12.07.2015 Views

Ladda ner hela tidningen i pdf format - GIH

Ladda ner hela tidningen i pdf format - GIH

Ladda ner hela tidningen i pdf format - GIH

SHOW MORE
SHOW LESS
  • No tags were found...

You also want an ePaper? Increase the reach of your titles

YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.

1 | 2012 | ÅRGÅNG 21Tema:IDROTTSLYFTETTidernas satsninggranskad


INNEHÅLL nr 1/20123451014192227303338Ledare Per NilssonIdrottslyftet – mer och flerFakta om regeringens storsatsning på barnVar hamnade idrottslyftspengarna?Joakim Wirén Åkesson och Johan R. NorbergIdrott för alla – ur nyanlända barns perspektivKrister Hertting och Inger KarleforsLedare osäkra om barns rättigheter Karin RedeliusNär upphör ledarens sociala ansvar? Johan von EssenUnga ledare behöver stödLena Larsson och Jane MeckbachIdrottstävlingar skapar kön Håkan Larsson och Susanne JohanssonRörelser i staden – aktivitet på olika villkor i Malmö Karin BookManlig idrottsprofilering i grundskolanInger Eliasson, Magnus Ferry och Eva OlofssonStyra eller styras? Om relationen mellan staten och RFOwe Stråhlman, Sten Eriksson och Göran PatrikssonAnsvarig utgivarePer NilssonChefredaktörChristine DartschChristine.Dartsch@gih.seRedaktörJohan PihlbladJohan.Pihlblad@gih.seAdressCentrum för idrottsforskningBox 5626114 86 StockholmTel 08-402 22 00Hemsidawww.centrumforidrottsforskning.seCIF på twitter@CIFofficialPrenumerationsprisHelår med fyra nummer kostar 200 kr.Beställs på hemsidan. Pg-konto 957849-3.PrenumerationsärendenMarie Broholmer08- 402 22 91marie.broholmer@gih.seGrafisk form och produktionTomas SvenssonGrafiska Huset ABTel. 08-10 30 25tomas@grafiskahuset.seTryckeriGrafiska punkten i Växjö ABFoto (om ej annat anges)Bildbyrån i HässleholmISSN-nr 1103-4629424651555963Det stora lyftet uteblevStaffan Karp, Inger Eliasson, Josef Fahlén, Kent Löfgren och Kim WickmanIdrottslyftet lyfter vad då?Matthis Kempe-Bergman, Håkan Larsson och Karin RedeliusFler stannar men färre börjar?Susanna Hedenborg, Kalle Jonasson, Tomas Peterson, Katarina Schenker ochHelena TolvhedEtt lyft under varierande villkorPG Fahlström, Per Gerrevall, Marie Hedberg och Susanne LinnérStarka män söker kvinnorHansi Hinic och Hampus LostinEn utvecklingsmotor som inte startadeOlov Wolf-Watz1 | 2012 | ÅRGÅNG 21Tema:IDROTTSLYFTETTidernas satsninggranskadVår i idrotts-Sverige.2 svensk idrottsforskning 1/2012


Ledare nr 1/2012Bästa läsare!R e g e r i n g e n s s ä r s k i l d a s a t s n i n g påbarn- och ungdomsidrott, Idrottslyftet, ärnu inne på sitt femte år. Runt om i landethar tusentals projekt fått dela på drygt 2miljarder kronor sedan starten år 2007.Riksidrottsförbundet (RF) har låtit ettantal forskare från olika högskolor ochuniversitet att utvärdera arbetet.I det här numret som är ett samarbetemed RF kan du läsa om vad de harkommit fram till. Hur har egentligenpengarna använts i föreningar ochförbund och vilka har effekterna blivit?Läser man forskarnas omdömen framkommeren bild av att idrotten inte alltidhar lyckats nå upp till förväntningarna.Utvärderingarna riktar till exempel kritikmot att idrottsrörelsen inte lockat nyagrupper till idrotten och pekar på storabrister i det jämställdhets- och jämlikhetsarbetesom målet var att förbättra.Men helt klart har pengarna också varittill nytta för utvecklingen av barn- ochungdomsidrotten.I Idrottslyftet ingår även ett antalenskilda forskningsprojekt. I den härtidningen kan du bland annat läsa omJoakim Åkessons och Johan R Norbergsjämförelse mellan Idrottslyftet och dentidigare satsningen, det så kallade Handslaget.Karin Redelius har gjort en spännandestudie som handlar om barn- ochungdomsledare och deras syn på barnsrättigheter. Resultatet tyder på att detfinns en del att jobba med för att förverkligavisionerna i RF:s idédokumentIdrotten vill. Dessutom har Karin Bookundersökt hur barn och ungdomaranvänder stadens olika platser för idrottoch hur unga från olika stadsdelar rör sig istaden.Årets första nummer är alltså vigt åtIdrottslyftet. Men det händer även andraintressanta saker i forskningsvärlden. Ifebruari presenterades resultaten av denstora utvärderingen av nordisk idrottsforskning.Rapporten Sport Sciences inNordic Countries visar att bland annat attden nordiska forskningen håller högkvalitet, men att den varierar mycketmellan olika enheter, länder och forskningsområden.Forskningen är inte likanyskapande och banbrytande som denvarit tidigare. Särskilt märks det påelitidrottens område. Den internationellautvärderingsgrupp som skrivit rapportenföreslår att vi behöver fler tvärvetenskapligasamarbeten mellan de nordiskaländerna, men också inom respektiveland. De konstaterar vidare att det finnsgoda möjligheter att skapa en samnordiskspetsforskningsenhet. I utvärderingeningick 97 forskningsenheter från Sverige,Danmark, Norge, Finland och Island.Våren och försommaren innehålleräven flera konferenser att se fram emot.Den stora internationella biokemikonferensenIBEC arrangeras i Sverige ochStockholm den 17–21 juni. Dessförinnanfinns ett antal att välja bland, till exempelIdrott & samhällsnytta den 23–24 maj iGöteborg. RF och Centrum för idrottsforskningbjuder då in till ett dialogmöteom idrottens roll i samhället.Missa inte heller Centrum för idrottsforskningsnyhetsbrev som har premiär ivår. Nu blir det ännu enklare att hålla siguppdaterad om idrottsforskning i Sverige.Nästa nummer av Svensk Idrottsforskningkommer ut i juni. Vi det laget harSverige redan spelat sina inledandematcher i fotbolls EM och OS i Londonstår i startgroparna. OS är också temat inästa tidning. Vi utlovar intressantforskning från olika discipliner, allt medbäring på den kommande olympiaden.Per NilssonOrdförande,Centrum för idrottsforskning1/2012 svensk idrottsforskning 3


Idrottslyftet – mer och flerFakta om regeringens storsatsning på barnI d r o t t s l y f t e t ä r e n e x t r a statlig satsning påsvensk barn- och ungdomsidrott som startade 1 juli2007. Årligen har regeringen avsatt 500 miljonerkronor till Riksidrottsförbundet (RF), utöver detordinarie anslaget till idrotten. Räknar man in projektetHandlaget som föregick Idrottslyftet har barn- ochungdomsidrotten under den senaste åtta åren fått etttillskott på över tre miljarder kronor.Målet under Idrottslyftets första fyra år var att öppnadörrarna för fler barn och ungdomar att börja idrotta,och att få fler unga att idrotta längre upp i åldrarna.Idrottslyftet – mer och fler var RF:s motto. Arbetetskulle dessutom utgå från ett jämställd- och jämlikhetsperspektiv.Idrottsrörelsen skulle främst arbeta med:• Att utveckla specialidrottsförbund och föreningar• Att öka tillgänglighet till anläggningar och idrottsmiljöer• Att stärka ledarförsörjningen• Att stärka samverkan med skolanFärska utvärderingarFör att ta reda på vad som har hänt i Idrottslyftetperioden 2007–2011 gav RF sex lärosäten och enkonsultfirma i uppdrag att tillsammans med frivilligaspecialidrottsförbund genomföra en extern utvärdering.Förbunden valde i sin tur ut ett antal projektsom forskarna fick undersöka närmare. Tjugofyraförbund och RF:s egen roll har utvärderats ochredovisats till RF. I det här numret får du en kortfattadversion av deras rapporter.En del av pengarna satsade RF även på forskningsmedeli samarbete med Centrum för idrottsforskning.Forskare fick söka medel för projekt som hade frågeställningarmed anknytning till Idrottslyftets mål.Majoriteten av de tolv projekt som valdes ut är nuavslutade. Flertalet av dem kan du läsa om i det härnumret av Svensk Idrottsforskning.Idrottslyftet fortsätterDen 1 juli 2011 inleddes Idrottslyftet år 5, som beräknaspågå till den 31 december 2012. Regeringen vill attden fortsatta satsningen ska ha en ännu närmarekoppling till skolans arbete. Den ska även stödjaandra typer av motionsaktiviteter än idrott i syfte attnå fler barn och ungdomar. Särskilt flickor och barnmed invandrarbakgrund.Först ut HandslagetStatens särskilda satsning på barn- och ungdomsidrottgår tillbaka till år 2004. Då gav regeringen RF iuppdrag att genomföra en extra satsning fram till år2007. Målet var att få fler att börja idrotta. Totaltsatsades en miljard fördelat över de fyra åren. Mer omHandslaget finns att läsa i Lars-Magnus Engströmssammanställning Forskning om Handslagets genomförandeoch resultat och i Svensk Idrottsforskning nr3/4 år 2007. Det temanumret hittar du på Centrumför idrottsforsknings webbplats, där du för övrigthittar samtliga nummer sedan starten år 1992.FAKTA RiksidrottsförbundetUtvärderare IdrottslyftetRiksidrottsförbundet (RF) är en paraplyorganisation för hela densvenska idrottsrörelsen. Inom RF finns bland annat 69 självständigaspecialidrottsförbund som representerar olika idrotter.Cirka 21 500 idrottsföreningar finns representerade i RF.• Gymnastik- och idrottshögskolan• Göteborgs universitet• Högskolan i Halmstad• Linnéuniversitetet• Malmö högskola• Umeå universitet• Ramböll ManagementFör dig som vill fördjupa dig mer i utvärderingen och forskningsprojekten gå in på:http://www.rf.se/Vi-arbetar-med/Politiskafragor/Idrottslyftet/Utvarderingforskning/4 svensk idrottsforskning 1/2012


Var hamnadeidrottslyftspengarna?Möjligheten fanns att bryta mönstret – att tydligare stödja mindreresursstarka föreningar och kommuner och hitta andra sätt att lockanya ungdomsgrupper till idrotten. Men Idrottslyftet gick i sammafotspår som Handslaget.I d r o t t s r ö r e l s e n s f ö r e n i n g a r ärmycket olika varandra. De befinner sig iskilda sammanhang och bedriver olikartadeverksamheter. De verkar underolikartade ekonomiska och organisatoriskaförhållanden. Frågan är vad somhänder när ett generellt och storskaligtutvecklingsprojekt som Idrottslyftet skarealiseras inom ramen för ett så brokigtföreningsliv?Hösten 2002 lanserade regeringen denidrottspolitiska utvecklingssatsningenHandslaget. Satsningen innebar attidrottsrörelsen under en fyraårsperiodoch parollen ”öppna dörrarna för fler”tillfördes sammanlagt en miljard kronor,utöver det ordinarie statsanslaget förutvecklingsprojekt inom barn- ochungdomsidrotten på lokal nivå. Efterregeringsskiftet år 2006 presenterades enny utvecklingssatsning, Idrottslyftet.Denna gång hade resurserna fördubblatstill två miljarder kronor fördelat över denkommande mandatperioden. Därtill hadesatsningens övergripande ambitioneräven kompletterats med målet att ”få fleraatt fortsätta längre inom idrotten”. Enytterligare nyordning var att idrottsrörelsenfick större handlingsutrymme att självstyra över medlens fördelning på verksamheteroch projekt (1).Föreningarnas förutsättningarDen här artikeln handlar om resursspridningeninom Idrottslyftet. En huvudfrågaär därmed om Riksidrottsförbundet (RF)infört nya fördelningsprinciper för attförhindra att även denna satsning utmynnari en regional spridning som gynnaridrottslivet i socioekonomiskt välmåendekommuner, såsom Handslaget gjorde.Men vi vill även gå ett steg längre. I 2007års utvärdering Var hamnade handslagspengarna?”Stor” blev större och ”liten”kunde inte hänga med (2) studerade viendast föreningarnas externa sammanhang,medan den här studien även tarsteget in i de lokala föreningarna. Vi haranalyserat fyra utvalda föreningar i syfteatt belysa faktorer som påverkar derasförutsättningar att engagera sig i satsningarmotsvarande Idrottslyftet. I utvärderingenskiljer vi därför mellan föreningsexternaoch föreningsinterna faktorer.Föreningsexterna faktorer är omständigheteroch villkor som föreningarna har svårtatt påverka, såsom Idrottslyftets fördelningsprinciper,förbundstillhörighet samtlokala sociala förhållanden. Föreningsinternafaktorer är faktorer kopplat tillklubbarnas egna verksamheter såsomorganisationsstruktur, ideellt engagemangsamt beredskap och förutsättningar attengagera sig i olika former av utvecklingsprojekt.Utvärderingen hämtar teoretisk inspirationi Robert D. Putnams välkända undersökningDen fungerande demokratin frånår 1996 (3). I likhet med Putnam är intressetriktat mot relationen mellan socialasammanhang och ideellt föreningsliv, samthur den påverkar demokratisk effektivitet(i den här studien mätt i idrottsföreningarsengagemang inom Idrottslyftet). Menmedan Putnam visar hur ett vitalt föreningslivskapar medborgerligt engagemang(socialt kapital), vilket i sin tur är betydelsefulltför skapandet av ett välfungerandedemokratiskt samhälle, läggs tyngdpunkteni denna studie på den dialektiskarelationen mellan ett vitalt föreningsliv ochmedborgerligt engagemang. Det finnssåledes ett ömsesidigt förhållande mellandessa två snarare än att det ena leder tillJoakim Wirén ÅkessonLic. i idrottsvetenskapInstitutionen idrottsvetenskap,Malmö högskolaJohan R. NorbergDocent i idrottsvetenskapInstitutionen idrottsvetenskap,Malmö högskola1/2012 svensk idrottsforskning 5


FigurerFAKTADen här artikeln baseras påJoakim Åkessons rapport Varhamnade handslagspengarna?från år 2007. Studienvisar att Riksidrottsförbundetutformade fördelningsprinciperför Handslaget som ipraktiken gynnade förbundmed redan omfattandeungdomsverksamhet.Dessutom hamnade deregionala medlen i störstutsträckning hos populäraidrotter i föreningar i tätbefolkadeoch socioekonomisktvälmående kommuner påbekostnad av föreningslivet iekonomiskt svagare kommunereller på landsbygden.Figur 1 Modell över relationer mellan föreningsliv, socialt kapital och effektivitet Figur 1. Modell över relationer mellan föreningsliv, socialtkapital och effektivitet.Tabell 1 Idrottslyftsmedlens fördelning (2007-­‐2010) det andra (Figur 1) (4).Vi fokuserar alltså på avsedda ochoavsedda konsekvenser av Idrottslyftetsutformning. Syftet är i första hand attförstå föreningarnas förutsättningar attengagera sig i satsningen – och inte attbedöma satsningens måluppfyllelse. Meden mer metodologisk och utvärderingsteoretiskterminologi rör det sig alltså om enutvärdering enligt en så kallad relevansmodellKälla: Riksidrottsförbundetdär projektets strategiskautformningställs mot dess övergripande mål i enproblematiserande diskussion om utformningensrelevans för målen (5).Fyra nivåer av satsningen har analyserats:den del av idrottslyftsatsningen som rörspecialidrottsförbunden och dess föreningar.Distriktsidrottsförbunden behandlasi genomgången av RF:s fördelningsprinciper,men lämnas därefter utanförstudien. Utvärderingen omfattar satsningenstvå första år, 2007-2008.Nedan presenteras utvärderingens treövergripande resultat.Fördelningens konsekvenserIdrottslyftet är problematiskt att utvärdera,inte minst med tanke på de vagasyftesformuleringarna. Förvisso är detfastslaget att idrottsrörelsen genomsatsningen ska ”öppna dörrarna tillidrotten för fler barn och ungdomar ochutveckla sin verksamhet så att de väljer attfortsätta idrotta högre upp i åldern” (6).Men varför det anses vara viktigt, och vadsom ska uppnås genom detta, är intenärmare preciserat. Är syftet att höjaungdomens fysiska hälsa och välbefin-Figur 2 Samvarians mellan: Idrottslyftsmedel per nande? invånare Ska (Y) det och medborgerliga andel av befolkningen engagemangetöka – och därmed även effektivi-med eftergymnasial utbildning (X) i Skånes 33 kommuner.teten i samhället? Handlar det om att gebarn och unga en meningsfull sysselsättning?Är utgångspunkten att idrotten i sig1) RF:s fördelningsprinciper för idrottslyftet.2) Specialidrottsförbundens resurstilldelningoch idrottslyftsstrategier.3) Resursfördelningens regionala spridningmellan kommuner i Skåne.4) Fyra utvalda föreningars förutsättningaroch engagemang att delta i Idrottslyftet.självt har ett samhälleligt egenvärde? Omdetta står det ingenting skrivet. Attbedöma utformningen av Idrottslyftetsfördelningsprinciper i relation till syftetmed satsningen, blir därför svårt. Vadman däremot kan göra är att analyserafördelningsprinciperna, och de konsekvensersom följer av hur de är utformade.Källmaterialet består av dokument frånovanstående organisationer, intervjuermed företrädare för organisationerna,samt statistik från Statistiska centralbyrån.Utvärderingen inkluderar i huvudsakRF har fördelat Idrottslyftet enligttabell 1. Störst andel, 56 procent ellerdrygt 1,1 miljarder kronor, har avsatts fördirekt föreningsstöd på lokal nivå.Fördelningen mellan idrotter är gjord påbasis av specialidrottsförbundens andel avIdrottslyftet Summa i tkr Andeldet ordinarie statsbidraget (RF-bidraget)och aktivitetsnivån i deras barn- ochUtvecklingsstöd SF 432 000 21,6ungdomsverksamhet (mätt utifrånUtvecklingsstöd DF 56 000 2,8LOK-stödet). Varje specialidrottsförbundFöreningsstöd SF 800 000 40,0har därefter beslutat hur stödet skaFöreningsstöd DF 320 000 16,0spridas till de egna föreningarna. NästLedarförsörjning SISU Källa: Riksidrottsförbundet 140 000 & Statistiska 7,0 centralbyrån. största bidragspott, 488 miljoner kronorProjekt 20 000 1,0motsvarande 24 procent, har tilldelatsTillgänglighet 200 000 10,0förbunden i form av utvecklingsstöd.Förutom ett mindre grundbidrag för varjeUtvärdering och rådgivning 32 000 1,6förbund, har utvecklingsstödet fördelatsSumma 2 000 000 100mellan förbunden enligt samma principerTabell 1. Idrottslyftsmedlens fördelning (2007-2010). Källa: Riksidrottsförbundetsom det lokala föreningsstödet. 18 procent6 svensk idrottsforskning 1/2012


