 19.00-21.00. Info 046-2223965 el 070-6769323.21/11 Öppet hus – Inspirationsdag.Biblioteksdirektionen, LärandeLund, UCLU. Tornavägen 9 B, Lund,kl 10.00-16.00.21/11 Seminarium. ”Medicinhistoriskaaspekter på lungsjukdomoch tuberkulos”, doc Peter Nilsson.Arr Enheten för medicinens historia.Kl 13.00-16.00 F1, Blocket,Universitetssjukhuset i Lund. Info 046-173301.25/11 Musikhögskolan Öppet Hus2003. Öppet hus vänder sig såväl tillstudenter och lärare vid kommunalamusikskolor, folkhögskolor, studieförbundoch gymnasieskolor som tillden musikintresserade allmänheten.Se även:www.mhm.lu.se25/11 Filosoficirkeln. ”Scientismoch biologism – reella hot eller nidbilder?”,Dan Larhammar. Kl 19.30i universitetets aula, Lund. Info 046-197700.Historiska Museethar fått ny styrelseLundaprofilen och läkaren StigPersson har utsetts till ny ordförandei Historiska Museets styrelse.Han har tidigare under flera år varitordförande i Akademiska Föreningensstyrelse. Övriga ledamöter imuseets styrelse är Lars Larssonarkeologi, Lena Larsén Kulturen,Hanne Sanders historia och CarlJohan Wassholm som RegionSkåne utsett. En plats i styrelsen ärännu vakant.Under hösten ska även tjänstensom föreståndare för Historiskamuseet annonseras ut, en tjänstsom för närvarande upprätthålls avakademisekreterare Hans Modig.Miljöinstitutethar fått ny styrelseIndustrimannen Sören Gyll, ordförandeför Föreningen Svenskt Näringsliv,och förra talmannen BirgittaDahl blir nya ledamöter i styrelsenför Internationella institutetför industriell miljöekonomi vidLunds universitet. Ny ordförandeblir Lunds universitets prorektorAnn Numhauser Henning.Nomineringar tillVetenskapsrådet…Till Vetenskapsrådets utbildningsvetenskapligakommitté har Lundsuniversitet nominerat professorernaGun Malmgren, litteraturvetenskap,och Shirley Booth högskolepedagogik.….och för elektorsvaltill FASElektorsförsamlingen för FAS(Forskningsrådet för arbetsliv ochsocialvetenskap) utser sju forskarledamöteri FAS styrelse och derasersättare. Ordföranden och övrigaledamöter utses av regeringen.Elektorsförsamlingen har nyligenutsett en valberedning som ska arbetamed att utse forskasarmhälletsrepresentanter i FAS styrelse. LUsrepresentant i valberedningen ärprofessor Olof Rydén.18


Gästprofessori kommunikationGästprofessurer i journalistisk harfunnits några år men inom kommunikationär det en ny företeelsei Sverige. Campus Helsingborg blevförst med en sådan och det är Nils-Ingvar Lundin som under höstenkommer att fungera som gästprofessurvid Insitutet of Communication.Nils-Ingvar Lundin har ett förflutetsom nyhetsjournalist inom SverigesTelevision i Malmö. Han har enjur.kandexamen från Lunds universitetoch har under senare år varitinformationsdirektör för InvestorAB och för Ericssonkoncernen.Om fysikutan matematikVärldens främste läromedelsförfattareinom fysik, Paul Hewittfrån Florida, besöker Lund i november.Han är inbjuden av Fysiska institutionenoch håller ett föredragöppet för alla om ”fysik utan matematik”.Det är den 17 novembermellan 16 och 17 i LTHs kårhusaula.Ny utbildningför socionomer?Högskoleverket föreslår i samarbetemed Socialstyrelsen att dagenstvå yrkesexamina social omsorg ochsocionom i framtiden blir en ny examen.Även om den nya examen fårbeteckningen socionom hämtasinnehållet från båda utbildningarna.HÄNTNY CHEF för Internationella sekretariatetär Caroline Runéus .Honkommer närmast från Alfa Lavaldär hon bland annat ansvarat förden interna informationen. Under90-talet arbetade hon med attbygga upp internationaliseringsarbetetvid högskolan i Örebro.Caroline Runéus tillträder sitt nyaarbete den 1 januari 2004.NY CHEF förStuderandeenhetenblir TarmoHaavisto, nuvarandechef församhällsvetarnaskansli och tidigarestudierektor i nationalekonomi.HEDERSDOK-TOR. Eva FalkNilsson, nu pensioneradpedagogiskkonsult vidLU, har blivit hedersdoktorvidMalmö högskola.Motiveringen är att hon i 30 år arbetatmed all personal vid Odontologiskafakulteten och haft ett avgörandeinflytande på fakultetensverksamhet och utveckling.NY REKTOR vid Södertörns högskolablir Ingela Josefsson som sedanårsskiftet är t f rektor vid sammahögskola.NY REKTOR för Linköpings universitetär Mille Millnert, professor ireglerteknik vid samma universitet.EVA ÖSTER-BERG, professor ihistoria vid LU,har fått det s kGetingepriset på100.000 kronorav Hallands Akademi.TRYGGVE METTINGER, bibelforskareoch professor i GamlaTestamentets exegetik vid Centrumför teologi och religionsvetenskaphar valts till hedersledamot av TheBritish Society for Old TestamentStudies.ORDFÖRANDE.Per GunnarEdebalk professorem vid Socialhögskolanhar utsettstill ordförandei styrelsenför den nybildadeArbetsmiljöhögskolan med PerWickenberg som föreståndare.JONAS TALLBERG, fil dr, har tilldelatsForskarstiftelsens Thedor Adelswärdsminnespris på 50.000 kronor.Han får