Riksidrottsförbundets ordförandeKarin Mattsson Weijber ochidrottsminister Lena AdelsohnLiljeroth på Riksidrottsmötet införstarten av Idrottslyftet år 2007.miska resurser, ett brett och aktivt idrottsutbud,och låga ohälsotal. Inga nämnvärdastrategiska satsningar har gjorts föratt öka idrottsengagemanget inom varkenunderprivilegierade idrotter, grupper avmänniskor, eller med hänsyn till socialasammanhang och geografiska områden.Behov och utvecklingsarbeteFyra föreningar valdes som sagt ut för attnärmare analysera vilken betydelseföreningsinterna faktorer har för engagemanginom Idrottslyftet:Förening 1. En förening som haftidrottslyftsmedel och befinner sig i enkommun där det hamnat mycketidrottslyftsmedel per invånare.Förening 2. En förening som inte haftidrottslyftsmedel och befinner sig i enkommun där det hamnat mycketidrottslyftsmedel per invånare.Förening 3. En förening som haftidrottslyftsmedel och befinner sig i enkommun där det hamnat lite idrottslyftsmedelper invånare.Förening 4. En förening som inte haftidrottslyftsmedel och befinner sig i enkommun där det hamnat lite idrottslyftsmedelper invånare.Vid närmare analys visade det sig attföreningarna 2, 3 och 4 hade flera gemensammakännetecken. Föreningarna hadeideellt arbetande styrelser utan direktaspecialkompetenser. De bars upp av ettfåtal personer vilka agerade som styrelseledamöter,ledare och eldsjälar på en ochsamma gång. Ingen av föreningarna hadeavlönad personal, bortsett från enstakatränararvoden. Samtliga uttryckte ocksåsvårigheter att engagera ideella kraftersom kan bidra till vidareutveckling avverksamheten. De personella resursernavar hårt ansträngda och ägnades nästintilluteslutande åt att bedriva föreningensbasverksamhet. De hade i princip ingainkomster annat än de som medlemmarnagenererade genom medlems-, träningsochtävlingsavgifter. Resurserna förutvecklingsarbete var kraftigt begränsade,särskilt ifråga om personella krafter. Detvar dessutom främst ledarbrist ochanläggningsbegränsningar som angavssom hinder för verksamhetsutveckling. Enav föreningarna hade visserligen bedrivitett projekt inom Idrottslyftet – men utanlångvariga effekter och utan försök attupprätthålla verksamheten genom nyaansökningar. Överhuvudtaget menadeföreningarna att alla tillgängliga resurserlades på den ordinarie verksamheten och8 svensk idrottsforskning 1/2012


att det därmed saknade både idéer ochkrafter för att engagera sig i Idrottslyftet.Förening 1 var radikalt annorlunda.Föreningen hade en professionell ochspecialiserad styrelse, bestående avledamöter med höga positioner i näringslivet.Föreningen hade anställd strategiskoch administrativ personal. Även omföreningen hade tillgång till ideellakrafter var de inte beroende av demsamma utsträckning som de övriga treföreningarna. Tillgången till anställdpersonal fick även till följd att föreningenkunde bedriva ett kontinuerligt ochstrategiskt utvecklingsarbete. Vidare ägdeföreningen sin egen anläggning vilketskapade ett ekonomiskt överskott. Detillämpade även riskspridning genom attbedriva en rad olikartade verksamheter.Föreningen var djupt involverad i Idrottslyftetoch hade fått mycket medel därifrån.För att ha möjlighet att engagera siginom en satsning som Idrottslyftet är detalltså viktigt att det finns resurser iföreningarna, inte minst på ledarsidan.Därmed blir slutsatsen att Idrottslyftet ärmest anpassat för de föreningar somredan kommit en bit på väg i sitt utvecklingsarbete.För de klubbar som har idéeroch kraft att arbeta med dem har satsningenskapat möjlighet att realisera olikaformer av projekt och förändringsinsatseroch därmed förstärka en redan positivutvecklingsprocess. Men för föreningarsom kämpar med att få tid och ork till denordinarie verksamheten, och som kanskeär i störst behov av stöd, har satsningeninte inneburit en lika stor möjlighet(Figur 3).Vi har sett flera exempel på institutionaliseratagerande i den här studien. RFhar fördelat idrottslyftsmedlen tillspecialidrottsförbunden i enlighet medprinciper som skapades i Handslaget,och för dem har de säkerligen framståttsom högst rättvisa och naturliga.Men på lokal nivå framstår idrottslyftetinte alltid lika självklart. Fleraföreningar har vittnat om, inte barasvårigheterna med att engagera sig inomidrottslyftet, utan också att ens seengagemang inom satsningen somnågonting görbart. De upplevda hindren,har medfört att de inte ens uppfattatsatsningen som någonting för dem – därdet främsta och största hindret somidentifierats är bristen på personellaresurser för utvecklingsarbete.Studien har också pekat på att dettaspårbundna (8) agerande inte enbartbestämts av förhållanden inom denenskilda föreningen. Det är ocksåberoende av det externa sociala, geografiskaoch demografiska sammanhangsom den befinner sig i och är en del av.Idrottslyftets övergripande konstruktionoch strategiska upplägg har i storutsträckning borgat för accelererad takt– men i samma riktning. Det harresulterat i att stor har getts ökadmöjlighet att bli större. Frågan är dockvarför RF inte har utnyttjat möjlighetentill att byta riktning, att bryta mot denintrampade stigens självklarhet, för attdärigenom våga försöka åstadkommanågot radikalt annorlunda – och kanskeäven locka nya ungdomsgrupper tillidrotten?Referenser1. Norberg, Johan R. Idrottensföränderliga samhällsnytta. Kommande2012.2. Åkesson, Joakim. Var hamnadehandslagspengarna? 2007.3. Putnam, Robert D. Den fungerandedemokratin. 1996.4. Rothstein, Bo. Sociala fälloroch tillitens problem. 2003. s.170.5. Vedung, Evert. Utvärderingi politik och förvaltning. 2009.s. 116.6. Regeringen. Sveriges Riksidrottsförbundsdisposition avmedel från AB Svenska Spel.2007.7. Berger, Peter L. m.fl. The socialconstruction of reality. 1966. s.70-85.8. Steinmo, Sven. HistoricalInstitutionalism. I Della Portam.fl. Approaches and Methodologiesin the Social Sciences. 2008.s. 150-178.Kontaktjoakim.akesson@mah.sejohan.norberg@mah.seDen intrampade stigens självklarhetInom samhällsvetenskaplig teoribildningär institutionalisering ett vanligt begrepp.Det används för att förstå hur och varförmänniskor utvecklar vanor och rutiner.Som exempel har Peter L. Berger ochThomas Luckmann diskuterat hurkontinuerligt mänskligt agerande tenderaratt institutionaliseras. Rationalitetenbakom mycket mänskligt agerande är oftaatt ”man gör som man alltid har gjort”,vilket tenderar att osynliggöra alternativahandlingsmöjligheter. Även om förändringsåledes hela tiden äger rum tenderarden att gå i samma riktning (7).UtvecklingsarbeteResurs-överskottGrundläggande behovFigur 3. Utvecklingspyramid, där det grundläggande behovet måstetillgodoses innan det går att ta nästa steg uppåt i pyramiden.1/2012 svensk idrottsforskning 9


Idrott för allaUr nyanlända barns perspektivBarn som just kommit till Sverige har det inte alltid lätt att komma in iföreningslivet, även de vill vara med. Olika hinder måste övervinnas.Här ger Geoff, Mustafa, Kim, Annia, Maia och Saga sina bilder av hurde ser på idrotten i Sverige.Krister HerttingLektor i lärandeLuleå tekniska universitetInstitutionen för konst,kommunikation och lärandeInger KarleforsLektor i pedagogikUmeå universitetPedagogiska institutionenD e n o r g a n i s e r a d e i d r o t t e n i Sverigeska vara en öppen arena för alla, men allamedborgare deltar inte i idrottsverksamhet.Verksamheten har två olika mål,tävlingsfostran och föreningsfostran (2).Dels en fostran till tävlingsidrottare, delstill goda föreningsmedlemmar enligtsvensk folkrörelsetradition. Det tycksdock finnas en snedrekrytering somuttrycks genom att pojkar idrottar mer änflickor och att rika idrottar mer än fattiga(2). Det gäller såväl svenskfödda sominvandrade barn och ungdomar. Barn ochungdomar med invandrarbakgrund ärunderrepresenterade i föreningslivet (3)särskilt flickor (4,5). Idrottsrörelsensidéprogram Idrotten vill uttrycker enambition att invandrade barn och ungdomarska ha möjlighet att delta i idrott.Idrotten ska ”aktivt arbeta för att barn ochungdomar med invandrarbakgrundkommer med i idrottens föreningsverksamhet”(1).Idrotten som integrationsarenaAktiviteter inom den svenska idrottsrörelsenhar under ett drygt sekel växt till attbli den vanligaste fritidssysselsättningenför barn och ungdomar. Den utvecklingoch framgång som den organiseradeidrotten har genomgått under de senastedecennierna har enligt pedagogen Lars-Magnus Engström begränsat den oorganiserade,spontana idrotten (6). Han menardock att den nu växer igen, men i andraformer. Folkrörelsebakgrunden och detideella engagemanget gör att idrott ocksåengagerar många föräldrar och därförborde kunna fungera som en viktigmötesplats mellan nyanlända och redanetablerade medborgare. Genom idrottenkan nyanlända lättare involveras och fåkontakter i det nya hemlandet. Ettömsesidigt utbyte skulle vara möjligt ochinvandrande barn och ungdomar somkommer till idrotten skulle då inte baraanpassas till den svenska modellen, utanäven vara med att omforma och utveckladen (7).Men bilden av den organiserade idrottensbetydelse för invandrares integration är inteentydig. Idrottsrörelsen har svårt attattrahera alla medborgare, där socioekonomi,kön, kultur och etnicitet är begränsandefaktorer, och verksamheten tycksoftare styras av idrottens behov än av deidrottandes intressen (2,8,9). Den organiseradeidrotten tycks ha svårt att vara receptivmot den kulturella mångfald som invandradebarn och ungdomar representerar.Forskaren Kristin Walseth använderbegreppen bridging och bonding när hondiskuterar och beskriver idrottsutövandetsbetydelse för kontakt och kommunikationmellan idrottsdeltagare (10). Bridginginnebär att lära känna människor som ärannorlunda än en själv, till exempel människormed annan kulturell och etniskbakgrund. Bonding innebär att behållarelationen med kamrater med sammabakgrund som man själv. Walseths studievisar att de flesta nya relationer i en idrottsklubbär ganska ytliga, men även om de ärytliga kan de ha betydelse för att lära kännalagkamraternas bakgrund, normer ochvärderingar. Bonding är vanligt inomidrottsverksamhet där individer som harkänt varandra länge finns i samma idrott.Det är inte lätt komma in i den idrottsgemenskapen,vilket kan leda till utanförskap(11,12).Idrott och identitetsarbeteRelationen mellan kultur och identitet haravgörande betydelse för om individen väljeratt delta i en verksamhet eller inte (5). En10 svensk idrottsforskning 1/2012


individs identitet har formats av denuppväxt och den kultur man växt upp i.Forskaren Fazal Rizvi menar att skapandetav kulturer och identiteter är enmångfacetterad och rörlig process däridentiteter och sociala sammanhang bådeformar och formas av varandra (13).Walseth använder termen identity workför att betona att identiteten är något somindividen måste arbeta med (14). I spänningsfältetmellan den egna kulturen ochden nya, blir identiteten ifrågasatt ochresultatet kan bli ett ställningstagande omatt delta i idrott eller inte.De flesta studier som har beskrivit deinvandrade barnens och ungdomarnasföreställningar och erfarenheter av denorganiserade idrotten har riktat sig motungdomar, som redan är eller har varitinvolverade i idrottsrörelsen. I den härstudien vill vi ta fasta på de bilder ochföreställningar om idrott som barn harmed sig till Sverige och hur barnen ser påidrott som fritidssysselsättning i den formden har i Sverige.Barns bilder av idrott i SverigeStudien genomfördes på en skola förintegration i en svensk kommun, där allanyanlända barn påbörjar sin skolgångmed fokus på språkinlärning. När barnenanses mogna slussas de över till denordinarie skolgången. Tiden vid integrationsskolanär cirka sex månader till tvåår, beroende på ålder och bakgrund.Målgruppen i studien var barn mellan 10-13år. Studien genomfördes i två steg. I detförsta steget inbjöd vi 20 barn (två grupperom tio barn) att rita teckningar. Instruktionenvar att rita en bild om en upplevelse avidrott i hemlandet. Många av barnen hadevid det tillfället precis anlänt till Sverige. Isamband med det fördes enklare informellasamtal med barnen för att få en störreförståelse för deras tankar (15). I nästa steg,åtta månader senare, deltog sex barn iintervjuer om sina erfarenheter och önskningarom idrott i Sverige. Dessa barnpresenteras närmare i den här artikeln. Ianalysen av teckningsstudien framträddetre teman: idrotten som formell arena,idrotten som informell arena och idrottensom åskådararena. Urvalet av barnen ärgjort utifrån dessa teman.Geoff kom hit från Indonesien tillsammansmed sin pappa. Mamma är kvar iIndonesien. Hans teckning visar barn somspelar fotboll, men också en annan lek –jampering. Det träd som finns på teckningensymboliserar leken. Den går till såatt barnen klättrar upp i ett träd med oljadstam och hämtar saker som hänger i trädet.När han spelade fotboll i Indonesien var detmest på lek tillsammans med kompisar,men han har också spelat organiserat medtränare. Här i Sverige vill Geoff spela fotbolli ett fotbollslag på sin fritid och har ocksåBarnen i studien har olikaerfarenheter av organiserad idrott.Kulturella skillnader finns och ävenen könsskillnad. Två flickor kan intedelta på grund av att bland annatklädseln sätter stopp för det.Barnen på bilden har inget att göramed de barn som nämns i artikeln.1/2012 svensk idrottsforskning 11


haft kontakt med en klubb där hanskompis spelar. Han fick dock inte börjadirekt utan han behöver träna mer först.Det skulle betyda väldigt mycket förhonom om han blev antagen till laget.Fotbollen i Sverige är annorlunda än den iIndonesien menar Geoff. I Sverige behöverman kunna passa mer än i Indonesien,där sparkade man hårt. Geoff tycker attskolan är roligare än fritiden för där harhan sina kompisar, och han är medvetenom att skolan är viktig och att han måstelära sig mer.Mustafa kommer från Burma, menbodde senast i Thailand. I Burma lektehan fotboll med sina kompisar menspelade inte organiserat. Mustafa tränarsedan en tid tillbaka två gånger i veckanmed ett fotbollslag i Sverige och vill blifotbollsproffs. Han menar att han harkompisar i laget under träningar ochmatcher, men umgås inte med de andraspelarna i laget efter träningen. Då umgåshan i stället med sina klasskompisar frånspråkskolan. Han har ibland svårt att följamed och förstå det tränarna säger påsvenska och tycker det är svårt att fråga.Ibland frågar han en lagkompis. Hantycker att det vore bra om tränarnapratade långsammare, då skulle det varalättare för honom att förstå. Han försökertitta på övningarna och skapa sig enförståelse för hur de ska utföras. Hanskulle gärna ha med sig de andra kompisarnafrån språkskolan på träningen, detskulle göra honom mer trygg. När haninte är i skolan eller på träning så försökerhan lära sig svenska och läser andra läxor.Kim är från Kina har bott sex månaderi Sverige. Han tycker mycket om att spelapingis. Han spelade mycket med sinpappa i en park i Kina, men han har intespelat pingis sedan han kom till Sverige.Nu spelar han gitarr och dator på sinfritid. Han skriver, målar och läsernyheter. Han träffar inga kompisar påfritiden, utan gör många saker för sigsjälv. Kim tycker om att simma och hanskulle gärna spela tennis på sin fritid. Hanskulle gärna vilja komma i kontakt med enidrottsförening, i pingis eller tennis. Menhan vet inte hur man gör. Hans pappa kaninte heller så pass bra svenska att han kanhjälpa till.Annia kommer från Somalia. Hon är 11år går i 4-5-6:an. Hon har sjal runt huvudetoch lång kjol. Hon har sju systrar och tvåbröder. Efter skolan leker hon ofta med sinasyskon ute. De jagar varandra, kastarsnöboll och pratar somaliska. I Somalialekte de andra lekar, för där fanns ingen snöatt göra snöbollar av. Hon har ingenerfarenhet av idrott från Somalia och honkan inte vara med på den idrottsundervisningdär man måste ha lite kläder på sig. Dåsäger hon att hon är sjuk. När de springerså är hon med och på redskapsbana. Påfritiden när hon inte leker, gör hon läxor.Svenska och matematik nämner honsärskilt. Det finns ingen idrott som honskulle vilja hålla på med.Maia är en allvarlig lite blyg tjej på 12 år.Hon har en bror som är 14 år. I Thailandspelade hon fotboll. De spelade 11-mannafotbolloch hon spelade center. Det varroligt att spela fotboll, men ibland kundedet bli för allvarligt. I Sverige spelar hontennis på tv:n. Det är roligt, men hon skullegärna lära sig tennis på riktigt, men hon vetinte hur det skulle gå till. Hon spelar ocksåbordtennis och badminton på tv:n. Basket,som det finns mycket av i staden och påhennes skola, tycker hon inte om. Hon harfått bollen i huvudet och det gör ont, såbasket vill hon inte spela. Badminton skullehon helst vilja spela och gärna med andratjejer. I Sverige spelar hon fotboll en gång iveckan med skolan. På idrottslektionernaspelar de badminton, basket och springer.Maia kan inte simma, men är med påsimlektionerna. Hon går dock inte påbadhuset själv med sin bror eller med familjenför att träna.Saga är 12 år är en charmig, glad ochöppen tjej som kommer från Afghanistan.Hon har en syster och tre bröder, så de ärsju i familjen. I Afghanistan har hon en vithäst, hund, får och kor, som hon lämnadedär. Om hon reser tillbaka dit kan de kramahenne säger hon med längtan i rösten. Sagaritade fyra barn som spelar basket. Det ärhon själv och hennes klasskompisar. Maia,som inte tycker om basket, är en av dem. Despelar basket på skolgården och då de harolika språk så talar de svenska med varandra.I Afghanistan spelade hon fotboll,lekte, hoppade hopprep och lekte kurragömma.Pojkar och flickor lekte tillsam-12 svensk idrottsforskning 1/2012


mans. Saga gör inget särskilt efter skolan.Hon är hemma och läser, övar till någotprov eller spelar dator. Hon vill inte varamed i någon klubb och spela basket för nuär det ju snö ute. Men inne vill hon inteheller spela, för det är för många pojkarsom gör det. Hon behöver också varahemma och passa sina småsyskon närmamma och pappa arbetar. Hon har ingasvenska kompisar, men skulle gärna viljaha några. Saga är så duktig på att simma såhon ska börja lära sig simma ryggsim. Omnågon skulle be henne komma och spela isitt basketlag skulle hon följa med (åtminstonemed intervjuaren): ”Jag kommer meddig alltid”, säger hon. Ska hon vara med inågon klubb vill hon ha någon kompis medsig eller någon som hon känner.Svårt att få kontakt med idrottenDen preliminära analysen av intervjuernavisar på intressanta mönster. Utgångspunktenför analysen var alltså de teman somframkom vid teckningsstudien: idrottensom formell arena, idrotten som informellarena och idrotten som åskådararena. Vidintervjuerna framkom att alla utom enpojke fanns på åskådararenan, men flera avbarnen ville in på den formella idrottsarenan.Att inte veta hur man kommer ikontakt med en idrottsklubb, att inte varabra nog eller att vilja ha någon som räckerut handen och säger ”Kom med”, var treskäl till att barnen befann sig på åskådararenani Sverige.Barnen har också olika erfarenheter avorganiserad idrott beroende på vilket landde kommer ifrån. Medan Kim, Maia och iviss mån Geoff har erfarenhet av organiseradeidrottsaktiviteter (det ingår i derasidentitet) så har de andra barnen inte denerfarenheten. Förutom att idrottserfarenhetkan bero på en kulturell skillnad, kan vi anaatt det också finns en könsskillnad. Två avflickorna kan inte delta i organiserad idrottpå grund av klädseln, att pojkar är där elleratt de behöver ta ansvar för familjen.Familjeförhållanden tycks också ha enbetydelse. Med många syskon att leka medligger den informella aktiviteten närmreidentiteten än den formella. Mustafa är denenda som tagit sig in i den organiseradesvenska idrotten. En förståelse av hansberättelse är att han kommit till det Walsethbenämner bridging, men han harfortfarande en bit kvar till bonding.De preliminära resultaten visar attbarnens ankomst till en ny kultur gör attdet blir förskjutningar mellan aktivitetsarenorna.Olika hinder måste övervinnasför att barnen ska kunna delta i idrottsverksamheten.De flesta barnen i studienhamnar på åskådararenan och deninformella arenan när de kommer tillSverige, men det finns en önskan att ta sigtill den formella arenan. Trots politiskaintentioner om en idrott för alla finns detsvårigheter för barnen att komma ikontakt med idrotten som formell arenavid ankomsten till Sverige, och även närkontakten är tagen är det inte självklartatt få vara med.Vi har i tidigare studier sett att barnsom rör sig i flera kulturella sammanhangoch utvecklar vad man skulle kunnabetrakta som dubbla identiteter atthantera, kan göra detta till något positivtoch en stolt del av den man är (16). Kanidrotten hjälpa till att skapa utrymme förden stoltheten och bli en positiv byggsteni skapandet av en identitet i det nyahemlandet? Som forskaren TomasPeterson lyfter fram finns möjligheten attinvandrade barn och ungdomar inteenbart formas av den svenska idrottsrörelsen,utan att de också är med ochutvecklar och omformar den (8). Idrottenhar en lång tradition av internationellaoch globala möten. Men idrotten verkarockså lokalt. För oss i Sverige är det enutmaning att få vårt svenska system att påett naturligt sätt möta de globala rörelsersom är ett faktum i dagens samhälle. Föratt möta barn och ungdomar som kommerhit från andra kulturer sätts högre krav påförståelse, känslighet och flexibilitet hosden svenska idrottsrörelsen och dessföreningar. Genom förståelsen, känslighetenoch flexibiliteten kan idrottsrörelsennärma sig de bilder som barn från olikakulturer har av idrott, och någonstanssmälta samman med dessa. Det skullevara till gagn för både idrotten och allabarn som vill vara en del av idrottsrörelsen.Vi hoppas få möjlighet att genomföraen studie inom ett par år, när barnenhunnit etablera sig i sina lokala skolor ochsina lokala sammanhang och vidarestudera hur dessa barns förhållande tillden svenska idrottsrörelsen har utvecklats.Referenser1. Idrotten vill. Riksidrottsförbundet.2005.2. Peterson, T. SOU 2008:59.Föreningsfostran och tävlingsfostran.2008.3. Norberg, J. R. Idrott och integration.En kunskapsöversikt.Riksidrottsförbundet. 2002.4. Idrott och integration – enstatistisk undersökning. Riksidrottsförbundet.2010.5. Strandbu, Å. Identity, embodiedculture and physical exercis:Stories from Muslim girls in Oslowith immigrant back groundsYoung. 2005. 13:27. pp27-45.6. Engström, L-M. Svenskidrottsforskning. 2004. 4:10-15.7. Peterson, T. Idrotten somintegrationsarena? I: Att mötafrämlingar. G. Rydstad & S. Lundberg(red). Arkiv. 2000.8. Walseth, K. En problematiseringav idretten som arenaför integrasjon av etniskeminoriteter. www.idrottsforum.org. 27 januari 2012.9. Lundvall, S. Handslagsrapport2007:13. Riksidrottsförbundet.2007.10. Walseth, K. Sport, Educationand Society. 2008. 13, 1: 1-17.11. Elling, A & Knoppers, A. JYouth and Adolescence. 2005.34, 3:257-268.12. Cortis, N. Australian J SocialIssues. 2009. 44, 1:91-106.13. Rizvi, F. Discourse: Studiesin the Cultural Politics of Education.2009. 30, 3:253-268.14. Walseth, K. Young MuslimWomen and Sport: The Impact ofIdentity Work. 2006.15. Karlefors, I. & Hertting, K.Svensk Idrottsforskning. 2011.20, 2:21-25.16. Hertting, K., Alerby, E. Int JLearning. 2009. 16:633-648KontaktKrister.hertting@ltu.seInger.karlefors@ltu.se1/2012 svensk idrottsforskning 13


Ledare osäkra ombarns rättigheterHur ser ledare på barns rättigheter? Svaren från närmare200 ledare visar att många är ovana att resonera i termer av attidrottande barn har rättigheter och att kunskapen om barnkonventionensinnehåll är låg.Karin RedeliusDocent i pedagogikGymnastik- och idrottshögskolanS v e r i g e s r e g e r i n g har bestämt att ”allbarn- och ungdomsverksamhet som fårstatligt stöd ska bedrivas ur ett barnrättsperspektiv”(1).Ett sådant perspektiv utgårfrån FN:s konvention om barnets rättigheter,den så kallade barnkonventionen.Känner barn- och ungdomsledare till detregeringsbeslutet? Har de kunskap omvad det innebär att ta utgångspunkt i ettbarnrättsperspektiv? Och vilka rättigheteranser ledare att idrottande barn har?De här frågorna behandlas i studienIdrottsledarna och barnkonventionen (2).Syftet med undersökningen var attstudera idrottsledares syn på idrottandebarns rättigheter, med särskilt fokus påbarns rätt till delaktighet och att fåkomma i främsta rummet. Frågeställningarnarör ledares syn på vilka rättigheteroch skyldigheter idrottande barn har, vadbarn kan vara delaktiga i och bestämmaöver, vad det innebär att utgå från barnetsbästa, och vilket barns bästa som avses. Iden här artikeln är fokus särskilt riktatmot den första frågan: Vilka rättigheteroch skyldigheter anser ledare att idrottandebarn har? Barnkonventionen utgörden fond mot vilken resultaten tolkas ochdet är också konventions definition avbarn, alla människor under 18 år, somanvänds i studien (3).Idrotten vill – inte bindandeRegeringen är alltså tydlig med att idrottför unga ska utgå från barnkonventionen,men vad anser idrottsrörelsen? På Riksidrottsförbundetsstämma år 2009 beslutadesatt utformningen av all barn- ochungdomsidrott ska utgå från barnkonventionen,och att så ska föras in i idéprogrammetIdrotten vill. Skrivelsen inledernu de riktlinjer och rekommendationersom sedan programmets tillkomst år 1995stipulerar hur idrott ska utformas för barnoch unga (4). Idrottsrörelsens officiellahållning överensstämmer alltså medregeringens beslut, men idrottsrörelsenbestår av självständiga förbund ochföreningar och även om Idrotten vill utgörett styrdokument har den ingen bindandefunktion. Utvärderingar har också visatatt Idrotten vill inte har särskilt storgenomslagskraft på föreningsnivå (5). Huridrott ska utformas för barn och ungaverkar det med andra ord finnas olika ochdelvis motstridiga uppfattningar om. Detär därför angeläget att studera vilkaföreställningar idrottsledare har om barnsrättigheter, liksom vilken förståelseledarna har om vad ett barnrättsperspektivkonkret kan innebära. Det senare ärockså en förutsättning för att perspektivetska kunna omsättas i den praktiskaidrottsverksamheten, vilket påpekas iregeringens proposition (1).Idrottsledares dubbla uppdragEn utgångspunkt för studien är att ledareshandlingsutrymme är beroende av detsammanhang som ledaren ingår i. Meddetta menas, enkelt uttryckt, att ledareinte enbart agerar efter eget huvud, utanatt deras agerande är betingat av densituation de befinner sig i. I det här falletutgörs situationen av en idrottslig praktikdär det både finns uttalade och outtalade14 svensk idrottsforskning 1/2012


egler för och förväntningar på hur enidrottsledare ska uppträda. Hur en ledarehandlar, hur han eller hon utformar ochorganiserar idrottsverksamheten, ärpåverkat av ledarens egna kunskaper och”Drygt hälften svaradeatt de inte känner tillIdrotten vill.”erfarenheter av idrott men också av hurdessa kunskaper och erfarenheter tasemot av omgivningen (6).Den speciella miljö som barn- ochungdomsidrotten utgör är också betingadav det som Tomas Peterson kallar föridrottsledares dubbla uppdrag: delsföreningsfostran, vilket är det uppdragsom kommer från samhället, dels tävlingsfostran,vilket är idrottens egetuppdrag (5). Det förra handlar om attutveckla demokratiska tanke- och handlingsformeroch att ge barn och ungdomarmöjligheter att idrotta och att varadelaktiga i och ta ansvar för sin egenidrottsutövning. I uppdraget ingår att tahand om alla dem som vill vara med ochatt låta var och en utvecklas på sinapremisser. Genom att barn och ungdomarfår en föreningsfostran uppfylls en del målsom inte nödvändigtvis handlar om idrott,men som är viktiga ut ett samhälleligt perspektiv.Det andra uppdraget däremot, tävlingsfostran,handlar om att uppfylla idrottensmål. Denna fostran innebär att lära deunga att handskas med vinster ochförluster, medtävlare och motståndaresamt att förbereda barn och ungdomar föratt kunna prestera så bra som möjligt i ettidrottsligt tävlingssammanhang. Målet ärmed andra ord att bli bra i idrott, och idetta fostransuppdrag ingår att ge alla engrenspecifik utbildning och att utvecklabarn och ungdomar till duktiga idrottsutövare.Även om förenings- och tävlingsfostraninte behöver utesluta varandra,präglas ledaruppdraget av dessa delvismotstridiga mål.Vilka ledare tillfrågades?Två olika datainsamlingar ligger till grundför studien. Den första består av intervjuermed tolv idrottsledare, åtta män ochfyra kvinnor. Ledarna är mellan 22 och 52år och de verkar som tränare för barn ochungdomar i föreningar i Mälardalen och iStockholmsområdet. De representeraridrotterna badminton, bordtennis, fotboll,gymnastik, ishockey, karate och konståkning.Ledarna är verksamma i både lagochindividuella idrotter och de representerarbåde bredd- och mer elitinriktadeföreningar.Den andra datainsamlingen består avenkätsvar från 160 ledare. Av dessa är 111män (70 procent) och 49 kvinnor (30procent). Den äldsta ledaren är 64 år ochden yngsta 15 år. Medelåldern är 33 år. Deflesta har varit ledare i minst fem år, mennågra gjorde sin första säsong. Var femteledare har varit ledare i tolv år eller mer.Knappt 40 procent har egna barn blanddem de tränar. Åldersspannet på de barnoch ungdomar de är ledare för varierarmellan 5 och 18 år. Ledarna representerarett trettiotal olika idrotter.Få känner till idrottens idéskriftI idrottsrörelsens gemensamma idéskriftIdrotten vill finns de övergripanderiktlinjerna för hur barn- och ungdomsidrottska bedrivas. Dokumentet är ettviktigt styrinstrument, men frågan ärvilken kunskap ledarna har om skriften.Drygt hälften (55 procent) av ledarnasvarade att de inte känner till Idrottenvill. En fjärdedel sa att de har hört talasom dokumentet och tio procent svaradeatt de har bläddrat i det. Knappt sjuprocent (eller elva personer) svarade attde har läst Idrotten vill.Regeringen beslutade relativt nyligenom att enbart den barn- och ungdomsverksamhetsom bedrivs i enlighet med ettbarnrättsperspektiv ska erhålla statligtstöd. Har beslutet ändå nått fram tillverksamma idrottsledare? Av de ledaresom besvarade enkäten, anger majoriteten(80 procent) att de inte känner tillregeringsbeslutet. I en öppen frågaombads ledarna ge exempel på vad detkan innebära att utgå från barnkonventionennär man utformar idrott för unga.Drygt 70 procent svarade att de inte visstevad det kan innebära medan resterandeandel ledare formulerade olika förslag.Vilka rättigheter har barn?I enkäten ställdes frågan: Har de barn/ungdomar som du leder några rättighe-1/2012 svensk idrottsforskning 15


Det har stormat ordentligt kringgymnastiksporten den senaste tiden.Tidiga elitsatsningar har kritiseratshårt, inte minst i en artikelserie iDagens Nyheter. Flera före dettagymnaster har beskrivit träningsklimatetoch vittnat om en osundtränarkultur.ter? En stor andel ledare (70 procent)svarade ’Ja’ på den frågan. Resterandeandel svarade antingen att idrottandebarn inte har rättigheter (cirka 10 procent),eller att de åtminstone inte harnågra som de kan komma på (cirka 20procent). Ledarna beskrev också medegna ord cirka 150 olika exempel på vadrättigheterna kan bestå av. I stort kan dekategoriseras i sex skilda områden, det villsäga barns rätt:1. Att delta.2. Att bli behandlade väl, respekteradeoch sedda.3. Att få säga vad de tycker och blilyssnade på.4. Att få utvecklas i sin idrott.5. Att få bestämma (vissa) träningaroch övningar.6. Att ha utbildade, kunniga ochengagerade ledare.Svarsbilden var dock inte enhetlig utankännetecknas istället av stor spridning.Att dessa kategorier går att mejsla utbland svaren betyder alltså inte att allaledare gav exempel på samtliga, eller enspå någon, av ovanstående rättigheter.Rätten att få säga sin åsikt och att blilyssnad på, som är en viktig princip ibarnkonventionen, var en av de vanligastförekommande. Ändå var det inte fler änett tjugotal av de cirka 150 exempel somgavs som handlade om barns rätt att fåkomma till tals. Rätten att bli respekteradoch bemött på ett bra sätt när manidrottar förekom också i ett tjugotal svar.Många av svaren var kortfattade ochknapphändigt formulerade, vilket inte ärså konstigt med tanke på att frågan skullebesvaras skriftligt i en enkät. Låt ossdärför vända blicken mot de ledare somintervjuades och se hur de besvaradefrågan om idrottande barns rättigheter.Är rättigheterna självklara?Då frågan ställdes i intervjuerna var dettydligt att många ledare först inte förstodden. En av dem, en konståkningstränare,begrundade frågan länge och sa sedan:”Oj, vad svårt … [lång paus]. Jag kan ju bara talaom konståkning och där kan jag inte komma pånågonting… faktiskt. Näe, har du något förslageller någon ledtråd?”Andra ledare behövde också fundera enstund, och uttryckte sig sedan lite tvek-16 svensk idrottsforskning 1/2012


samt, som om det var något lurt medfrågan: ”Ja… det ska de väl ha… nu är jaginte riktigt säker på var du vill komma?”Att det för många var ovanligt att tänka itermer av idrottande barns rättigheter,bekräftades även mot slutet av intervjun.Ledarna ombads då reflektera över omdet var något som behandlats i intervjunsom de inte tänkt på tidigare. En ledaresvarade:”Ja, det här med barns rättigheter … den hadejag inte ens lagt en tanke på. Jag tror att det lättblir att man tänker på vad de har för skyldigheter.När du sa rättigheter, då kunde jag intekomma på något. Jag har inte ens funderat kringden frågan alls… faktiskt. Och det tror jag intebara gäller mig.”Flera var inne på samma spår, såledarens fundering ovan stämmer. Entränare hade dock inga svårigheter medatt formulera sig. En badmintontränareför tonåringar svarade snabbt:”Om de har några rättigheter? Ja … jag tvingarde aldrig. De är här på egen fri vilja. Jag säger såhär: Jag kan inte tvinga er och jag vill inte tvingaer. Ni får gå hem precis när ni vill, och så får nikomma tillbaka nästa gång. Jag kommer inte atttvinga er, men jag kommer att driva er till saker.Det är mitt jobb. Jag kommer att driva er tillutveckling!”I ovanstående citat låter det nästansom att barn också har en skyldighet attutvecklas, och frågan är vad ledare anserom barns skyldigheter. Den frågan utgörden andra sidan av myntet och sägerindirekt också något om barns rättigheter.Vilka skyldigheter har barn?Både i enkäten och i intervjuerna fickledarna besvara frågan om idrottandebarn har några skyldigheter. När detgäller den frågan redovisas intervjusvarenförst. Vi fortsätter därför med denbadmintontränare som citerades ovan.När han talar om barns rättigheter,framhåller han att han aldrig tvingarbarn. På följdfrågan, som handlar omhuruvida barn som idrottar har någraskyldigheter, återkommer han till fråganom tvång kontra frihet:”Skyldigheterna är att de ska vilja! När dekommer till min träning så måste de vilja vissasaker; de ska vilja driva sin kropp. Det finnsinget tvång. Tvånget är att de ska försöka, mendet är det enda. […]. Det finns inget tvång, jagkan inte tvinga dom till någonting. Men jag körju med krav, jag kör med hot, jag kör med… allade saker som alla ledare gör.”Att döma av ovanstående utsagahandlar barns skyldigheter om att demåste vilja. Enligt tränaren är det viljanatt driva sin kropp hårt och viljan attalltid försöka som räknas, och som detenligt honom är barns skyldighet att levaupp till på träningen.Flera andra ledare talar i intervjuernaom vikten av att vara fokuserad och omatt barnen måste göra sitt bästa. Ledarnaframhåller att det förvisso är en rättighetför barn att få idrotta, men i samtalen blirdet tydligt att när barnen väl är på enträning, då har de också en skyldighet attgöra det de är där för, nämligen träna ochgöra som tränaren säger. En fotbollstränaresom har hand om tioåriga flickor,säger:”Ibland är de ju ofokuserade, så otroligtofokuserade och vi tycker att vi lägger ner tiddels på att lägga upp en träning, dels på att varadär… och då kan de ju inte hålla på och flamsa,de måste ju lyssna på vad vi säger.”När fotbollstränaren uttrycker sig pådet viset handlar vikten av koncentrationom att barnen ska vara fokuserade förledarnas skull. Ledarna har ansträngt sigoch lägger ner tid, oftast ideell sådan, påsitt uppdrag. Då måste de också fåutdelning i form av uppmärksamma barnsom beter sig så som ledarna vill ochönskar.Vi ska nu närmare granska enkätsvaren.Drygt 20 procent av ledarna menadeatt idrottande barn inte har någraskyldigheter (eller åtminstone inga somde kan komma på). Resterande andel gavmed egna ord exempel på vad idrottandebarns skyldigheter kan bestå av. Liksom ifallet med rättigheter är det ingenenhetlig svarsbild som tonar fram, utanexemplen är många och av olika karaktär.När ledarna själva ger exempel påskyldigheter kan det låta som följer:”Passa tiden, vara tysta när andra pratar, räckaupp handen om de vill säga något, respekteraalla i laget”. (manlig fotbollstränare)1/2012 svensk idrottsforskning 17