priset för sin avhandlingsom bl a handlar om icke-efterlevnadav internationella beslut ochöverenskommelser. Han disputeradevid LU i statsvetenskap 1999och är verksam här samt vid Utrikespolitiskainstitutet i Stockholm.LUNDS UNIVER-SITETS HISTO-RISKA SÄLL-SKAP har firat10-årsjubliemSällskapet grundadesden 4 oktober1993 viduniversitetets 325-årsjubileum ochhar bortåt 1.000 medlemmar. Ordförandeär sedan starten förre LUrektornprofessor Håkan Westling.NY FÖRESTÅN-DARE för Centrumför öst- ochsydöstasienstudierhar professorRogerGreatrex blivit.LEGATET på 100.000 kronor urEinar Hansens forskningsfond går iår till språkforskaren Cecilia Falk,docent och lektor vid Institutionenför nordiska språk. I prismotiveringenlovordas hennes forskningom svensk språkhistoria och grammatikmen också hennes undervisning.Cecilia Falk har förutom ettpar år vid högskolan i Kristianstadarbetat vid Lunds universitet sedan1993. Legatet är avsett för en framståendeyngre humanistisk forskareoch går vartannat år till Danmarkoch vartannat till Sverige.HELGE ALBIN, framgångsrik jazzmusikeri Malmö, ledaren för välkändaTolvan Big Band, har utsettstill professor i jazzimprovisation vidMusikhögskolan i Malmö.Humanistdagar igenHumanistdagarna äger rum nästagång 23–25 april 2004 i Köpenhamn,Lund, Malmö och Roskilde.RÄTTELSEI artikeln om Socialhögskolansöppna hus i förra numret av LUMförekom ett omnämnande av enmansjour i Malmö. Denna mansjourheter Kriscentrum för män ochinget annat.Ny kurs i etik startar till vårenEn ny introduktionskurs i etik inrättasnu vid Centrum för teologi ochreligionsvetenskap vid Lunds universitet.Kursen omfattar 1-20 poängoch startar våren 2004. Den ska gegrundläggande kompetens i normativaetiska teorier och argumentationsanalysoch studenterna skaockså få träna förmågan till ett välgrundatetiskt ställningstagandeinom olika aktuella områden. Kursenska vara grund för vidare studieroch uppsatser i etik och utgörabasen i en examen, t ex en fil.kand.teol.kand. eller ekonomie magisterexamen.– Etik har blivit ett modeord. Idag ska alla företag ha en etiskpolicy, sjukvården ha etiska riktlinjeroch politiker ska fatta etiskabeslut. Trots att etik, eller moralfilosofi,är ett av de äldsta ämnensom studerats vid lärosäten världenöver vet vi inte vad som är rätt ochfel i alla lägen, säger Helena Röcklinsbergsom är ansvarig lärare förden nya kursen.Introduktionskursen vänder sigtill dem som är intresserade av attanalysera etiska frågor, vill lära sigolika etiska teorier och sätt att förhållasig till etiska dilemman.19


INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNA • INSIDORNAHav På tröst gång alla glömska!Minnespiller är på vägOm fem – tio år kommer detatt finnas läkemedel motsviktande minne. Både dennormala åldersglömskan ochsjuklig minnessvaghet somvid Alzheimer. Och om ytterligaretjugo år kommer vi attförstå hur minnen bildas ochlagras i hjärnan. Den optimistiskabedömningen gör minnesforskarenEric Kandel somhöll årets Sven Berggren-föreläsningi Fysiografiska Sällskapet.Vid Columbia University leder Kandelen grupp som forskar omminneslagring. Forskarna skiljermellan två sorters minnen– detomedvetna (den som en gång lärtsig cykla tänker inte på det går till)och det medvetna, (t ex att återkallai minnet hur en viss plats serut). De använder havssnigelnAplysia för att förstå hur den”minns” att bete sig inför en fara,och möss för att se hur de minnsplatsen för utfordring. I båda fallenstuderar man de molekylära processernaför minneslagringen föratt se om och hur de sammanfalleri något steg. I båda fallen krävsnybildning av proteiner för att ettminnesintryck ska bevaras.HÄNTEric Kandel i Lund. FOTO: SOLVEIG STÅHLNyckelrollEtt uppmärksammat fynd gäller attett protein med prionliknandeegenskaper – dvs det övergår i ensjälvbevarande form – kan ha ennyckelroll i minneslagringen.– Jag tycker det tyder på attprioner har en normal fysiologiskroll, precis som onkogener. Det ärnär de muterar som de kan utlösasjukdomar, säger Eric Kandel.– Kan man träna upp sitt minne,i väntan på glömskepiller?– Visst. Lär arabiska eller görnågot annat som känns nytt ochlite svårt. Utmana nervcellerna ochlåt dem anstränga sig. Då bildasnya synapser och proteiner.Kandel är född 1929 och fortfarandeaktiv som forskare och resandeföreläsare. Han skrattar ochskojar gärna och han brinner aventusiasm när han presenterarkomplicerade signalkedjor iminnesmaskineriet. Han tyckersynd om sina europeiska kollegorsom anses för gamla vid 65. ”Sådanmisshushållning”.SOLVEIG STÅHL”Det är märkligt att ingenerkänner att vårt system förresursfördelning till utbildningeninnebär en kollektivframgångsgaranti. Att fåbetalt per godkänd studentgör det omöjligt att arbetamed kvalitetsargument.Allt styrs ekonomiskt, menpå helt fel sätt!”Folke Norstad,SULF, Linköping”Om