Referenser1. Regeringens proposition2008/09:126, Statens stöd tillidrotten.2. Den fullständiga rapportenfinns att ladda hem på Riksidrottsförbundetswebplatswww.rf.se.3. Förenta Nationerna. FN:s konventionom barnets rättigheter.1989.4. Riksidrottsförbundet. Idrottenvill. 1995; 2009.5. Se t.ex. Engström, L-M. m.fl.Idrotten vill. En utvärderingav barn- och ungdomsidrotten,FoU-rapport 2007:1.6. Säljö, R. Lärande i praktiken:ett sociokulturellt perspektiv.2003.7. Peterson, T. Talangutvecklingeller talangavveckling?. 2011.8. Elvin, G. Möjligheternas dokument.I För barnets bästa: enantologi om idrott ur ett barnrättsperspektiv.Centrum föridrottsforskning 2011:2.Kontaktkarin.redelius@gih.se”Vara en god kamrat och engagerad i träningen”.(manlig simtränare)”Kämpa på träning och match”.(manlig handbollstränare)”Närvara på träningar och följa programmet”.(kvinnlig baskettränare)”Komma i tid, höra av sig om de inte kan komma,vara vänliga mot andra”. (kvinnlig gymnastiktränare)”Hålla tider, vara ordningssam, normalaskolregler”. (manlig brottningstränare)De enskilt vanligaste skyldigheterna somanges är att komma i tid till träningenrespektive att höra av sig om man intekommer (cirka 25 svar vardera). Deframhåller även vikten av att följa överenskomnaregler. Och precis som entränare uttrycker det i sista citatet ovan,så är det i mångt och mycket skolansregler som ledarna anser vara idrottandebarns skyldigheter.Rättigheter och skyldigheterEn kort sammanfattning av resultaten gervid handen att skriften Idrotten vill i stortsett är okänd. Åtminstone sett till hurmånga som de facto anger att de lästskriften, men andemeningen kan naturligtvisvara känd bland ledarna. Merpartenav ledarna har inte hört talas omregeringens nya riktlinjer rörande detstatliga stödet. En majoritet kan hellerinte ge exempel på vad det kan betyda attha barnkonventionen som utgångspunktdå idrottsverksamhet för barn och ungaska utformas. Dessutom är många ledareovana att tänka i termer av och att tala omidrottande barns rättigheter. Flera menaratt frågan om barns rättigheter sällanberörs inom idrotten, vilket dock inte ärdetsamma som att barns rättigheter intetillgodoses i den praktiska idrottsverksamheten.När ledarna ombeds ge exempelpå vad rättigheterna kan bestå av, ärdet inte en enhetlig bild som tonar fram.Det kan både bero på att det finns mångarättigheter att framhålla, och att det intefinns någon samstämmig uppfattningbland ledarna om vad idrottande barnsrättigheter kan bestå av. Att beskrivaidrottande barns skyldigheter, verkar förledarna te sig något lättare.Frågan om rättigheter och skyldigheterär komplex. Nästan samtliga av dekategorier svar som identifierades sombarns rättigheter, går att återfinna somskyldigheter: Barn har rätt att delta iidrott men de har också har skyldighet attträna, komma i tid och att meddelafrånvaro. Barn har rätt att bli bemötta väl,respekterade och sedda men de har ocksåskyldighet att ha ett gott uppförande,respektera andra och vara en bra kompis.Barn har rätt att komma med synpunkteroch att bli lyssnade på men de har ocksåskyldighet att lyssna på andra, vara tystanär ledarna pratar och att följa instruktioner.Barn har rätt att utvecklas i idrottmen de har också skyldighet att ha rättinställning, vara fokuserade och göra sittbästa. En tolkning av att idrottande barnsrättigheter och skyldigheter framstår somtvå sidor av samma mynt, går att hänföratill idrottsledares dubbla uppdrag. De harrätt att vara med, känna delaktighet ochmå bra (föreningsfostran), men de harockså en skyldighet att träna så att deutvecklar sina färdigheter och att ha rättinställning (tävlingsfostran).Barnkonventionen – ett stöd!Att barnkonventionen ska vara enutgångspunkt om föreningen ska fåstatligt stöd, känner alltså få ledare till.Skulle konventionen, om den var merkänd och bearbetad, kunna vara ett stöddå ledarna balanserar mellan att låta allavara med och att utveckla vinnare?Gunnar Elvin, som arbetar på Barnombudsmannenoch som har erfarenhet somidrottsledare, är övertygad om att barnkonventionenär ett användbart redskap(8). Han uppfattar barnkonventionen sommöjligheternas dokument, och menar attkonventionen inte ska ses som en samlingregler utan som ett förhållningssätt. Föratt vara säker på att man som idrottsledarehar ett förhållningssätt där barnetsbästa är i fokus, finns det ett par enklakontrollfrågor som man som ledare kanställa sig: Varför finns vi som förening?Vem är verksamheten till för? Om maninom föreningen eller enskild ledare påallvar reflekterar över de frågorna, är detsvårt att komma fram till något annat svarän att det är utövaren, alltså barnet, somverksamheten är till för. Med ett sådantförhållningssätt blir frågan om idrottandebarns rättigheter lätt att besvara.18 svensk idrottsforskning 1/2012


När upphör ledarenssociala ansvar?Så gott som alla barn- och ungdomsledare säger att de tar ett socialtansvar. Men i konflikten mellan idrottsliga mål och sociala insatserväljer de flesta idrotten. Vad tycker egentligen ideella ledare omidrottens självpåtagna roll som fostrare?D e n o r g a n i s e r a d e i d r o t t e n är ettstort fenomen i det svenska samhället,och det gäller inte minst barn- ochungdomsidrotten. Mer än hälften av allaungdomar mellan 13 och 20 år tränadeeller tävlade i en idrottsförening år 2010(1). Ungdomsidrotten är viktig, inte barasom ett fritidsintresse, utan också eftersomdet finns en förväntan på att idrottenska fostra de barn och ungdomar som äraktiva i idrottsföreningar samt vara ettsocialt stöd för dem som behöver. Barnochungdomsidrott handlar alltså intebara om att leka, träna och tävla, den harockså en social dimension. Idén om attidrott kan fostra barn och ungdomar ärgammal, den formades under det tidiga1900-talet, och är fortfarande viktig föridrottsrörelsen (2). Att idrotten är fostrandeoch tar socialt ansvar ger denlegitimitet i det vidare samhället, inteminst gentemot staten. Det finns godaskäl att undersöka denna sociala dimension,hur den uttrycks och hur manuppfattar den inom idrotten.Det är de ideella idrottsledarna sommöter och interagerar med barn ochungdomar och det är de som representeraridrottsföreningen. För att undersökaom och hur idrotten har en fostrandefunktion är denna grupp viktig. Nästanvar tionde vuxen person i Sverige ärideellt engagerad i idrotten, och många avdem i barn- och ungdomsidrotten (3).Därför finns alla typer av människorrepresenterade bland ledarna. Vidarefinns det många olika skäl till att bliledare. Här finns idrottsintresserade,föreningsmänniskor men också föräldrarsom blivit engagerade genom sina barn.Idrottsledarna är alltså en viktig menockså mycket heterogen grupp. Dessutomär det förbryllande att idrott har uppfattatsvara ett sätt att stötta barn och ungdomar.Tävlingsidrott, som denna undersökningägnar sig åt, karaktäriseras inte av socialthänsynstagande, tvärtom syftar den till attnågon ska vinna. Det finns alltså enspänning mellan tävlingsidrottens prestationsintresseoch samhällets förväntan påatt idrotten ska fostra som torde påverkahur ideella idrottsledare ser på sitt ledaruppdrag(4). Samtidigt talar idrottensföreträdare om hur viktig idrotten är för attbarn och ungdomar ska bli ansvarsfullavuxna.Det finns alltså starka och normativaförväntningar på barn- och ungdomsidrottensfostrande roll som står i stark kontrasttill idrottens tävlande. För att veta huridrottsledare ser på idrottens fostrande rolloch vilka sociala insatser de gör fick ideellaledare som var engagerade i föreningarinom Sörmlandsidrotten möjlighet attsvara på en enkät. 530 personer valde attsvara och deras svar ligger till grund för deresultat som här diskuteras. För attanalysera deras svar användes två analysinstrumentsom hade arbetats fram i entidigare intervjustudie med idrottsledare(5).Socialt ansvar och idrottsliga målDet första analysinstrumentet fångar uppatt socialt ansvar inte är något enhetligt,utan att det tar sig olika uttryck. För attfånga dem delade vi in sociala insatser iolika formar. I en första form är det attvårda de sociala sammanhang som kommermed att vara ledare, som att skapagemenskap och laganda. Nästa form är deallmänmänskliga insatser som uppkommernär man möter andra människor, som atttrösta den som är ledsen. Därefter följer deJohan von EssenTeologie dr.Avdelningen för forskningom det civila samhället.Ersta Sköndal högskola1/2012 svensk idrottsforskning 19


Gemenskap bland unga vattenpolospelare.Att ha roligt och vara medkompisar är det bästa med idrottenom man frågar barnen.moraliska eller politiska frågor som aktualiserasi laget eller föreningen utan att deär idrottsliga frågor. Man kan exempelvista kontakt med sociala myndigheter omnågon håller på att hamna snett. Till sistkan den sociala dimensionen avse denfunktion som föreningen vill att verksamhetenska fylla i samhället. Den förstaformen finns med i själva ledarrollen,medan den sista ibland uppfattas vara enpolitisk fråga som inte har med idrott attgöra.Det andra analysinstrumentet fångarden spänning mellan idrottsledarskapetssociala dimension och den idrottsliga somde ideella ledarna måste hantera. Fråganär då om man menar att det råder harmonieller konflikt mellan idrott ochsocialt ansvarstagande. En annan fråga ärvad man tycker är viktigast, att idrottaeller att ha sociala målsättningar. Betonarman de idrottsliga målsättningarna ochharmoni kan man mena att idrott leder tillgoda sociala värden, som exempelvisgemenskap. Betonar man de socialadimensionerna och harmoni kan mananse att ett gott socialt sammanhang ledertill goda idrottsliga resultat. Betonar manden idrottsliga dimensionen och konfliktmenar man att sociala målsättningar intefår störa idrottsliga målsättningar. Betonarman den sociala dimensionen och konfliktmenar man att det är problematiskt attsträvan efter idrottsliga resultat kan ledatill sociala problem.Ideella ledares sociala insatserBland de idrottsledare som svarade påenkäten finns alla typer, men de flesta ärmedelålders föräldrar som är tämligen välförankrade på arbetsmarknaden och som iliknande utsträckning som befolkningen iövrigt har en eftergymnasialutbildning. Defick frågor om varför de blev ledare, vad degör för sociala insatser och varför de görsådana, hur långt de menar att derasansvar sträcker sig och hur de ser påförhållandet mellan idrott och socialainsatser. Deras svar visade att idrottsledarskapetssociala dimension har olika formersom rör sig från idrottsledarskapets socialasida, som är en aspekt av den sociala20 svensk idrottsforskning 1/2012


interaktion som ledarskap innebär, till detallmänmänskliga ansvarstagande somuppkommer, särskilt när man som vuxeneller äldre tonåring har med barn ochungdomar att göra. Många svarade ocksåatt de tar ställning till och ansvar förfrågor och behov som finns bland de barnoch ungdomar de leder utan att varaallmänmänskliga behov, som att takontakt med sociala myndigheter. Till sistfanns det också ledare som svarade attidrotten bör fylla en samhällelig roll ochsom rörelse ta ett samhällsansvar.Det betyder att den sociala dimensioneninte är något man som ledare helt kanvälja bort, och så gott som ingen gör detheller. Det betyder också att ju merexpansiv den sociala dimensionen är,desto svagare stöd får idén om idrottensom fostrande och socialt ansvarstagande.Det här mönstret förstärks av att mångamenar att det råder harmoni mellanidrottsliga och sociala målsättningar. Ärman tvungen att ta ställning till enkonflikt mellan de två målsättningarnabetonar de flesta de idrottsliga målsättningarna.Man skulle kunna uttrycka detså att ledarna menar att den socialadimensionen varken är överordnad ellerlikställd den idrottsliga målsättningen,utan något viktigt som idrottande ochengagemang i en välfungerande idrottsföreningkan leda till.Dessa uppfattningar tycks vara välspridda bland dem som svarat; ålder, köneller funktion spelar mindre roll än detfaktum att man är ideell ledare inom enidrottsförening. Så gott som alla bejakaratt idrottsledarskapet har en socialdimension, men att den är kopplad till detidrottsliga. Det verkar alltså som om detfinns ett sätt att se på den sociala dimensionensom följer med idrotten själv. Mansocialiseras i så fall in i idrottens uppfattningaroch idrottsledarens uppdrag attföreningsfostra och tävlingsfostra formasdärför av idrottens logik. Idrottsledare hardå inte en neutral uppfattning om idrottsledarskapetssociala dimensioner utan deuttrycks i och formas ofta av idrottensegenart.Idrottsliga och sociala dimensionerLåter man de ideella idrottsledarnakomma till tals bekräftar de alltså attbarn- och ungdomsidrotten fyller enfostrande funktion. Så gott som alla ledaresäger att de tar socialt ansvar när de lederoch tränar barn och ungdomar. Mångatycker vidare att man som ledare bör taansvar och att det är självklart att göradet. Det tyder på att idrottsrörelsen harfog för att hävda att barn- och ungdomsidrottenhar en fostrande roll och att dengör sociala insatser. Men om ledarnaförväntas ta ansvar för frågor som liggerutanför de goda sociala relationer somutvecklas när man idrottar är emellertidinte ledarnas svar lika självklart positivt.När sociala insatser och föreningsfostranuppfattas vara främmande eller i konkurrensmed idrottens målsättningar ochlogik uppstår en spänning mellan idrottoch socialt ansvar. Ledarna bejakar alltsåsociala insatser så länge de idrottsliga ochde sociala målsättningarna inte står ikonflikt med varandra. Men är de tvungnaatt ta ställning till denna konflikt väljer deflesta att betona de idrottsliga målsättningarna.Sociala insatser är något gottsom sker inom idrotten och som ennaturlig följd av idrottandet.Det finns givetvis både moraliska ochpolitiska skäl för att hävda att idrotten börta ett socialt ansvar för de många barn ochungdomar som söker sig dit, elitsatsningbland barn och ungdomar kan ju leda tillnegativa och ibland tragiska följder.Barn- och ungdomsidrotten får storastatliga anslag och det torde vara rimligtatt idrotten då tar ett socialt ansvar. Menen slutsats av denna studie är att urmånga ideella ledares perspektiv är intedet sociala ansvaret något som man på ettenkelt sätt väljer om det går utanför ellerstår i konflikt till idrottens egenart.Nu är inte idrottens egenart en naturlag,det är en social konstruktion ochdärför möjlig att förändra. Men då är detviktigt att se att det goda idrotten för medsig av gemenskap, spänning och samarbeteär kopplat till dess tävlan och att alladeltar på samma villkor. Alltså, just detsom gjort att idrott uppfattas som ettviktigt sammanhang för fostran och socialomtanke är kopplat till, eller kanske tilloch med förutsätter, att det är en egenverklighet med sin egen dynamik, en slagsavgränsad verklighet där barn och ungdomarpå stort allvar får leka tillsammans.Referenser1. Riksidrottsförbundet. Idrotteni siffror. 2011.2. Norberg, J. R. Idrottens vägtill folkhemmet. Studier i statligidrottspolitik 1913-1970. 2004.3. Svedberg, L. Jegermalm, M.& von Essen, J. Svenskarnasengagemang är större än någonsin.Insatser i och utanför föreningslivet.2010.4. Peterson, T. Förenings- ochtävlingsfostran. 2007.5. Börjesson, M. & von Essen, J.Det sociala ledarskapet. 2010.Kontaktjohan.von-essen@esh.se1/2012 svensk idrottsforskning 21


Unga ledare behöver stödLedarbrist är ett problem för föreningar. Stödjande miljöer kan vara enframgångsfaktor för att rekrytera unga ledare. Att skapa miljöer somfår ungdomarna att trivas och utvecklas är en utmaning. Frågan är vaden miljö som är stödjande är och vem den förväntas stödja.Lena LarssonFil. dr.LinnéuniversitetetJane MeckbachFil. dr.Gymnastik- ochidrottshögskolanT r o t s a t t m å n g a engagerar sig somledare är ledarbrist och hur man skakunna engagera och utbilda kunniga ochduktiga ledare en ständigt återkommandefråga som idrottsrörelsen brottas med(1,2,3). För att komma tillrätta med ledarbristenbehöver rekryteringen av nyaledare breddas till att omfatta ävengrupper som vanligtvis inte blir tillfrågadeoch under senare år har ett antal satsningarpå framför allt unga ledare, mångamed bra resultat, gjorts inom idrottsrörelsen(4). Även Idrottslyftet inbegriper ensärskild satsning på unga ledare. Huvudansvarigför denna är SISU idrottsutbildarnaoch målet är att rekrytera flerledare genom att bland annat skapastödjande miljöer.Många vill bli ledareTidigare studier visar att många ungdomarär engagerade i idrottsrörelsen ochatt många också har ledaruppdrag,framför allt gäller det ungdomar somstannar kvar inom idrottsrörelsen (4,5,6).I en utvärdering av ungdomars idrottandekonstateras att drygt hälften av de ungdomarsom fortfarande är aktiva när de är19–20 år har haft ledaruppdrag och attandelen har ökat under senare år (5).Många unga ledare rekryteras alltså frånde egna leden samtidigt som flera studiervisar att majoriteten av ungdomar som avolika anledningar lämnar idrotten gör detför gott. Det betyder inte att de ej kantänka sig att bli ledare, tvärtom är detmånga som om de bara blev tillfrågadegärna skulle vilja vara ledare (4,6,7).För att få ungdomar att åta sig ledaruppdragnämns ofta stödjande miljöersom nyckeln till framgång. Stödjandemiljöer förklaras av idrottens ungdomsrådinte bara som viktiga, utan som enförutsättning för att kunna rekrytera ungaledare. Ungdomsrådet betonar betydelsenav miljöns utformning och menar att föratt en miljö ska vara stödjande krävs bådeändrade arbetsformer och metoder inomidrottsrörelsen. Speciellt viktigt är det attunga ledare får stöd under sin första tidsom ledare. Stödet kan utformas på olikasätt och exempel på stödjande miljöersom visat sig fungera är kontinuerligaträffar mellan nyrekryterade ledare ochmer vana, att börja som hjälpledare till enmer rutinerade ledare, att arbeta i teamoch få möjligheten till att rådfråga äldreledare (8).I fokus står stödjande miljöerDet är satsningen unga ledare med måletatt både rekrytera nya och att behållaunga ledare inom idrottsrörelsen som är ifokus i denna artikel. Artikeln baseras påen studie där syftet var att undersökavilka stödjande miljöer som har skapatsoch för vem de har skapats. Underlag föranalysen är dels skriftligt material i formav RF:s och SISU:s årsrapporter frånIdrottslyftet, SISU-distriktensutvecklings planer, projektbeskrivningar,utvärderingar och ansökningar omprojektmedel från enskilda föreningar,dels fokusgruppintervjuer med deltagare iledarutbildningar inom ramen för densärskilda satsningen unga ledare. Totaltgenomfördes tio gruppintervjuer med 37deltagare (20 kvinnor och 17 män). Vidurvalet av intervjupersoner eftersträvadesgeografisk spridning, variation av idrotter,22 svensk idrottsforskning 1/2012


manliga och kvinnliga deltagare samtbåde så kallade aktivitets- och organisationsledare.Med hjälp av kvalitativtextanalys har olika frågor ställts tilltexterna och utsagorna i relation tillstudiens syfte och därefter tolkats utifrånden teoretiska referensramen.Ett kultursociologiskt perspektivIdrottsrörelsen kan förstås som enkulturell och social praktik där vissavärderingar, normer och handlingarframstår som mer givna än andra. För attförstå handlingar och föreställningar omvad som är möjligt och rätt i det socialasammanhang de unga ledarna befinner sigi har vi tagit stöd av Pierre Bourdieusteorier och begrepp. Bourdieu beskriverbland annat hur vissa sociala sammanhangsom till exempel idrottsrörelsen harsina specifika regler, normer och värderingar,det vill säga en egen logik och enfrihet att bestämma spelreglerna. Dessaspelregler eller strukturer uppfattas somnaturgivna av alla som ingår i sammanhanget(9). Bourdieu använder blandannat begreppet habitus för att förklaraatt trots att vi i praktiken kan välja frittoch upplever att vi gör det, ändå i så höggrad väljer i linje med det sociala sammanhangvi är uppväxta i och de erfarenhetervi har med oss. En individs habitusformas genom vardagssituationer medbörjan i barndomen, familjen, skolan ochvidare i livet. Habitus bestämmer hurmänniskor handlar, tänker, uppfattar ochvärderar i olika sociala sammanhang (10).Användandet av Bourdieus teorier gördet möjligt att ’komma bakom’ och belysavärdestrukturer och handlingsmönster irelation till unga ledares habitus i ensocial praktik som idrottsrörelsen (11). Enutgångspunkt är att Idrottslyftet och denspecifika satsningen på unga ledare kanförstås utifrån att idrottsrörelsen är ettsocialt sammanhang där deltagarnasinförlivade erfarenheter sammantagetmed de objektiva strukturerna styr vilkasatsningar som blir möjliga och där vissasatsningar framstår som mer givna änandra. Marknaden avgör vad som ärgångbart (12) och sett till idrottsledare ochledarsatsningar skulle utformningen av destödjande miljöer som har iscensattskunna vara en indikator för vad somtillerkänns värde. Att undersöka stöd-jande miljöer och för vem de har skapatskan bidra med en förståelse för vilkahandlingsmönster, praktiker och värderingarsom tilltros kunna vara verkningsfullaför att rekrytera nya ledare.Mentorer en form av stödAv utvecklingsplanerna framgår att SISUoch idrottsrörelsen har haft svårt attkonkretisera vad en stödjande miljö äreller kan tänkas vara. Vanligast är attmentorer har likställts med stödjandemiljö. Många av projekten har handlatom att utbilda mentorer eller mentoreroch unga ledare tillsammans.”Målgrupp för denna satsning är både ungdomaroch föreningsstyrelse. Syftet med satsningenär att: skapa goda förutsättningar förungas ledaruppdrag.” (Inbjudan utbildning,SISU Östergötland)I jämförelse med utbildningar förunga ledare framstår det som svårare attMed små medel kan en föreningiscensätta en stödjande miljö. Att fåuppmuntran och bli sedd är viktigt,enligt de unga ledarna själva.Dessutom efterlyser de en förståelseför att de inte kan allt.1/2012 svensk idrottsforskning 23


få deltagare till mentorsutbildningar,men också att erfarenheterna från desatsningar på mentorsutbildningar somhar gjorts är positiva. Utbildningarna harinneburit att föreningarna har fåttmöjlighet att utbilda mentor, en vuxenföreningserfaren person som den nya”Det skulle kunna sessom en paradox attföreningar inte prioriterararbetet med stödjandemiljöer om bristenpå ledare kanåtgärdas genom detta.”ledaren kan vända sig till och få hjälpeller stöd av. Av de unga ledarnas utsagorframgår att mentorskap är en del av denstöttning som de värdesätter, men att detinte är vem som helst som är lämplig sommentor. Vissa egenskaper, vissa kunskaperframstår som mer önskvärda änandra. Ungdomarna vill ha mentorersom är engagerade, lätta att träffa, somhar kunskap om vad unga vill och sominte har en överlägsen attityd.Handlingsplaner och strukturEn del projekt har handlat om att föreningarhar fått hjälp av SISU med attutarbeta handlingsplaner och att skapastruktur för att kunna slussa in och påolika sätt stötta den nya ledaren. Detta ären form av stöd som de unga ledarnagärna vill ha. De betonar betydelsen avatt det inom föreningen finns en struktur,tydlig arbetsbeskrivning och organisationför att rekrytera och behålla unga ledare.”Det finns liksom ingen sån där uttaladutbildningsansvarig som tar hand om utbildningoch rekrytering. Så nu när jag håller i utbildningarsom samordnare i distriktet så försökerjag få föreningarna att ha en uttalad … att hasom en kontakt i varje förening. Men det funkarfortfarande så där så oftast är det jag som får gådirekt på deras medlemmar och försöka få domatt gå kurs.” (Ung ledare, intervju 5)Det ska inte vara en enstaka lösning avett problem när något akut inträffar, utandet ska finnas en långsiktig plan där dennya ledaren successivt får mer ansvar.Att bli seddDet som de unga ledarna själva lyfterfram handlar mycket om att de vill bliuppmärksammade. Unga ledare har haftsvårt att få sitt engagemang förankrat iden egna föreningen och informationentill föreningen har inte alltid fungerat. Deuttrycker att det verkar som att få kännertill att de finns. Ungdomarna påpekar attdet inte var någon från styrelsen ellerresten av föreningen som brydde sig efteratt de gått en kurs eller efterhör hur detgår med ledaruppdraget. De ger ocksåuttryck för att det finns ett för givettagande hos föreningsstyrelser att har enperson väl tagit på sig ett uppdrag såsköter också vederbörande träningen ochallt arbete runt detta uppdrag. Ungdomarnamenar att alla i föreningen skakänna till att det finns nya unga ledare.”… jag har mest stöd från barnen som kommertillbaka år efter år och föräldrar som kommerfram efter träningen och ger kommentarer ochså… och säger att vi är så duktiga och dom vetatt vi har mycket annat också runt omkring.”(Ung ledare, intervju 3)Som ny ung ledare känner man sigosäker och behöver bli bekräftad inteenbart av deltagarna och deras föräldrar,utan också bli sedd av mer erfarna ledareoch andra i föreningen.”… och det som är viktigt är att man måste hastöd … det är mer att det visas intresse, att manfår uppskattning, att man visar stöd för deledare man har och att styrelsen liksom visarintresse så att dom frågar hur det går, ifall manvill ha hjälp. Och att styrelsen söker för vidareutbildningar så att man hela tiden kan utvecklassjälv att man känner att man kan utvecklassamtidigt som man hjälper andra. Det är såliksom på det sättet tror jag att man kan behållamånga fler ledare.”(Ung ledare, intervju 4)Att bli uppmärksammad kan ocksåvara att den unga ledaren får någon formav lön, till exempel att delta i utbildningeller i andra ledares träningar. Viktigt ärockså att det finns förståelse inomföreningen för att skolarbetet kan göraatt hon/han får förhinder eller i förstahand vill prova på att vara ledare underen kortare tid.24 svensk idrottsforskning 1/2012


Att känna trygghetAtt vara ung och ny ledare är ett stort stegför många. Det är också en ovan situationdär de ofta känner sig utlämnade ochensamma. Att då ha någon vuxen i närhetennär det uppstår situationer som upplevssom svårhanterliga är något som deunga ledarna betonar vikten av. Två av demberättar att det kan vara föräldrar ”somstår och skäller ut oss fast dom vågar intesäga det till styrelsen”, något barn som”blir jätteledsen och jättebesviken, sitteroch gråter och så, det har jag jättesvårt atttackla” och andra liknande situationer.En annan form av stöd, som en del av deunga ledarna har positiva erfarenheter av,är delat ledarskap. De beskriver delatledarskap som ett bra sätt för att stötta ochintroducera dem.”... vi är tre ledare som hjälper varandra, den enaär välutbildad hon har 6 års erfarenhet och hon ärhuvudledare kan man säga och jag är ju hjälpledare,sen specialiserar man sig på det, vad ska mansäga, positioner kan man säga.”(Ung ledare, intervju 1)Att känna trygghet handlar också om attha tillgång till kunskap, antingen egen ellerandras. En del utbildningar har också somen del av innehållet visat på hur man kanutveckla lämpliga forum för att samlakunskap som kan vara ’bra att ha’ som tillexempelvis hur man möter föräldrar ellertips på träningsuppläggning. Trygghethandlar också om att känna tillhörighet tillföreningen ”… jag är kvar i min föreningsom ledare nu… för där är en sån klubbkänsla”,berättar en ledare. Vidare kan dethandla om allt från att få föreningsoveralltill att få följa med på arrangemang ochföreningsträffar eller att bli tillfrågad omatt till exempel vara med på möten.Traditionen måste brytasResultaten visar att det finns en föreställninginom idrottsrörelsen att det inte är förvem som helst som stödjande miljöerbehöver utformas. De ungdomar somförväntas behöva stöd kommer frånidrottsrörelsen och har smak för idrott.”Ett lag med framgång på fotbollsplanen och ettlag med ambitioner… viktigt är att behålla dessa iföreningen både som spelare och ledare. Dettaprojekt är till för att kunna ge killarna insikterbåde som framtida organisations- och aktivitetsledare.”(Projektansökan SISU-distrikt Väst)Det är ungdomarna som känner sigbekväma inom idrottsrörelsen, som visarframfötterna och är ett ledarämne. De hareller förväntas kunna utveckla ett gottsjälvförtroende, vilket kan tolkas som attföreningarna inte behöver lägga ner förmycket arbete på att skapa stödjandemiljöer.Resultatet visar också att det är en långväg kvar för att andra grupper än de somvanligtvis inte blir tillfrågade ska kommaifråga. Vidare krävs förändringar ochomförhandling om de värden och det sättatt arbeta som traditionellt varit förhärskandeom det ska finnas några ungaledare som ska stöttas.Hela föreningens angelägenhetMed hjälp av det teoretiska ramverket äravsikten i denna avslutande del attdiskutera utfallet av analysen av stödjandemiljöer i relation till de unga ledare somska stödjas. Trots att stödjande miljöerbeskrivs som en framgångsfaktor både föratt rekrytera och behålla ledare (4,8,14)visar resultatet att det har varit svårt attengagera föreningarna i detta arbete. Detskulle kunna ses som en paradox attföreningar inte prioriterar arbetet medstödjande miljöer om bristen på ledarekan åtgärdas genom detta. Samtidigt kanjust denna paradox vara en förklaring.Inom ramen för en verksamhet somgenomförs genom ideellt arbete påfritiden kan ledarbristen innebära att deresurser föreningen har framför allt går åttill att hålla igång verksamheten. Tid ochork för att utarbeta strategier för attbehålla de unga ledare som har rekryteratsblir då svårare att prioritera, vilkettvingar många föreningar att arbetareaktivt istället för proaktivt.För att bli utvald som ung ledare krävsatt man som ung ledare har en habitussom matchar det sociala sammanhangman kliver in i och att ha en bakgrundsom aktiv idrottare framstår som en givenförutsättning. De presumtiva ledarnaförväntas ha smak för idrott och att dekan eller redan har införlivat det somTrondman benämner idrottens kärnlogik(13). De unga ledarnas idrottserfarenheter1/2012 svensk idrottsforskning 25


1 | 2012 | ÅRGÅNG 214 | 2011 | ÅRGÅNG 203 | 2011 | ÅRGÅNG 20Referenser1. Lindroth, J. Ledarna ochledarfrågan. Ett idrottssekel:Riksidrottsförbundet 1903-2003,red. Lindroth, J. & Norberg, J.R.2002.2. Eriksson, S. Idrottsrörelsensideella kraft. RF:s och SISU:sskriftserie, Idrottens ideellaledare. 2006.3. Larsson, L. & Meckbach,J. Swedish Journal of SportResearch. 2010. s. 81-106.4. Redelius, K. m.fl. Ung ledaresökes: En studie av Riksidrottsförbundetssatsning på ungaledare. 2004.5. Riksidrottsförbundet. Ungdomarstävlings- och motionsvanor.En statistisk undersökning våren2005. RF FoU-rapport 2005:6.6. Trondman, M. Unga och föreningsidrotten:en studie om föreningsidrottensplats, betydelseroch konsekvenser i ungas liv.2005.7. Redelius, K. Idrottsledarskap– ett lyft för ungdomar. RF:soch SISU:s skriftserie Idrottensideella ledare. 2007.8. Gerrevall, P. m.fl. Lärande ocherfarenheters värde: en studie avledare inom barn- och ungdomsidrott.2006. RF FoU rapport2006:1.9. Bourdieu, P. Konstens regler.Det litterära fältets uppkomst ochstruktur. 2000.10. Bourdieu, P. Praktiskt förnuft.Bidrag till en handlingsteori.1995.11. Bourdieu, P. Hvordan er demuligt at være interesseret isport?. Men hvem skabte skaberne?red. P. Bourdieu. 1997. s.178-198.12. Bourdieu, P. & Wacquant, L.An invitation to reflexive sociology.1992.13. Trondman, M. Ett idrottspolitisktdilemma: unga, föreningsidrottenoch delaktigheten. 2011.tycks fungera som en form av förkroppsligatkapital som gör att de både blirutvalda, upplever sig beredda att ta på sigett ledaruppdrag och passar utformningenav de stödjande miljöer som skapas.Utformningen av projekt som handlar omstödjande miljöer i relation till de ungaledare som ska stödjas visar att detförutom ett för givet tagande om vilkaungdomar som ska stödjas tas för givet attdet är stöd av en vuxen som ungdomarbehöver. I majoriteten av projekten somhar genomförts är stödjande miljöer iprincip synonymt med mentorsutbildningar.Det är en miljö där unga ledareoch mentorer ingår i en sociokulturellgemenskap där en förståelse för föreningsandanskapas. I ett sådant system kanäldre och föreningserfarna mentorerintroducera den unga ledaren i de värderingaroch normer som är förhärskande iföreningen. Föreningens strukturer kanpå så sätt fungera som genererandeprinciper så att det rätta sättet att handlaframstår som självklart och att den policyoch de riktlinjer som är gällande i föreningenockså anammas av de nya ungaledarna.Även om många av projekten harhandlat om utbildningar för mentorerpekar analysen av ungdomarnas utsagorpå att det också finns andra sätt och attföreningarna även med små medel kaniscensätta en stödjande miljö. För ungdomarnahandlar det om att få uppmuntran,bli sedda och att det finns en förståelse iföreningen för att de inte kan allt. Dethandlar om att en stödjande miljö är helaföreningens angelägenhet, att det finns enstruktur, tydlig arbetsbeskrivning ochorganisation där alla kan vara ett bollplank.Om man till exempel inom utbildningarnatalar om värderingar ochattityder och ungdomarna sedan möter enverklighet där krav och inställning frånbarn och föräldrar motsäger vad de harlärt sig behövs forum där ungdomarnakan diskutera och ta hjälp av antingenäldre erfarna eller av varandra.Presumtiva ledare stängs uteAnalysen visar att det finns både erfarenheterav och goda exempel på hur stödjandemiljöer kan skapas, men ger ocksåuttryck för en avsaknad av samlad kunskapom vad en stödjande miljö är och hurden kan skapas. Det resultatet pekar på äratt om idrottsrörelsen ska kunna engagerafler unga ledare måste föreningar ha välutvecklade strategier för att få fler ungdomaratt vilja engagera sig som ledare ochstrategier för att stödja dem. Såvälarbetssätt i föreningar och för givettaganden om vilka ungdomar som väljstill ledaruppdrag fungerar som barriärersom stänger ute presumtiva ledare.Svårigheterna att engagera föreningarnaoch att identifiera framgångsfaktorer förstödjande miljöer visar att ett mer systematisktarbete för att samla kunskap omvad en stödjande miljö är och hur den kanskapas skulle vara ett viktigt bidrag för attkunna behålla de unga ledare som rekryteras.Det behövs både goda och flerexempel på och mer kunskap om hurstödjande miljöer kan skapas och bevaras.Kontaktlena.larsson@lnu.sejane.meckbach@gih.seFörnya din prenumeration för 2012 !2 | 2011 | ÅRGÅNG 20T e m a :IDROTTSLYFTETTidernas satsninggranskadTEMA:Tema: BARNVad är barnets bästa?Talanglös selekteringGuide till barns skadorForskning vidLinnéuniversitetetJakten på talangenIshockeyns tidigahistoriaPromenaden somersätter medicinenMotion smakar bäst i storstäderHärföraren mot doping 80 år– porträtt av Arne LjungqvistMultisportarna spränger fysiologiska gränser26 svensk idrottsforskning 1/2012En helårsprenumeration med fyra nummer kostar 200 kr. Beställ på www.centrumforidrottsforskning.se