vi menar allvar med mångfaldsambitionernamåste vi frågaoss dels vilken högskola vi ska ha,dels vilken kunskap – annars finnsrisk att det stannar vid retorik. Närjag säger mångfald menar jag allasorters – det gäller kön, ålder ochsocial, etnisk och religiös tillhörighet.Kan inte akademin användasför att hävda ökad demokrati ochjämlikhet – ja, då finns ingen anledningför mig att stanna i denakademiska världen, då har jagannat att göra.”Gunilla Härnsten,universitetslektor i pedagogik,Uppsala universitetVisst behöver vi parapsykologi!Osså vi på sladden blir alltmerövertygad att en professur i parapsykologiär av nöden ochforskningen skulle kunna kastaljus över oförklarliga händelseroch mystiska fenomen, inte barai Lund utan även i högskolevärldeni övrigt.Själva den testamentariskaprofessuren i parapsykologi ärav aktningsvärd ålder och tordeinte ens kunna räknas in ifundraising-gängets framtidskapital.Men oförklarliga ochdärmed angelägna forskningsområdensaknas inte. Varförekar det så spökligt tomt iuniversitetshuset så många årefter det att merparten av dessinvånare flyttat ut till andra lokaler?Vad händer i Carolinasalen,universitetets äldsta lokaloch festsal på 1600-talet? HållerHört på Universitetslärarstämmanden i tysthet på att förvandlastill ett institutionsbibliotek endastför filosofer?Och varför väller det fortfarandefram så mycket spampostur datorerna fast LDC lovatatt stoppa den? Enda skillnadenär att posten är märkt spam ochkommer med ett dygns fördröjning.Hur är det möjligt att enhel fakultet, den medicinska,kunnat undgå att märka attLU:s styrelse har beslutat om ettgrafiskt profilprogram, som intelämnat några som helst spår påfakultetens omgjorda hemsida?Hur kan regeringen ha ettstående uppdrag till Högskoleverketatt kvalitetsgranska nyahögskolors ansökningar om attbli universitet och samtidigt(med ett undantag) med endåres envishet köra över verkets”Har vi för höga förhoppningar påpedagogisk utveckling som enslags generallösning på högskolansproblem? Och kan kraven påpedagogisk meritering kanskekomma att användas som ett vapenmot att anställa vissa lärare?Riskerar vi att förlora den autonomisom vi vunnit genom vårämneskompetens?…Av grundskolan kan vi dra slutsatsenatt detta ”att lära sig attlära” är omöjligt utan adekvatafaktakunskaper. Det finns en riskatt sådant som social kompetensoch kommunikativ förmåga blirmål istället för medel.För att undvika det, och ocksåför att pedagogisk meritering intebara ska bli en pappersmerit, är detviktigt att den stannar kvar inomämnena, att pedagogisk innovationoch förkovran sker där.”Inger Wistedt,professor, pedagog,Stockholms universitetLUM återkommer i nästa nummermed en utförligare rapport frånUniversitetslärarstämman.Osså vi på sladdenavstyrkningar till universitetsupphöjelse?Och hur kommer det sig attman byggt ut högskolesystemettill en nivå, där det saknas studenterpå flertalet högskolor?Kan det ha att göra med attAkademiska Hus årligen levererarin 100-tals friska vinstmiljonertill Finansdepartementet, som levereratkulorna till de byggnadersom nu inte kan fyllas?Nu är det dags att välja nyLU-styrelse och alla sådana valbrukar bjuda på oförklarligheter.Regeringens försöksballongom att en styrelseordförandeskulle kunna rotera mellanolika lärosäten kan bli som”hela havet stormar” med starkainslag av personlighetsklyvning.Det behöver man inte ens varaparapsykolog för att inse.20


▲Forskar på sitt egetskapandeHan gör saker lite bakvänt, tonsättaren HansGefors.Efter tretton år som professor har han gåttoch blivit doktorand.Och efter fem operor för stiliga teatersalongerskriver han nu på ett nytt musikdramatisktverk – för bilradion.Bakom det hela döljer sig en önskan om attta reda på hur musikdramaturgi egentligenfungerar, och att dela med sig av kunskapentill andra.Klockan är ett när LUM stiger in hemma hosHans Gefors i norra Lund. Foxterriern Tintinsprätter runt bland barnskorna i hallen alltmedanhusse ursäktar och visar in i köket där han bjuderpå kaffe och blåbärsmuffins.Det är fortfarande tidigt på dagen för HansGefors. När han komponerar brukar han hålla påfrån nio på kvällen till tre–halv fyra på natten. Dåär han för det mesta i en lägenhet på stan där hankan jobba ifred med synth och hörlurar – ettmåste för nattliga kompositörer som vill hålla sigväl med sina grannar. Sover gör han om morgonenoch förmiddagen. Hustrun får ta morgonruljangsenmed barnet.Just nu delar Hans Gefors sin arbetstid mellanatt skriva ett stycke för Malmö symfoniorkesteroch att vara doktorand vid Musikhögskolan iMalmö, där han hade en tidsbegränsad professuri komposition fram till 2001.