Idrottstävlingarskapar könIdrottstävlingar lär barn och unga vad det innebär att vara flicka ellerpojke. Flickors och pojkars prestationer ska till exempel inte mätasmed varandra och flickor görs ofta mindre eller annorlunda jämförtmed pojkar, som i sin tur utgör norm.I d e n h ä r a r t i k e l n presenteras enstudie av idrotternas sätt att organiseratävlingsklasser med avseende på kön. Detfinns många skäl till varför man delar uppkönen, men det är inte de bakomliggandemotiven som står i fokus här, utan depedagogiska konsekvenserna. Sannoliktbidrar uppdelningen till att flickor ochpojkar lär sig att det inte är rimligt attmäta sig fysiskt med någon av det vibrukar kalla för det motsatta könet,åtminstone inte när det är på allvar (isamband med tävling). Uppdelningen itvå tävlingsklasser är bara en aspekt avåtskillnaden mellan könen. Ibland följeräven en differentiering, eller en ”anpassning”,av reglerna för de två tävlingsklasserna.Ordet anpassning är satt inomcitattecken för att markera att en sådanalltid måste göras utifrån ett generelltantagande om vad kön är: en norm – vilketsamtidigt utgör ett skapande avnormativa föreställningar om detta kön.Inom projektet Genus och heteronormativiteti barn- och ungdomsidrott har vianalyserat hur regler från Riksidrottsförbundetsspecialidrottsförbund konstruerarkön (1).Kropparnas relation vid tävlingI samtal om vad barn lär sig av att idrotta,talas ofta om idrotten som något enhetligt.Egentligen är denna formuleringotymplig eftersom idrottskulturen är såmångfacetterad. Inte sällan delar forskarein idrotten i mindre beståndsdelar för attkunna beskriva den bättre. Det kanhandla om individuell idrott kontralagidrott, tävlingsidrott kontra motionsidrotteller elitidrott kontra breddidrott.Men även dessa indelningar är grova. Detfinns forskare som har försökt sig på attindela idrotten på andra sätt, men de harsällan tagit själva idrottspraktiken – hurtävlingen går till i olika idrotter – somutgångspunkt. Vår analys utgår från enidé hos den franske sociologen PierreBourdieu om hur man kan studeranormer i olika idrotter genom ett särskiltfokus på hur idrotterna praktiseras, tillexempel om en idrott ”förutsätter direktkontakt,hand-mot-hand, som till exempeli brottning eller i rugby, eller om dentvärtom exkluderar all kontakt, som i golf,eller tillåter det endast indirekt genombruket av en boll, som i tennis, eller medredskap som mellanhänder, som i fäktning”(2). Kategoriseringen av idrotterbygger alltså på hur idrottarnas kropparförhåller sig till varandra när de mäts ochbedöms (det vill säga i tävlingssituationen).I en del idrotter sker inte någon åtskillnadav könen, nämligen inom ridsport,motorsport och flygsport. Det är idrotterdär idrottaren styr, medan hästen ellerfordonet gör arbetet.I en del idrotter genomför en person itaget sitt försök. Så ser det till exempel uti artistisk gymnastik (AG), friidrottensfältgrenar (till exempel längdhopp ochspjutkastning), samt i vissa bollspel (tillexempel badminton och tennis). Vi harvalt att kalla denna kategori för kroppefter-kropp.I en del idrotter gör idrottarna sinHåkan LarssonProfessor i pedagogikGymnastik- och idrottshögskolanSusanne JohanssonDoktorandGymnastik- och idrottshögskolan1/2012 svensk idrottsforskning 27


flera idrottare samverkar, mot respektivemed varandra, mot specifika mål. Denkallar vi kropp-bland-kroppar. Vi hardelat upp kategorin i två varianter, en därtvå lag åt gången uppträder, vilka harrollen av motparter, och en där de olikatrupperna har rollen av solitära enheter. Iden första varianten, kropp-bland/mot-kroppar, återfinns till exempelishockey, rugby och amerikansk fotboll; iden andra, kropp-bland/med-kroppar,återfinns till exempel konstsim (team),konståkning (team) och truppgymnastik.Organisera fram könVad säger då analysen av tävlingsreglernaom man ställer dem mot ovanståendeindelning av idrotter? I de fall då reglernaär anpassade efter kön sker differentieringenoftast i samband med puberteten.Det beror sannolikt på att man brukartillskriva barn få fysiska könsskillnader.Det är först vid puberteten som de fysiskakönsskillnaderna antas få en avgörandebetydelse. I den utsträckning flickor ochpojkar ändå tävlar mot varandra handlardet oftast om att flickor tävlar i pojkklass.”Det förekommeringa idrotter därflickor eller kvinnorinte deltar”En flicka som bryter motkonventionerna.prestation vid sidan om varandra, menändå i relativ avskildhet från varandra.Prestationen påverkas endast indirekt avvad motståndaren håller på med. Exempelpå detta sätt att tävla finns i simning,löpning, skidåkning (masstart) ochskridsko. Den kategorin kallar vi förkropp-bredvid-kropp.I en del idrotter interagerar två idrottare,ibland med varandra – som ett par,ibland mot varandra. I dans agerar ett parbland andra par, i konståkning (paråkningoch isdans) agerar paren enskilt. Denkategorin kallar vi kropp-med-kropp. Iboxning, brottning och andra kampsporterär poängen att nedlägga motståndaren.Den kategorin kallar vi kropp-motkropp.I kategorierna ovan präglas tävlingssituationenav enskilda idrottare eller par. Inästa kategori präglas situationen av attDet har, enligt förbundsrepresentantersom vi intervjuat i samband med projektet,framför allt att göra med att det oftaresaknas flickor för att genomföra tävlingeni en särskild klass. Att låta flickor tävla ipojkklass ter sig dessutom mindre utmanandeän att låta pojkar tävla i flickklass,även om det rör sig om barn.I många idrotter skiljer reglerna, utöverde två tävlingsklasserna, inte på flickoroch pojkar (3). Dessa idrotter återfinns ihuvudsak i kategorin kropp-efter-kropp,men även kategorierna kropp-bredvidkroppoch kropp-bland-kroppar finnsrepresenterade. I några av dessa idrotterförekommer mixedklass, framför alltinom kategorin kropp-efter-kropp.Den vanligaste formen av anpassninginnebär att flickklassen görs till en mindrekrävande variant av originalet, det villsäga pojkklassen (könen kan beskrivas28 svensk idrottsforskning 1/2012


som A[man] – a[kvinna]). Det handlar omen anpassning av till exempel redskapetsstorlek, tävlingsdistansen, distansen tillmål, planstorleken, näthöjden, antaletspelenheter (antal försök, rundor etcetera)samt bruket av skydd (inklusiverestriktioner när det gäller fysisk kontakt).Den typen av anpassning förekommer iidrotter inom flera kategorier (kroppbredvid-kropp,kropp-mot-kropp,kropp-bland-kroppar, kropp-bland/mot-kroppar). Men idrotter inom kategoriernakropp-med-kropp och kroppbland/med-kropparfinns inte representerade.En annan vanlig form av anpassningmedför två kvalitativt skilda sätt att utövaen idrott på (könen kan beskrivas somA[man] – B[kvinna]). Sådan anpassningförekommer framför allt i estetiskaidrotter, där bedömning av prestationer,inte mätning, står i centrum. De äridrotter som uttrycker kategorin kroppmed-kropp(dans och konståkning).Formeln A–B dyker upp också då tävlingsreglernaberör utövarnas klädsel ochsmink. I idrotter som utövas kropp-medkroppförutsätts det att paret består av enkvinnlig och en manlig utövare med entydlig rollfördelning. I detta sammanhangmärks idrottens heteronormativitetsärskilt.Det förekommer inga idrotter därflickor eller kvinnor inte deltar (även omandelen kvinnor är låg). Däremot finnsdet idrotter där inga pojkar eller mändeltar. Det gäller i idrotter som rytmiskgymnastik (RG), konstsim (par och team)och konståkning (team). Det är idrottersom uttrycker kategorierna kropp-medkropp,särskilt kropp-med/bland-kroppar(4).Vad lär sig barnen?Analysen påvisar att flickor och pojkar, itillämpningen av tävlingsreglerna, får lärasig att det inte är rimligt att man mäter sigmed det motsatta könet i tävlingssituationer;att flickor i en del idrotter är mindrevarianter av pojkar (A–a); att flickor ochpojkar i en del idrotter inte ska utövaidrotten på samma sätt (A–B); och attestetiska idrotter, där utövarna uttryckersig med redskap eller i grupp, inte ärnågot för pojkar (B–icke-A) (5).En grundläggande utgångspunkt iprojektet har varit att åtskillnad – ochdifferentiering, eller anpassning, av denena tävlingsklassen – uttrycker socialanormer kring kön och sexualitet. Analysenav tävlingsreglerna antyder att könsnormeribland utmanas, till exempel i det attflickor och pojkar tävlar mot varandra,eller åtminstone tävlar på samma sätt.Men analysen påvisar också att könsnormernainte utmanas hur som helst. Ävendå flickor och pojkar inte tävlar motvarandra, förutsätts en flicka eller kvinnavara något annat och ofta mindre än enpojke eller man. Det här förhållandetavspeglar en heteronorm, där kvinnligt ärmotsatsen till eller mindre än manligt.Studien antyder alltså också på vilka sättdet är möjligt att utmana normer kringkön och sexualitet i idrottsliga sammanhang.Vilken betydelse har då en studie av dethär slaget för utformningen av idrotten?Den fråga som bör vägleda en utvecklingav regelverken ur ett jämställdhetsperspektivär: Bidrar den här regeln till attutmana eller förstärka traditionella (ochstereotypa) synsätt på flickor och kvinnor;pojkar och män?Referenser1. Reglementen från förbund somorganiserar ”intressegrupper”,som akademisk idrott, skolidrott,Korpen, handikappförbundetoch dövidrottsförbundet, har inteinkluderats i analysen.2. Bourdieu, P. Program för enidrottssociologi. I H. Larsson &K. Redelius (red) Leve idrottspedagogiken!.2005, s. 92f.3. Detta gäller i badminton,bandy, bangolf, biljard, bortennis,boule, bowling, curling, dart,draghund, dragkamp, frisbee,fäktning, innebandy, isjakt, judo,landhockey, motorcykel, racerbåt,segling, squash, styrkelyft,tennis och tyngdlyftning.4. RG karakteriseras av att redskapeninte används för att träffaeller transporteras till ett särskiltmål. Istället används redskapetför att skapa uttryck.5. Hirdman, Y. Genus – om detstabilas föränderliga former.2001.Kontakthakan.larsson@gih.se1/2012 svensk idrottsforskning 29


Rörelser i stadenAktivitet på olika villkor i MalmöEtt bostadsområdes karaktär och socioekonomiska status har betydelseför hur unga rör sig i staden och använder olika platser för idrott. Attöppna upp staden för fler kräver nya planerings- och samarbetsformer.Karin BookLektorInstitutionen för idrottsvetenskap,Malmö högskolaE n vi k t i g a s p e k t på utövandet av idrottoch fysisk aktivitet är var den äger rum,det vill säga det rumsliga perspektivet.Människor har olika rumsliga aktivitetsochrörelsemönster beroende på vilketutbud det finns av olika idrottsaktiviteteroch platser för att utöva idrott. Olikaindividers önskemål och, inte minst,möjligheter påverkar också mönstren.Utbud såväl som möjligheter varierar frånområde till område i staden.Syftet med den studie som ligger tillgrund för den här artikeln var att medfokus på tre områden i Malmö skapa ökadförståelse för ungdomars geografiskarörlighet kopplad till fysisk aktivitet medutgångspunkt i områdenas olika karaktär.Syftet var också att få insyn i vilka platserungdomarna använder. Därefter var måletatt kunna lyfta blicken och diskutera hurman kan planera rum för fysisk aktivitetså att de uppfyller ungdomars behov ochönskemål.Studien fokuserar på ungdomar iåldern 11-14 år i tre områden i Malmö:Möllevången, Hermodsdal och Bunkeflostrand.Totalt har 358 enkäter genomförtsi årskurs 5-8 på tre skolor (Möllevångsskolan,Hermodsdalsskolan och Sundsbroskolan).Dessutom har jag intervjuatelever (individuellt och i grupp), gjortfältstudier, dokumentstudier och intervjuermed planerare på Malmö stad medflera.Tre områdeskaraktärerJag var i min studie intresserad av såvälbebyggelsekaraktär och utbud somområdets socioekonomiska status.Bunkeflostrand representerar ett områdemed en hög socioekonomisk status.Inkomsten per hushåll är hög liksomandelen som förvärvsarbetar. Möllevångenrepresenterar ett område med ensocioekonomisk status lite under genomsnittetför Malmö stad. Hermodsdal får isammanhanget klassas som ett socioekonomisktlågstatusområde. Den socioekonomiskastatusen verkar i dessa fall ha ettsamband med andelen invånare medutländsk bakgrund samt bostadsbeståndetskaraktär. I såväl Hermodsdal somMöllevången är andelen invånare som ärfödda i utlandet större än genomsnittet iMalmö (som i sin tur har en större andelän riksgenomsnittet).Möllevången är en del av Malmösinnerstad (cirka en kilometer från centrumoch Stortorget) med en hel del äldrebebyggelse från sent 1800- och tidigt1900-tal, men även senare tillkommenbebyggelse av kompakt karaktär. Utbudetav miljöer för fysisk aktivitet är få inärområdet, men runt omkring finns enstörre park (Pildammsparken) och en bitdärifrån ligger stadionområdet med flertaletanläggningar för olika idrotter (dock ejför spontant bruk). På Möllevångenanlades år 2011 en konstgräsplan avmodell näridrottsplats med bidrag frånIdrottslyftet.Hermodsdal byggdes som en del avmiljonprogrammet på 1960- och 1970-talet. Samtliga bostadshus är flerfamiljshusmed hyresrätter. Avståndet in tillcentrum är drygt fyra km. År 2006genomgick det lokala grönområdetHermodsdalsparken en omdaning medbidrag från Handslaget. Där finns ennäridrottsplats som anlades som en del avparkutvecklingen. Inom 5-10 minutersgångväg ligger Gullviksborgs idrottsplats(med en gräsplan och en grusplan för11-mannafotboll, två grusplaner för30 svensk idrottsforskning 1/2012


7-mannafotboll, bollfält och skolfriidrottsytor).Bunkeflostrand är en del av Malmösklart mest välbärgade stadsdel. Bunkeflostrand,som ligger i Malmös ytterkant,började bebyggas med villor på 1960- och1970-talet. Under 2000-talet har utbyggnadenfortsatt i form av en blandning avsmåhus och lägenheter. Det finns ett riktutbud av platser för fysisk aktivitet i formav Stadium Arena (fotbollshall), Sundsbrohallen(med spelplaner för handboll,volleyboll, basket, badmintontennis ochinnebandy etcetera), idrottsplats (med tvågräsplaner för 11-mannafotboll, engrusplan för 11-mannafotboll och ettgräsbollfält), två temalekplatser, sammanhängandegrönytor och promenadstråklängs havet med mera.Aktivitets- och rörelsemönsterStudien av de tre områdena visar på bådelikheter och skillnader i ungdomarnasaktivitetsmönster och geografiska rörlighet.En stor andel (mer än 84 procent) aveleverna i samtliga områden utövadenågon typ av spontan/egenorganiseradfysisk aktivitet – inte minst fotboll.Närområdet är viktigt oavsett var ungdomarnabor, särskilt när det gäller justegenorganiserad aktivitet. Det här talarför att det finns ett behov av närbelägnaytor och anläggningar för fysisk aktivitet(med betoning på spontanaktivitet). Närdet gäller användningen av platser utanfördet egna området var variationerna större.Undersökningen av de tre områdenavisar att den geografiska rörligheten, ellerräckvidden, kopplad till idrott och fysiskaktivitet på fritiden är störst i Bunkeflostrandoch minst i Hermodsdal. Bunkefloungdomarnaanvänder många platser ihela stadsområdet för sina aktiviteter,medan Hermodsdalsungdomarna endastpekar ut några få platser utanför sitt egetområde. Ungdomarna på Möllevångenanger en hel del platser utanför sitt egetområde, dock är de flesta belägna iinnerstaden, det vill säga relativt nära detegna området.Vad som är värt att notera är att iHermodsdal, där eleverna är mest geografisktbundna till sitt område och ett fåtalplatser i detta, uppger flest ungdomar attde är nöjda med hur området är planeratutifrån ett fysiskt aktivitetsperspektiv.Ungdomarna där rör sig vant och fritt inomsitt område även om den geografiskarörligheten utanför området är begränsad.Minst nöjda med områdets planering ärungdomarna i innerstadsmiljön, det villsäga Möllevångsungdomarna. Den miljö debefinner sig i är utformad på ett sätt somskapar restriktioner för mer fri aktivitet.Området med högst socioekonomisk statushar ett större utbud av aktivitetsplatser förbåde organiserad och spontan eller egenorganiseradaktivitet, samt fler rekreationsytor.Det har som följd att fler platserPlatser för idrott är ofta fysisktavgränsade från stadens övriga rum.Det kan vara ett hinder för attanvända dem. En ökad öppenhetmellan de olika rummen skullekunna öppna dem för fler människor.1/2012 svensk idrottsforskning 31


Referenser1. Malmö stad. Ungas Fritid –Förening Förvaltning Malmöbor.2011.Malmö stad. Fritidsstilsundersökningbland 13-25-åringar iMalmö under år 2010. 2010.2. Anderson, Camilla: Gatukontoret,Malmö stad. Intervju den10 november 2011.Göransson, Sten: Gatukontoret,Malmö stad. Intervju den 21september 2011.Kontaktkarin.book@mah.seanvänds i området. Många platser föraktivitet leder emellertid inte automatiskttill att de unga blir mer nöjda. Den fysiskaoch sociala tillgängligheten till platserna ärväl så viktig.Geografisk rörlighet är beroende på enrad olika faktorer som kan kopplas tillrumsliga, ekonomiska och sociala förutsättningar.De rumsliga förutsättningarnahar att göra med områdets utformning ochutbud samt transportmöjligheterna inom,till och från området. De ekonomiskaförutsättningarna kan kopplas till bilinnehavoch möjligheter att delta i aktiviteter.De begränsningar i geografisk rörlighetsom till exempel kan ses hos Hermodsdalsungdomarnakan sannolikt kopplas tillbegränsade ekonomiska möjligheter ochatt få har tillgång till bil, men även mervaga aspekter som har med sociala, ellersocioekonomiska, förutsättningar att göra.Platserna i närområdet är välkända ochtillgängliga (för dem som bor där) menövriga staden är inte det. En hög socioekonomiskställning, vilket en stor andel i tillexempel Bunkeflostrand har, innebär oftamer makt, större tillgång till informationoch nätverk samt en högre grad av tillgänglighettill stadens utbud.Planering för fysisk aktivitetEn utgångspunkt i planeringen måste varaatt en hel del ungdomar i dag inte är attbeteckna som geografiskt (hög)rörliga. Detär viktigt att värdesätta de vardagliga ochenkla miljöerna. De fyller en funktion,vilket min undersökning i de tre Malmöområdenavittnar om. Utifrån detta enkla,vardagliga perspektiv med betoning påspontanitet och flexibilitet finns det fog förenkla konstgräsplaner och näridrottsplatser(vilka ibland sammanfaller) ochliknande. Det är just näridrottsplatser medkonstgräs som medel från Idrottslyftet haranvänts till i Malmö. När invånare (i dettafall i Malmö) i olika undersökningar ochplaneringsprocesser som Malmö stadarbetat med tillfrågats om vad de önskarsig i form av förbättringsåtgärder i sittområde kommer alltid konstgräsplanerhögt på önskelistan (1). Såväl Sten Göranssonsom Camilla Anderson på gatukontoretanger att konstgräsplanen blivit en slagssymbol för att området räknas och attkommunen satsar på det (2).Konstgräsplanerna och näridrottsplatsernaanvänds och är uppskattade. Flerastudier visar emellertid att det främst(ibland bara) är killar som använder dem.Därtill används de nästan uteslutande tillatt spela fotboll på, trots att det oftahandlar om så kallade multisportarenor. Iflera fall är det främst äldre killar somanvänder dem och de yngre har svårt att fåtillträde, vilket till exempel eleverna påMöllevången påtalade. Det är bra att byggakonstgräsplanerna och spontanidrottsplatserna,men inte om det sker på bekostnadav andra alternativ. Kan vi kanske anta attkonstgräsplaner önskas av invånarna föratt de känner till att sådana finns och hurde kan användas, det vill säga det är kändmark? Det är kanske svårt att ha önskemålom sådant man inte känner till. Det ärdärför dags att finna nya typer av platserför nya möten och aktiviteter – att tänka inya banor, att bjuda in olika grupper ochkonstellationer i planeringsprocessen, atttänka in natur och äventyr i redanbebyggda områden och att informera omde platser som finns. Strävan kan vara attfinna en avvägning mellan det vardagligaoch det spektakulära. Det kan också varafruktbart att inte bara tänka idrott ellerfysisk aktivitet utan snarare tänka i olikakombinationer, till exempel hur kultur ochidrott kan mötas på en och samma plats.Det kan locka fler och nya individer tillplatsen. En social aktivitet kan glida över ien fysisk aktivitet. Gränserna behöver intevara så skarpa. Idrottsytor är ofta fysiskavgränsade från övriga stadsrummet. Detkan utgöra en tröskel till att använda dem.Därför skulle en ökad öppenhet mellanidrottens och övriga stadens rum öppna förfler. Dessa förslag gynnar många avstadens invånare, men kanske allra mestdem som inte lockas eller har möjlighet attta del av den traditionella (organiseradeeller spontana) idrotten.Jag vill framhålla att de idrottslyftssatsningarsom gatukontoret i Malmö drivitfyller ett behov då de fokuserat på områdenmed låg geografisk rörlighet. Jag vill seatt medel fortsättningsvis satsas på nytänkandeoch satsningar utanför den organiseradeidrotten. För det krävs nya samarbetsformerför utveckling och planering avidrottsmiljöer samt en ny syn på vad(riktig) idrott är. Frågan är dock om det ärRiksidrottsförbundet, i nuvarande form,som ska ansvarar för det.32 svensk idrottsforskning 1/2012


Manlig idrottsprofileringi grundskolanDen svenska modellen innebär traditionellt att skolan ansvarar förundervisning i idrottsämnet och föreningarna för idrotten på fritiden.Men i dag går tusentals elever på idrottsgymnasium och var fjärdehögstadieskola erbjuder träning på skoltid.I d r o t t s r ö r e l s e n och dess aktiviteter iskolan är inte helt nytt. Ett av de tydligasteexemplen är den verksamhet somintroducerades med idrottsgymnasierna ibörjan av 1970-talet. Genom dessa fick ettfåtal talangfulla elever i ett fåtal idrottermöjlighet att utöva sin idrott underskoldagen. Sedan mitten av 1990-talet hardet skett en markant ökning och breddningav utbudet av föreningsidrott bådeinom gymnasie- och grundskolan (1-4).Utvecklingen har inneburit att idrottsaktiviteternainom den svenska skolan harförändrats. Numera är det så mycket merän enbart det obligatoriska ämnet idrottoch hälsa. Idrottsträningar under skoltidbenämns internationellt som SchoolSport. I ett svenskt perspektiv kan begreppetanvändas som ett sammanfattning förden undervisning som sker inom det somkallas idrottsprofil i grundskolan ochinom ämnet specialidrott i gymnasieskolan.I många länder finns det nationellastrategier för hur skolor ska kunnaerbjuda unga idrottare möjligheten attkombinera studier med en satsning påidrott (5). I Sverige finns ett nationelltsystem för att kombinera idrott ochstudier på gymnasienivå, vilket saknas förgrundskolan. I grundskolan är utbudet avolika profiler och inriktningar i ställetlokalt beslutade och reglerade genom attskolorna kan utnyttja det utrymme somfinns inom ramen för det som kallas förskolans val och elevens val (6).Få studier av högstadietMedan idrottsprofilerad utbildning igymnasieskolan är väl studerad underflera decennier är situationen inomgrundskolan sparsamt studerad. Detövergripande syftet med vår studie ärsåledes att bidra med kunskap om idrottsprofileradutbildning i grundskolan. Vihar genomfört två delstudier – dels ennationell kartläggningsstudie av förekomstenoch omfattningen av idrottsprofileradegrundskolor, dels en intervjustudie ifyra skolor med fotbollsprofil.I den första studien har vi närmaregranskat utbudet av idrottsprofileradehögstadieskolor i 77 utvalda kommuneroch sammanställt data över skolorna frånSkolverkets internetbaserade resultat- ochkvalitetsinformationssystem (SIRIS). Vihar även intervjuat 50 skolledare somockså fått besvara en enkät. I studien harvi valt att definiera idrottsprofileradeskolor som:Skolor som har en uttalad idrottsprofileringoch/eller speciella klasser medidrottsinriktning. Det innebär att deskolor som enbart erbjuder idrott somett av många områden inom elevensval inte räknas som en idrottsprofileradutbildning.Den andra delstudien består av djupintervjuermed 24 elever i årskurs sju ochnio (8 flickor och 16 pojkar) samt 4 lärare.I den här artikeln har vi valt att lyftafram delar av resultatet. Den teoretiskainspirationen är hämtad från utbildningssociologenPierre Bourdieus teorier ochbegrepp (7,8). Studien har vidare ettgenusperspektiv (9,10,11).Skolorna skiljer sig åtI de 77 utvalda kommunerna fanns totalt854 högstadieskolor. 26 procent av dessauppfyller studiens definition av idrotts-Inger EliassonUniversitetslektorPedagogiska institutionenUmeå universitetMagnus FerryUniversitetsadjunktPedagogiska institutionenUmeå universitet, doktorand,Gymnastik- och idrottshögskolan,Eva OlofssonFil. dr.Pedagogiska institutionenUmeå universitet1/2012 svensk idrottsforskning 33


LagidrotterBredidrottsprofilSpecifikidrottsprofilKommunal (n=186) 89 121Fristående (n=36) 18 19Totalt 107 140Tabell 1. Inriktningarna på idrottsprofilerna i 77 undersöktakommuner. Samma skola kan erbjuda båda inriktningarna.n=antal.Individuella idrotterProcent Antal Procent AntalFotboll 48 107 Dans * 9 21Ishockey 14 31 Friidrott 6 13Innebandy 11 24 Hästsport 5 11Basket 8 18 Simning 4 9Handboll 8 17 Golf 3 7Bandy 1 3 Tennis 3 7Volleyboll 1 2 Konståkning 3 6Tabell 2. De vanligaste idrottsprofilerna på högstadiet i 77 undersökta kommuner.*Dans kan även förekomma på skolor med en kultur eller estetprofil. Här ingår dans endast omskolan har inriktningen som en idrottsprofil.profilerad utbildning. Utifrån huvudmannaskapär det var tredje kommunal ochvar tionde fristående skola som haridrottsprofilerad utbildning. I verksamhetendeltar uppskattningsvis var åttondeelev.Det finns två inriktningar på idrottsprofilerna,en bred och en specifik.Fyrtioåtta procent av skolorna har en bredinriktning som kan beskrivas som enfördjupning av ämnet idrott och hälsaeller ett smörgåsbord av fysiska aktiviteteroch idrotter. Skolor med en specifikidrottsprofil är vanligare och finns i 63procent av skolorna. De erbjuder i ställetträning i en eller flera specialidrotter(Tabell 1).Skolorna erbjuder totalt 31 olikaidrotter. Lagidrotterna dominerar utbudetoch fotboll finns i närmare hälften av allaskolor (48 procent). Bland de individuellaidrotterna är dans, friidrott, hästsport ochsimning vanligast (Tabell 2).Vanligast är att skolorna erbjuder idrottsom en eller flera profilinriktningar, menett fåtal skolor är rena idrottsskolor däralla elever deltar i idrottsprofileringen.Vissa skolor har valt att delvis integreraidrottseleverna genom att organiseraspeciella idrottsklasser, medan andraskolor helt integrerat idrottselever medövriga elever på skolan. Vilken strategiskolan väljer för att integrera elevernaverkar framför allt vara beroende avskolans storlek, tillgången på idrottslokaleroch antalet idrottselever.Gemensamt för skolornas organisationav idrottsprofilerna är att de användertiden för elevens val som bas för sinverksamhet. Vissa skolor använder ocksåtiden för skolans val. På andra skolor hartiden för elevens val utökats och på någraskolor sker undervisningen endast ianslutning till skolans start eller slut, ellerdelvis utanför timplanen. Någon enstakaskola byter också ut en lektion i ämnetidrott och hälsa mot undervisning i idrottsprofilen.Undervisningen på vissa skolor skerårskursvis medan andra undervisarårskurslöst. På vissa skolor undervisasflickor och pojkar separat, på andragemensamt. De intervjuade skoledarnaanger att gruppindelningen främst ärberoende av vilken karaktär aktiviteternahar och hur många elever som deltar.Skolorna som erbjuder idrottsprofilskiljer sig från övriga skolor i de 77 kommunerna.De har:• Fler elever än övriga skolor.• Lägre andel flickor.• Högre andel elever med utländskbakgrund.• Lägre andel föräldrar med en eftergymnasial utbildning.Samverkan med idrottsrörelsenÅttiotvå procent av skolorna samarbetarmed en eller flera idrottsföreningar påorten och nio procent med distriktsförbundeneller något specialidrottsförbund(Figur 1).Den samverkan som sker mellan skolornaoch idrottsrörelsen bygger främst påatt ledare, tränare eller coacher från denföreningen som skolan samarbetar medinvolveras i undervisningen(74 procent). Vanligt är också att föreningarnaslokaler används till undervisningen(38 procent). Några anger också attskolans idrottsprofil har samverkan medidrottsrörelsen genom olika Idrottslyftprojekteller genom anordnandet av idrottstävlingar.Några få skolor anger också attsamarbetsföreningarna används för att34 svensk idrottsforskning 1/2012


Volleyboll Dans Danskankanävenävenförekommaförekomma 1 påpå 2 skolorskolor Konståkning medmed enenkulturkulturellereller 3 estetprofil.estetprofil. 6 HärHäringåringårdansdansendastendastomom1 inriktningen Dans kan även förekomma på skolor med en kultur eller estetprofil. Här ingår dans endast om inriktningensomsomenenidrottsprofil.idrottsprofil.skinriktningen som en idrottsprofil.rekrytera elever, antingen som rekryteringsbaseller som rekryteringsverktyg(Figur 2).Kul med fotbollI den andra delstudien har vi undersöktflickors, pojkars och lärares erfarenheteroch uppfattningar om idrottsprofileradutbildning i grundskolan.Eleverna är mycket positivt inställda tillfotbollsprofilerna. Oavsett ålder och könanser eleverna att fotbollen gör skoldagenroligare. Det är tydligt att de väljer fotbollmot bakgrund av att de spelar fotboll påfritiden. Flera av eleverna säger att de harspelat fotboll sedan 6-7 års ålder. Påfrågan varför han valt fotboll på skolansäger en pojke:”Fotboll är bäst helt enkelt.”Några elever menar att de vill prövahur det är att ha fotboll på skoltid och intebara på fritiden, eller att de ville satsa merpå idrotten:”Jag vill få mer träning på det. För jag vill typ,satsa lite mer på det (fotboll) och bli bättre.Sen tycker jag det är kul.”En elev beskriver att fotbollen intekänns som en lektion utan mer som fritid:%% 100 100909080807070606050504040303020201010 0 0 I-ro0123reningar SF, DF, SISU Annat Inget I-ro0123reningar SF, DF, SISU Annat Inget Figur 1. 1. Skolornas samarbetspartners inom idrottsrörelsen. SF=specialidrottsförbund, DF=distriktsförbFigur 1. Skolornas samarbetspartners inom idrottsrörelsen. SF=specialidrottsförbund, DF=distriktsförbuDF=distriktsförbund.% % 80 80 70 70 60 60 50 50 40 40 30 30 20 20 10 10 0 0 Tränare Lokaler I-ro01lyG Tävlingar Rekrytering Övrigt Inget Tränare Lokaler I-ro01lyG Tävlingar Rekrytering Övrigt Inget Figur 2. . Skolornas samverkan med idrottsrörelsen.Figur 2. . Skolornas samverkan med idrottsrörelsen.”Då orkar du ju för det första inte ge hundra påklubbens träning heller, eftersom att du redan ärtrött i kroppen efter att du har kört i skolan.Ibland händer det.””Alltså, det blir ju som en fritid. Det blir ju somen brejk från skolans lektioner där du sitter ochtänker och tänker… Älskar du fotbollen blir det jusom rast. Nu får man göra det man verkligen villoch få göra det under skolans tid, det är välganska underbart kan man säga.”Lärarna säger att det bästa med attundervisa i fotbollsprofilen är att de fårhålla på med sin hobby på arbetstid.Vidare uppskattar de den personligarelation och den gemenskap de får medeleverna. De får uppleva elevernas glädjeoch de tycker att det är roligt att bidra tillatt skolan får ett gott rykte:”Jag gör ju det som jag tycker är det roligaste somfinns. Jag menar jag har ju samtidigt min hobbyoch mitt yrke, liksom som håller på med det här,så det är få förunnat som har det…”Även om eleverna gillar fotbollen finnsvissa nackdelar. Elever berättar att deibland kan bli trötta av all träning eller attde får stressa för att hinna till klubbensträning på kvällen på grund av eftermiddagsträningi skolan:Ett annat orosmoment som eleveribland känner är att de inte hinner medskolan på ett bra sätt och att det finns enrisk att de tappar intresset om de harfotboll i skolan i flera år. En elev önskaratt det borde finnas en person att pratamed som kan stärka elevens självförtroendenär kraven på prestation blir alltförhöga.Fotbollsprofil och klubbfotbollLärarna i fotboll menar att de själva lokaltpå skolan bestämmer innehållet i undervisningeni fotbollsprofilen men att de oftautgår från Svenska fotbollförbundetsutbildningsmaterial. Eleverna är dockosäkra på vad som förväntas av dem pålektionerna utöver att de ska bli bättresom fotbollsspelare, göra sitt bästa, ha kuloch inte förstöra för andra elever.För att kunna vara med i fotboll påskolan är det ett krav att eleven inte ärnybörjare i fotboll, på grund av att deflesta eleverna som väljer fotboll redanspelar i ett lag i en idrottsförening. Det1/2012 svensk idrottsforskning 35