– En del professorer har höjt på ögonbrynennär de hört att jag har blivit doktorand. Meninom det konstnärliga området blir man ju professorpå helt andra meriter än inom de akademiskaämnena, påpekar Hans Gefors.Det var först för ett år sedan som det startadeskonstnärlig forskarutbildning vid Lunds universitet.Till skillnad från den traditionella akademiskaforskarutbildningen där resultatet blir en bok,handlar det här om konstnärligt gestaltande verksamhetsom kan redovisas på olika sätt. Samtidigt”För mig som forskaregör det inget om detinte blir något speciellt,processen är juintressant ändå,men som konstnärvore det tristom det inte blevbra.”Efter att ha skrivit femoperor vill Hans Geforsta reda på hurmusikdramaturgiegentligen fungerar.KONSTNÄRLIG FORSKARUTBILDNING• 2002 antogs de första doktoranderna vid det konstnärliga området vid LU(Musikhögskolan, Teaterhögskolan och Konsthögskolan i Malmö).• Idag finns det tre doktorander i musik, två i teater och fyra i bildkonst.• För att antas till forskarutbildningen krävs genomgången konstnärlig högskoleutbildning(eller motsvarande kompetens), yrkeserfarenhet som konstnär,samt en projektplan för doktorsstudierna, vars kvalitet och genomförbarhetbedöms av en antagningsnämnd.• De individuella projekt- och studieplanerna är centrala i utbildningen. Balansenmellan konstnärlig och skriftlig/verbal slutdokumentation kan bli väldigtskiftande, beroende på de enskilda projekten.• Det finns ännu varken fakultetsorganisation eller fakultetsanslag vid konstnärligautbildningar, något som de konstnärliga högskolorna vill ändra på.IX


▲”Målet är göramitt bästa verknånsin!”HANS GEFORSmåste man redogöra för metoder och resultat,men omfattningen av den skriftliga dokumentationenkan variera. Målet är fördjupad konstnärligmognad och medvetenhet hos doktoranden,och en bättre förmåga att dela med sig av kunskaperna.Som framgångsrik operakompositör har HansGefors valt att studera musikdramaturgi, som hantycker är ett försummat ämne. Arbetsnamnet påprojektet är ”Opera är inte musik – det är drama”.– I tonsättar- och musikerkretsar ser man påopera som något musikaliskt med en visuell sida.Men av egen erfarenhet vet jag att det är dramatsom är det centrala med opera. Musik är förvissoen oundgänglig del, men det är lätt att missbedömaoperor om man inte också ser till dramaturgin.Min önskan är att bättre förstå vilkenbetydelse dramaturgin har för musikdramatiken.Idag finns det knappt en enda bok om detta.Komponerar ett hörspelHans Gefors doktorandprojekt kommer att beståav tre delar: ett musikdramatiskt verk, en dagboköver processen och en teoretisk del. Han tyckerdock inte att det är någon poäng med att ge sigpå något som han redan kan, som att skriva enopera för teaterscenen. Därför har han givit sigsjälv en klurig uppgift: att komponera ett ickescenisktmusikdramatiskt verk. Det ska bli etthörspel för radio, med allt vad det innebär avatt gestalta förlopp, scenografi och annat utanhjälp av att handlingen visualiseras.Han skriver dessutom librettot själv förförsta gången, något som visat sig vara ganskasvårt. Det tar lång tid innan han kommerpå hur saker och ting ska vara.– I librettot finns alla de dramaturgiskaproblemen: vad ska vara med, på vilketställe ska vad in och ur vilken synvinkeletc. Vad som sedan återstår är bara ett musikalisktproblem, hur man gestaltar librettot, sägerHans Gefors, och får den musikaliska biten attlåta som en bagatell i sammanhanget.– Med librettot måste man ha en övergripandeidé och den tror jag med jämna mellanrum attHans Gefors föddes 1952 i Stockholm. Han studerade komposition 1972–1977på musikhögskolorna i Stockholm och Århus och har vid sidan av sitt tonsättararbetevarit musikskribent och redaktör för Dansk Musiktidsskrift. Hans Geforsvar professor i komposition vid Musikhögskolan i Malmö 1988–2001 och inneharnu ett flertal styrelseuppdrag och sitter i juryn för Polarpriset.Hans Gefors har bl a erhållit Litteris et Artibus och Christ Johnson musikprisför sångcykeln Njutningen och orkesterverket Twine. Bland hans verk märks operornaPoeten och glasmästaren 1979 (Århus), Christina 1986 (Stockholm), DerPark 1991 (Wiesbaden), Vargen kommer 1996 (Malmö) och Clara 1998 (Paris).jag har. Men sedan visar det sig att det var mer enlokal idé, vilket kräver en ny övergripande idé...En av Hans Gefors övergripande idéer hittillsär att han vill göra sitt verk för bilförare. Iställetför att skriva för en salong fylld med uppmärksammalyssnare vill han göra musikdramatik förmånga ensamma lyssnare som delvis har sin uppmärksamhetnågon annanstans.– Det är en väldigt nutida form för erfarenhet.I en bil får man en intimitet och man kan designaljudet för just det rummet.Dokumenterar processenUnder arbetets gång för Hans Gefors dagbok.– Det handlar om att dokumentera den kreativaprocessen med alla tankegångar, tveksamheteroch tvivel. Den idé jag har är svår att genomföra.För mig som forskare gör det inget om detinte blir något speciellt, processen är ju intressantändå, men som konstnär vore det trist om det inteblev bra. Målet är göra mitt bästa verk nånsin!Den teoretiska delen av doktorandarbetet skahandla om de dramaturgiska verktygen, somHans Gefors är noga med att kalla dem.– Det uppstår ofta felaktiga föreställningar omatt dramaturgi – särskilt inom film – är någotslags recept som det bara är att följa så blir detbra. Det är fullständigt galet! Det här är ju ingenIKEA-byggsats! Men man kan däremot ha väldigtgod hjälp av dramaturgi som verktyg.MultimediaFör att förmedla såväl det musikdramatiska verketsom processen runt dess tillkomst har HansGefors en idé om något slags multimediepresentationpå dator. Där ska man samlat kunna höramusiken, se noterna, läsa librettot, och följa dagbokenoch de teoriavsnitt som är relevanta för deolika delarna av verket. Riktigt hur det hela skalösas vet han inte, men han har å andra sidan någraår på sig innan det ska vara klart.Som professor arbetade Hans Gefors för attinföra konstnärlig doktorandutbildning vidLunds universitet, något som funnits en längre tidi Storbritannien och Finland, och sedan några årvid Göteborgs universitet. Det var också i Göteborgsom Hans Gefors, efter långvarigt sökande,hittade sin handledare Anders Wiklund.– Han hör till den första kullen konstnärligadoktorer, och är väl mer akademiker än jag. Menhan har studerat gamla operor, så han passar bra.Jag har också en brittisk musikvetenskapsmansom handledare, Roger Parker. Han har koll påatt jag inte slår in öppna dörrar på det akademiskaområdet. Men mitt främsta mål är inte att studeralitteraturen, det är snarare att göra det läromedelsom inte finns.TEXT: PETRA FRANCKEFOTO: KENNET RUONAX


▲Åsa Ahlander tycker att det är enotrolig lyx att gå på Författarskolanoch få respons från duktiga författareoch engagerade kursare.Här har allasamma drömSmåföretagsdirektören Kristina Sjögren är enav de första på författarskolan som fått klartett eget bokmanus. Efter tio år i näringslivetoch med fyra barn är hon van vid att få sakeroch ting gjorda.Musikalartisten Åsa Ahlander trodde att honskulle skriva dramatik, men det blev noveller.Och Ludvig Drakenfjord som redan prövat deflesta genrer, brottas för första gången med densvåra prosan i en psykologisk roman.Kristina, Åsa och Ludvig finns bland de cirka sextioförfattarstudenter som den här måndagensamlats i källaren på Absalon. ”Läsa för att skriva”är temat. Den första kullen författarstudenter,som nu är inne på sin tredje termin, ska varoch en redovisa en bok som inspirerat dem i derasskrivande. Bland åhörarna finns också de nyastudenter som just börjat Författarskolan.– Det är viktigt att läsa mycket om man villskriva bra. För att inte uppfinna hjulet igen och föratt se hur man gör, säger läraren Björn Larsson.Han är professor i romanska språk, men ocksåframgångsrik författare med flera romanerbakom sig. Det var hans idé att skapa en författarskolavid Lunds universitet.Skolan startade förra hösten som ett samarbetemellan litteraturvetenskap och språkinstitutionerna.Av de 130 sökande antogs 38 och av dem är30 kvar i dag.– Ingen lämnade skolan av missnöje. Enligt deutvärderingar vi gjort tycks alla på utbildningenvara mycket nöjda, försäkrar Johan Stenström,litteraturvetare, fackboksförfattare och den somsköter den mesta administrationen.För Sverige är det ganska nytt att utbilda författarepå akademisk nivå, men i USA finns författarskolorsedan länge vid de stora universiteten,inte sällan med kända författare som lärare.– Det viktiga är att finna sin egen röst, sägerBjörn Larsson till författarstudenterna i Absalon.Jag tycker inte jag har funnit min riktigt än, menjag känner att jag har den i mig.Tips från kollegaBjörn Larsson fungerar som en kollega som hjälperde andra genom att dela med sig av sin erfarenhet.– Att läsa kan vara matnyttigt. Man kan tillexempel lära sig hur man i en text går genom endörr utan att det tar en halv sida eller mer i anspråk.Men läsandet kan också ge bekymmer.– Man kan bli så bedövad av att det man läserär så bra, att man lägger ner alltihop och börjarläsa juridik istället, säger Björn Larsson och studenternaskrattar.Vanligare är kanske att man härmar den manläser:– Själv har jag haft en Hemingway-, en Slasochen Kurt Vonnegut-period, bekänner BjörnLarsson.”Man kan bli såbedövad av attdet man läser ärså bra, att manlägger ner alltihopoch börjarläsa juridikistället.”Björn Larsson var den somdrog igång Författarskolan.FOTO: BJÖRNNILSSON/HAGBLOM FOTO.XI


▲Överst t v: Redan innanLudvig Drakenfjord komin på Författarskolanhade han stor erfarenhetav att skrivadramatik och attmusicera.Överst t h: KristinaSjögren har redan skrivitfärdigt en samling”mytiska noveller”.Nederst t v: Koncentrationunder redovisningen.Nederst t h: ÅsaAhlander hittarinspiration i Peter HoegsBerättelser om natten.FÖRFATTAR-SKOLANFörfattarskolan är på 80poäng. Den som söker skaha läst minst 60 poäng i ettvalfritt akademiskt ämne,alternativt vara 24 år ochha gått ut gymnasiet förminst fem år sedan.Nästa intag är höstterminen2004.Utbildningen får högreanslag per årsstudieplatsän övriga inom den humanistiskafakulteten. Menman är ändå långt ifrån denivåer som gäller för utbildningarsom t ex teater,musik och konst.XIIFörst var tanken att lundaskolan skulle fokuserapå facklitterärt skrivande, men de flesta hartagit chansen att skapa fritt, även om de kanskeinte kommer att kunna ägna sig åt det i framtiden.Flera hade gått skrivarkurser tidigare, några hadekontakt med bokförlag och en student hade skrivitett par barnböcker. Åldersspridningen är stor– från 20 till 60 år – och kvinnorna är i majoritet.Första läsåret var studierna tämligen bundna,med många inbjudna föreläsare, läskurser och tilloch med salstentor i till exempel bokförlagskunskap.Nu handlar det om att koncentrera sig påatt få färdigt ett manus, vilket är utbildningensmål. Men studenterna ska också få lära sig hurman marknadsför sig gentemot förlagen.Författare som lärareAlla lärarna är professionella författare inomskön- eller facklitteratur. Förutom Björn Larssonoch Johan Stenström ingår Claes-Göran Holmberg,litteraturvetenskap, Lars-Håkan Svensson,engelska, och Karin Sandqvist, nordiska språk, iden fasta staben.Mycket arbete sker i mindre grupper. Studenternaläser varandras texter, ger och tar kritik. Deträffas, men mycket utbyte sker också via internet.Lärarkretsen har utvidgats och författarna NiklasTörnlund, Sigrid Combüchen, Tommy Olofssonoch Jan Sigurd har anlitats som handledare.Studenten Kristina Sjögren har till denna måndagssamlingvalt att presentera William GoldingsFlugornas herre – en klassiker om människansgrymhet, som hon läst många gånger. Hennes egetskrivande startade i en mer idyllisk genre. Frånbörjan handlade det mest om hästar berättar honför LUM under en paus.– Jag har skrivit sedan jag var liten. Efterhandblev det allehanda noveller och så dagbok.Kristina Sjögren är 41 år, kommer från ”ensläkt av arbetare och småbönder” och bor i Karlskronavarifrån hon långpendlar till Lund. Honhar en akademisk kommunikationsutbildning ochjobbade under tio år som VD för olika mindre företag,och ett par år för företagsbyn Soft Center iRonneby. Det var stimulerande men krävande,med många resor och ofta upp till 70 timmars arbetsvecka.När fjärde barnet föddes för två ochett halvt år sedan kände Kristina att hon var färdigmed att springa runt i ekorrhjulet. Av enslump fick hon se att författarskolan skulle starta.Hon sökte och kom in i hård konkurrens.– Det var fantastiskt! För första gången i livetmötte jag andra människor med samma intressesom jag! Annars har man alltid betraktats som litesuspekt när man berättat att man skriver och villbli läst av andra. Här hade alla samma dröm.Publicerade hästhistoriaEn enda gång har Kristina Sjögren blivit publicerad– hon var 13 år och fick in en hästhistoria ien ungdomstidning från Wahlströms förlag. Nuhar hon en färdig samling ”mytiska noveller”.Hon har tagit berättelser ur Bibeln och den grekiskaoch fornnordiska mytologin och berättatdem igen, utifrån det som de med ett moderntperspektiv egentligen handlar om, enligt Kristina.– Berättelsen om Dina i Bibeln handlar omhedersmord – det anser jag! Och Medea handlarom skilsmässa.Novellerna har ännu inte skickats till något förlag:– Jag tänkte låta min grupp hjälpa mig lite till…Samtalen med handledaren och kurskamrater-


na har varit oerhört givande, tycker hon. Hon seren kvalitetsskillnad i det hon skriver nu, jämförtmed för ett år sedan. Trots att kursarna inte träffasdagligen är gemenskapen stark – att analyseravarandras texter är något djupt personligt, menarKristina.Författarstudenterna har olika bakgrund.Medan Kristina skrivit dagbok, har 27-årige LudvigDrakenfjord redan satt upp flera pjäser utifrånegna manus. Häromåret tjänade han en rejäl slantpå ett barnfilmsmanuskript som han sålde till ettfilmbolag.Ludvig hade hunnit gå flera skrivarkurser innanhan kom till Lund. Han har två musikband,har läst historia och jobbat som gourmetkock!– Jag hade hållit på med allt – dramatik, film,musik och dikt – när jag började läsa litteraturvetenskaphär för ett par år sedan. Så startade Författarskolan!Det var perfekt!I dag är Ludvig Drakenfjord halvfärdig med enpsykologisk roman om en frigiven mördare, enkvinnlig präst och hennes barn. Historien hardelvis verklighetsbakgrund.– Det har varit svårt att skriva ska jag erkänna,eftersom jag aldrig tidigare hållit på med prosa.Men det är spännande.Är det romanförfattare han ska bli? Nja, kanskeinte. Men skriva i någon form kommer hanabsolut att göra.– Det har jag vetat hela livet.AnnonsSlår an en tonI föreläsningssalen på Absalon har turen kommittill Åsa Ahlander att berätta om en bok som inspirerathennes skrivande. Hon är 31 år, utbildadmusikalartist och skådespelare, och verksam vidSagohuset i Lund. Hon har valt Peter Hoegs Berättelserom natten. Åsa vet inte vad det är hosHoeg som inspirerar henne, men hon uppfattarinspiration som en ”ton” och den här danska novellsamlingenslår an den tonen i henne.Åsa Ahlander sökte till Författarskolan för attutveckla sitt språk och för att kanske kompletteraskådespeleriet med att skriva dramatik.– Men jag tar chansen att skriva fritt, det harblivit mest noveller. Det är en otrolig lyx att gåhär, och få respons från duktiga författare ochengagerade kursare.– Men det är jätteläskigt att lämna över sinatexter för granskning, värre än att stå på scen.Att hitta sin egen stil – och ge järnet. Det är tvåhållpunkter för Författarskolan. Men gemenskapenomhuldas och ett par gånger per termin träffaslärare och studenter under friare former. ”Läsaför att skriva”-dagen slutar med avspänt umgängeöver ett glas öl på Kulturens pub.TEXT: BRITTA COLLBERGFOTO: KENNET RUONAXIII


Borrkärnor från vulkan avslöjarväder från förrKontinenterna är arkiv som vittnar om fornatiders klimat. Därför vet man mer om klimatförändringarpå norra halvklotet än på det södra.I norr finns ju de stora landmassorna men isöder dominerar haven. Inte underligt att geologernakastar lystna blickar på de öar som liggerutslängda i oceanernas mitt. I februari landstegen grupp kvartärgeologer från Lund på Tristanda Cunha och började ta upp borrkärnor.Tristan da Cunha är en vulkanö i Sydatlantenungefär mitt emellan Kapstaden och Buenos Aires.Ön är en mil tvärs över med en högsta höjdöver havet på 2 100 meter. Befolkningen utgörsav 285 personer. Alla stammar från en handfullförfäder som flyttade dit i början på 1800-talet.Det räcker med att titta på en karta för att förståatt detta är en rätt exotisk plats. Befolkningen ärsamlad i Edinburgh of the Seven Seas, och detfinns en del mycket märkliga ortnamn som Ridge-where-the-Goat-jump-offoch Down-wherethe-Minister-land-his-things.Förutom fiske ochjordbruk har denna brittiska koloni livnärt sig påatt ge ut egna frimärken. Ett av dem har albatrossensom motiv. Förlagan lär vara en tavla av densvenske skärgårdsmålaren Roland Svensson sombesökt ön flera gånger.Det finns rikligt med albatrosser på Tristan daCunha. Så när expeditionsledaren Svante Björck,med kollegerna Dan Hammarlund, Kalle Ljungoch den danske geologen Ole Bennike banade sigväg genom halvmeterhöga ormbunkar iakttogs deav albatrossungar sittande i sina bon.– De klapprade med näbbarna när de fick synpå oss. Det var som om vi hälsades med applådåskordär vi drog fram, säger hobbyornitologenDan Hammarlund.Vem vet vad ortsbefolkningen kommer attkalla denna plats? Up-where-the-Albatrossesgreet-the-Geologists?Provborrning på The Hillpiece Bog– ett tungt jobb. FOTO: SVANTE BJÖRCK.XIV


Vulkanen är fortfarande aktiv och hade senast ettutbrott 1961, då hela befolkningen evakuerades.Några av de intressantaste proverna är tagnapå The Hillpiece Bog – en igenvuxen kratersjö –och i dem kan man se spåren av två stora vulkanutbrottför 500 och 800 år sedan. Andra intressantaprover är tagna från en kratersjö på 700meters höjd.Hög upplösning i proverna– Dateringen visar att den längsta lagerföljden vitagit upp på Tristan omfattar 2 500 år, konstaterarprofessor Svante Björck. Och det är myckethög upplösning i borrproverna, dvs mycket informationper tidsenhet. Om ett sediment på enoceanbotten växer en centimeter på 1000 år kanett sjösediment växa en centimeter på bara fem år.Det innehåller dessutom information om nederbördoch andra atmosfäriska förhållanden somman inte kan få från havsbottnens sediment.Tidigare har Svante Björck tagit prover påGrönland, Färöarna, Azorerna och på öar omkringAntarktiska Halvön. De ingår i hans projekt”Atlantis”; Tristan da Cunha är en viktig länkpå södra halvklotet som binder ihop dessa områden.Den sista länken blir Staaten Island öster omsydöstligaste Eldslandet. Tanken är att man skakunna bilda sig en uppfattning om klimatförändringarnai Atlanten de senaste 10 000–20 000åren. Landmassorna på norra halvklotet är ”motorn”som startar istiderna. Men förändringarnai klimatet under istiderna är inte alltid i fas medvarandra på norra och södra halvklotet. Det ärinte heller fallet med klimatförändringarna efteristiden.Lilla Istiden– I historisk tid har vi haft två stora klimatförändringari Europa. På 1000-talet var medeltemperaturennågon grad högre än i dag. På 1400-taletinleddes den s k Lilla Istiden då vintrarna blevmycket stränga, och den upphörde inte förrän islutet på 1800-talet.Vi kan se att 1000-talet också var en varm tidpå Tristan da Cunha. Men vi kan inte se någraspår av Lilla Istiden. Det är intressant eftersom detfinns en teori om att Lilla Istiden skulle bero påförändringar i solaktiviteten; det var delvis enperiod med mycket få solfläckar. Man kan dockinte dra slutsatsen att denna teori om Lilla Istidensuppkomst är felaktig. Men den är betydligtmer komplex än vad data på norra halvklotetantyder.Gruppen besökte också Nightingale Island, enobefolkad ö nära Tristan da Cunha. Den tio meterlånga borrkärna man tog där är ännu intedaterad men man har gott hopp om att den kanvara 10 000–15 000 år gammal i bottnen. Nightingaleär en fågelö dominerad av arten större lira.Dess ägg uppskattas mycket av Tristan da Cunhaborna.De har byggt sommarhus på Nightingaleoch det har blivit en festlig tradition att varje åråka dit och frossa på ägg. Den yngre generationenlär dock inte vara lika förtjust i denna kolesterolorgie.Det finns mycket material kvar att arbeta medfrån Tristan da Cunha och Nightingale. DoktorandenKalle Ljung ska bl a genomföra en rad pollenanalyseroch geokemiska och geofysiska analyser.Tristan da Cunha kan ha mycket att lära ossom hur jordens klimat fungerar.Det är möjligt att forskarnas strapatser på Tristanda Cunha och Nightingale Island kommer attvisas i SVT. På uppmaning av VetenskapensVärlds redaktion har de filmat ett fyra timmarlångt material som nu håller på att redigeras.GÖRAN FRANKELLundageologernahade en lokalfanklubb:albatrosserna. FOTO:SVANTE BJÖRCK.Liten plats, pampigtnamn: Edinburgh ofthe Seven Seas påhuk under vulkanbranterna.FOTO:SVANTE BJÖRCK.Svante Björck (t v)och doktorandenKalle Ljunginspekterar enborrkärna. FOTO:DAN HAMMARLUND.XV


Posttidning ALunds universitetBox 117221 00 LundGun Malmgren.FOTO: KENNET RUONA.XVIHallå!…Gun Malmgren, nyinstallerad professorsom höll installationsföreläsningen medtiteln Möte mellan text och läsare.Du är professor i litteraturvetenskap med didaktiskinriktning – vad innebär det?– Det är den del av litteraturvetenskapen somhandlar om litteraturen som en rörelse mellan textoch läsare. Jag vill lyfta fram läsarens perspektivoch det som sker i mötet mellan text och läsare.Och vad brukar hända i ett sådant möte?– Det beror på i vilket syfte man läser och vadman läser. Läsvanor har att göra med sociala roller,med kulturell identitet och med ideologiska föreställningar.Fiktionstexter kan kompensera läsarenför bristande handlingsmöjligheter. Vi läserockså för att bli bekräftade och för att ändra våraföreställningar om hur världen är eller kundevara.Har läsvanorna förändrats? Läser vi mer i dageller har IT och TV minskat läslusten?– Vi får rapporter om att det köps mer böcker idag och många nya böcker får stor uppmärksamhet.Men vi vet inte hur alla köpta böcker läses.Mötet mellan text och läsare är fortfarande ”ensvart låda” och det är många frågor som vi forskaresöker svar på.Du har särskilt intresserat dig för litteraturensplats i utbildningen av svensklärare. Vad kan lärarnagöra för att stimulera eleverna att läsa?– Alla medel är tillåtna för att göra litteraturentillgänglig. Blivande lärare bör vara belästa ochäven kunna göra en pedagogiskt riktad textanalys.Sverige har en fin produktion av barnlitteraturoch goda bibliotekstraditioner. Det tar lång tidatt bygga upp t ex skolbibliotek och sjukhusbibliotekmen det kan gå fort att rasera dem. Jagtycker det är olyckligt att spara på det området.Behöver skönlitteratur större utrymme på schemat?– Ja, jag anser att litteratur är en viktig kunskapskällai skolarbetet. Sen ska man veta att läsupplevelsenvarierar med åldern. För små barn ärläsning som lek och i den traditionella slukarålderngäller serieböcker där hjältar och hjältinnorär förebilder. Komponenterna är välkända förbarnen och det underlättar läsandet. Efterhandbörjar barnen kunna reflektera under läsningenoch för den äldre läsaren blir läsandet också entolkningsprocess. Barnen behöver en vuxen somdelar med sig av sin läserfarenhet och här spelarbåde föräldrar och lärare en viktig roll.Det talas mycket om olika lässtrategier. Vilkenstrategi tycker du är bra?– Läsecirklar är ett bra exempel. Där får manbåde läsa och tala om det som alla har läst. Deltagarnakan ha högst olika tolkningar av sammabok och sådana samtal är alltid givande.Vad läser du själv helst?– Svår fråga. Jag läser mycket och alla genrer. Låtmig säga att jag är oerhört privilegierad – jag haralltid älskat att läsa och nu får jag göra det ocksåsom yrke.En roman kan vara en stor och bestående läserfarenhet– men ibland vill man bara roas för stunden.Får man ha enkel kiosklitteratur i bokhyllan?–Visst. Många läsare har flera böcker på gång –kanske en krävande men svårtillgänglig romanoch en förutsägbar kärleksroman eller deckare.Det kallar vi dubbel bokföring. Man lär sig alltidnågot nytt om sig själv när man läser.SOLVEIG STÅHL

More magazines by this user
Similar magazines