krävs också ett starkt intresse för fotbollför att vara med i en fotbollsklass, särskiltom eleven gör ett val för flera år. En elevsäger:”Jag tror nog ifall man ska börja fotbollsklass såmåste man nog ha intresset sen tidigare… annarstror jag inte man pallar liksom.”Lärarna har en liknande uppfattning:”Ja, i ett lag, i en förening. För gör man inte detså tror jag inte man heller har intresset attfullfölja så att säga.”Fotbollsprofilen och klubbfotbollen harstora likheter innehållsmässigt, men detfinns också skillnader. En skillnad sombåde elever och lärare lyfter fram är attskolan är obligatorisk vilket innebär attalla ska få vara med oavsett prestationsförmåga.Resultaten visar också att skolanhar större fokus på individens utvecklingän på laget. Lärarna anser att skolansfotboll måste vara roligare än klubbens föratt eleverna inte ska skrämmas bort.Dessutom kan läraren inte ha lika högakrav på eleven i skolan som han kan hasom tränare i klubbfotbollen.”Det kan jag säga att jag inte ställer lika höga kravhär (i skolan), jag kan inte höja rösten och geextralöpningar, utan då tar jag hellre ett samtalmed dem liksom... Jag är lite snällare här. …i enkommunal skola ska alla få vara med och ha kul.”Flickor och pojkar tillsammansPojkarna är till antalet fler än flickorna ialla klasser som ingår i delstudien. Enlärare beskriver hur fördelningen kanskilja sig åt mellan årskurserna därantalet flickor successivt minskar medåldern:”De som går i sjuan nu, där är det 15 tjejer och15 killar. De som går i åttan nu är det 22 killaroch 8 tjejer. Och i nian nu så är det, ja, det är ju40 killar och 9 tjejer tror jag.”Lärarna säger först att gemensamundervisning med flickor och pojkar äroproblematisk. Sen visar det sig dock attsvårigheter finns, främst för flickorna.Särskilt handlar det om när de fysiskaskillnaderna blir för stora mellan eleverna.Det uppstår tydligast på skolor därundervisningen i fotbollsprofilen organiserasöver flera årskurser. En läraresäger:”När en tjej i sexan ska spela mot killar i nian dåhar man full förståelse för att det blir svårt alltså.Men då brukar jag försöka förklara att då får mangöra det bästa utifrån förutsättningarna alltså,sparka iväg en fotboll, det kan man göra oavsettvem som står mitt emot dig i så fall.”Utbredd profilering i grundskolanVår studie visar att idrottsprofileradutbildning är utbredd på grundskolanshögstadium. Den förekommer i var fjärdeskola och var åttonde högstadieelev deltari sådan utbildning. Flertalet skolor istudien startade sina idrottsprofiler imitten av 2000-talet under den periodsom konkurrensen mellan skolor ökademarkant i Sverige. Idrottsprofileringenhar i denna utveckling blivit ett sätt förskolorna att rekrytera elever, det vill sägaett konkurrensmedel i striden om elevernaoch idrott har blivit en vara påutbildningsmarknaden (4).Utbudet av idrotter som förekommerinom idrottsprofilerna påminner omgymnasieskolans utbud av specialidrotter(4) och ungdomars föreningsidrottande istort. En viktig skillnad är att det förgymnasiekolan finns en koppling tillämnet specialidrott med ett nationelltregelverk och certifieringssystem, medangrundskolans utbud och organisering avidrottsprofiler är lokalt reglerat. Denfördjupade studien av några skolorsfotbollsprofilering visar att skolansfotbollsverksamhet har stora likheter medidrottsföreningens och att lärarna bestämmerinnehållet i undervisningen motbakgrund av sin fotbollskunskap frånföreningslivet. Eftersom Svenska fotbollförbundeterbjuder skolorna Fotbollensarbetsbok för grundskolan och harutformat en certifiering av fotbollsprofiler,får således förbundet ett stort inflytandeöver undervisningen.Med stöd av Bourdieus resonemangkan vi se exempel på att utbudet av denspecifika produkten tävlingsidrott numeraåterfinns i två olika rum – i idrottsrörelsenoch i skolan (8). Den efterfrågan avidrottsprofiler som finns beror på vilkaelevernas dispositioner för att hålla påmed viss typ av idrott är. De personer somvalt att undervisa i idrottsprofilerna harutvecklat en stark smak för idrott genomsin bakgrund inom idrottsrörelsen somutövare och ledare. Fotboll i skolan blir i36 svensk idrottsforskning 1/2012


praktiken därför endast tillgänglig förelever och lärare som har spelat fotboll,eller som varit fotbollsledare, i föreningslivet.Manlig dominansIdrottsprofilerna i grundskolan dominerasav män. En majoritet av eleverna ärpojkar. De som undervisar i idrottsprofilernaär framför allt män med erfarenheterfrån idrottsrörelsen. När det gällerutbudet av fotboll i skolan verkar det intematcha flickors behov och efterfrågan ilika hög grad som pojkars behov och efterfrågantrots flickornas omfattande deltagandei föreningslivet (12). En konsekvensav att idrottsrörelsens aktiviteter och dentillhörande tävlingslogiken inryms inomskolans idrottsprofilerade utbud är attskolorna bidrar till att reproduceraridrottens struktur. Risken finns då att denmanliga normen och dominansen överförstill skolan. En frånvaro av problematiseringav fotbollsutbudet i skolan och dessorganisering i form av köns- och åldersintegreringkan ses som ett exempel på ettsymboliskt våld i Bourdieus termer (9).Det innebär att en manlig dominans kanvidmakthållas. Därmed får inte flickorsamma möjligheter som pojkar att utövasin fritidssysselsättning i skolan och attutvecklas i fotboll. Det innebär också attflickor ställs inför krav på att vara ”tuffa”och anpassa sig till en manlig norm föratt klara undervisningen (11). Den könsintegreradeundervisningen ger dockmöjlighet till att bryta sådan manligdominans, men förutsätter en genusmedvetenundervisning (10).Svengelsk modell?Avslutningsvis visar studien att idrottsträningunder skoltid - School Sport- numera är en del av det svenskautbildningssystemet. Därmed har ocksåen förändring skett av den svenskaidrottsmodellen. Att tävlingsidrottandetfått ett eget utrymme inom den svenskaskolan och att idrottsrörelsen och skolansamarbetar genom idrottsprofilernainnebär att vi istället för den traditionellafolkrörelsemodellen kanske snarareborde tala om en ”svengelsk” idrottsmodellför den svenska ungdomsidrotten.Genom att idrottsprofilerna erbjuderidrott till elever med ett habitus skapatgenom deltagande i föreningsidrott,öppnas dörrarna i grundskolan i förstahand för mera idrott för idrottsungdomaroch inte för idrott för flera ungdomar.Referenser1. Olofsson, E. European PhysicalEducation Review. 2005:11 (3),219-237.2. Olofsson, E. ScandinavianJournal of Educational Research.2007:51 (2), 163-183.3. Ferry, M. & Olofsson, E. Ämnetspecialidrott i gymnasieskolan –en utvärdering av ämnet läsåret2008/09. 2009.4. Lund, S. Idrottsutbildning ochutbildningsreformer – en kartläggningsstudieav Sveriges gymnasialaidrottsutbildning. 2010.5. Radtke, S. & Coalter, F.Sport Schools: An internationalReview. 2007.6. SFS 2010:800. Skollagen.7. Bourdieu, P. Social ScienceInformation. 1978:17 (6), 819-840.8. Bourdieu, P. Sociology of SportJournal. 1988:5, 153-161.9. Bourdieu, P. Den manligadominansen. 1999.10. Wright, J. European PhysicalEducation Review. 1999:5 (3),181-197.11. Eliasson, I. Soccer andSociety. 2011:12 (6), 820–833.12. Larsson, H. m.fl. På pojkarnasplanhalva. Ämnet idrott ochhälsa ur ett jämställdhets- ochlikvärdighetsperspektiv. 2010.Kontaktinger.eliasson@pedag.umu.semagnus.ferry@pedag.umu.seevamolofsson@gmail.comFörnya din prenumeration för 2012 !3 | 2011 | ÅRGÅNG 201 | 2012 | ÅRGÅNG 214 | 2011 | ÅRGÅNG 202 | 2011 | ÅRGÅNG 20Tema:IDROTTSLYFTETTidernas satsninggranskadTEMA:Tema: BARNVad är barnets bästa?Talanglös selekteringGuide till barns skadorForskning vidLinnéuniversitetetJakten på talangenIshockeyns tidigahistoriaPromenaden somersätter medicinenMotion smakar bäst i storstäderHärföraren mot doping 80 år– porträtt av Arne LjungqvistMultisportarna spränger fysiologiska gränserEn helårsprenumeration med fyra nummer kostar 200 kr. Beställ på www.centrumforidrottsforskning.se1/2012 svensk idrottsforskning 37


GÖTEBORGS UNIVERSITETS UTVÄRDERING AV: AKADEMISKA IDROTTSFÖRBUNDET, FLYGSPORTFÖRBUNDET, KORPEN OCHRIKSIDROTTSFÖRBUNDETStyra eller styras?Om relationen mellan staten och RFEffekterna av Idrottslyftet är svårbedömda. De förbund som vi harutvärderat baserar sina antaganden mer på förhoppningar än hårdafakta. Vi noterar även att regeringens förtroende för RF är mycket stort.Owe StråhlmanInstitutionen för kost- ochidrottsvetenskapGöteborgs universitetSten ErikssonInstitutionen för kost- ochidrottsvetenskapGöteborgs universitetGöran PatrikssonInstitutionen för kost- ochidrottsvetenskapGöteborgs universitetD e n h ä r u t v ä r d e r i n g e n om effekterav Idrottslyftet, som omfattar Riksidrottsförbundet(RF), Sveriges akademiskaidrottsförbund (SAIF), Svenskaflygsportförbundet (FSF) och KorpenSvenska motionsidrottsförbundet, visaratt det finns ett mycket förtroendefulltsamarbete mellan staten och idrottsrörelseni stort och mellan RF och dessspecialförbund.Idrottslyftet har en historia som gårtillbaka till 1980-talet. Utöver detvanliga, årligen utdelade, statliga stödettill idrotten har den svenska regeringenvid två tillfällen under de båda sistadecennierna av 1900-talet (år 1984 och1998) beslutat om särskilda ekonomiskasatsningar till idrottsrörelsen genom attavsätta medel ur Allmänna arvsfonden.Den andra satsningen kom hösten 1998,strax efter att Idrottsutredningen lämnatsitt slutbetänkande (1). De tankegångarsom låg bakom arvsfondssatsningarnaframfördes under slutet av valrörelseninför 2002 års val av det Socialdemokratiskaarbetarpartiet, sedan barn- ochungdomsidrotten blivit en viktig valfråga.I valmanifestet från år 2002 Barnoch unga vår framtid stod:”Vi är beredda att under mandatperiodentillföra idrottsrörelsen totalt en miljard kronor,om idrottsrörelsen tar på sig att öppna dörrarnaför fler, hålla tillbaka avgifterna, satsa mer påflickidrotten, delta i kampen mot droger ochintensifiera samarbetet med skolorna” (2).Även i 2006 års valrörelse blevbarn- och ungdomsidrotten en fråga somdebatterades. Den nybildade Alliansenlovade att de inte bara skulle fortsätta,utan dessutom fördubbla, projektsatsningenpå barn och ungdomar från en tilltvå miljarder kronor. Efter Alliansensvalseger var den nya regeringen beredd attunder senhösten 2006 verka för ett beslutom att förverkliga sitt vallöfte inom ramenför Idrottslyftet. I linje med den samförståndsandasom länge rått inom svenskidrottspolitik (3) lät regeringen RFinkomma med förslag till inriktning på dennya satsningen.Utvärderingen tar formDen del av utvärderingen som genomfördesvid institutionen för kost- och idrottsvetenskap,Göteborgs universitet inleddesmed att diskutera övergripande förslag förutvecklingsarbetets struktur och hursamverkan med RF och de tre specialförbundenskulle genomföras. Dialogträffargenomfördes med förbundens representanterpå ett tidigt stadium. Då fastslogs denmodell som forskargruppen har utvecklatbåde för specialförbunden och för RF:ssamordningsgrupp. Vi iscensatte sedan enintervjustudie med föreningar, förbund,RF:s styrgrupp, en representant frånRiksidrottsstyrelsen samt representanterför departementet. Totalt genomfördes 30intervjuer från Umeå i norr till Malmö isöder (Tabell 1).AntalintervjuerIntervjuade1 Departement6 Riksidrottsförbundets idrottslyftorganisation6 Sveriges akademiska idrottsförbund8 Svenska flygsportförbundet9 Korpen Svenska motionsidrottsförbundetTabell 1: Totalt genomfördes 30 intervjuer.38 svensk idrottsforskning 1/2012


Krav på högre åldersgränsDe tre specialförbund som vi har utvärderathar vissa gemensamma drag. De kanalla betraktas som paraplyorganisationer,som härbärgerar ett stort antal idrottereller fysiska aktiviteter. De är till stor delinriktade mot bredd- och motionsidrott(Flygsportförbundet har en större elitverksamhetän de övriga två) och devänder sig i hög grad till åldersgruppersom inte omfattas av Idrottslyftet. Församtliga har det inneburit en rad svårigheter,men de har på olika sätt försökt attkringgå problemen och hitta projekt ochverksamheter som ändå har gått att fogain inom Idrottslyftets ramar. I stort harförbunden varit uppfinningsrika ochlyckats väl med detta. SAIF, och specielltKorpen, har varit extra framgångsrika.De tre specialförbunden har formuleratvälbefogad kritik mot det befintligaregelverket avseende åldersaspekten ochdärtill också framfört argument för varförman bör förändra åldersbestämmelsernaoch låta även unga vuxna (20-25 år) få tadel av Idrottslyftets projektverksamhet.Förbunden inkom även med ett gemensamtbrev till RF, där man framförde kravpå förändringar. Skrivelsen har fått visstgehör. RF har i sin skrivelse i mars tillKulturdepartementet, om utformningenav det nu pågående Idrottslyftets första 18månader (juli 2011-december 2012),föreslagit att de förbund som önskar kan”… i begränsad omfattning efter godkännande avRF bevilja medel till förstärkta satsningar i förstahand inriktade på ledarrekrytering, som vändersig till åldersgrupper upp till och med 25 år.Dessa satsningar får totalt omfatta maximalt 10MSEK” (5).Förslaget godkändes senare av regeringen.De utvärderade förbunden har, när detgäller projektansökningar, haft en mycketliten styrning gentemot föreningarna. Dehar låtit idéerna flöda fritt inom Idrottslyftetsramar. De har ofta haft rådgivandesamtal antingen centralt (SAIF och FSF)eller regionalt (Korpen) och parterna har idialog med varandra kommit fram tillprojektförslag som sedan bedömts. Vissarestriktioner har funnits, till exempel iKorpen som framför allt satsat på störreprojekt i större kommuner (där mantidigare tappat mark), men också stöttatbra projekt i mindre orter med lite mindresummor. Korpen har också velat satsa påmer långsiktiga projekt över flera år. Det ärtankegångar och en policy som vi rekommenderarandra förbund tar efter. Endast ienstaka fall bör det vara befogat att gepengar till småprojekt.Josef Fahlén vid Umeå Universitet har ien preliminär utvärdering av vissa delar avIdrottslyftet funnit att de kan finnasganska stora diskrepanser i hur aktörer,som fördelar och mottar medel, på olikanivåer medvetet eller omedvetet tolkaravsändarens (regeringen) intentioner medIdrottslyftet (6). Det kan i slutändan ledatill att specialidrottsförbund och föreningarsatsar på projekt som i större ellermindre grad avviker från de ursprungligamålen. Sådana utfall är troligen mersannolika i utvärderingar av förbund medstark tävlings- och elitverksamhet i barnochungdomsidrotten. Ingen av de treaktuella förbunden som vi har analyserathar dock haft en sådan inriktning. Vi harheller inte kunnat se att det varken påförbunds- eller föreningsnivå har förekommitnågra tydliga avvikelser från regeringensoch RF:s avsikter med Idrottslyftet.Statistiska bristerHur skulle det gå med projektens fortlevnadom bidragen skulle upphöra? Svarenär något blandade. En del uttryckteoptimism och framtidstro, medan andrasåg medel från Idrottslyftet eller någonannanstans som en förutsättning för attkunna fortsätta med verksamheten. Det ärtveklöst så att många föreningar och ävenförbund gjort sig beroende av projektmedel.Man har ofta byggt upp en så stororganisation att det är en förutsättning attnya medel hela tiden flyter in. En person iKorpens ledning som vi intervjuat svaradeså här på frågan om de skulle kunnabehålla antalet anställda om pengarna frånIdrottslyftet skulle utebli: ”Nej, det skullevi inte. Vi har gjort en långsiktig plan påhur vi skulle göra utan dessa pengar. Dåskulle vi i första hand dra ned på föreningsutvecklingsdelen.Det är ju där vikunnat lägga resurser för att kunna mötaföreningarna.” Det är således viktigt attbåde förbund och föreningar har enberedskap för en sådan situation.Nära sammankopplat med projektensfort- eller överlevnad är i vilken grad som1/2012 svensk idrottsforskning 39


AkademiskaidrottsförbundetGrundat: 1913MedlemmarMän: 32 546Kvinnor: 36 700*Deltagartillfällen: 70 045FlygsportförbundetGrundat: 1966MedlemmarMän: 17 374Kvinnor: 2 370*Deltagartillfällen: 9 146KorpenGrundat: 1945MedlemmarMän: 196 589Kvinnor: 85 295*Deltagartillfällen: 151 3302010 års statistik.*Träning & tävling för barn 7-20 år.de tre förbunden nått de övergripandemålen för Idrottslyftet: Har fler ungakommit in i idrottsrörelsen och stannar dekvar längre? Det är inte helt lätt attbesvara den frågan, då uppläggningen avhela Idrottslyftets rapportering av statistiskauppgifter har brister som gör detsvårt eller omöjligt att studera både inochutflöden i idrottssystemet över tid.För att kunna göra tillförlitliga uppföljningaröver tid behövs dessutom uppgifterpå individnivå – att kunna följa sammaindivider under viss tid, något som ställerstora krav på statistikinsamlingen (7). Omdessutom uppgifterna varierar ellerförändras under pågående projekttid, somSAIF kritiserade RF för, bidrar detytterligare till problemen med att få framtillförlitlig statistik. Man bör inte ändraspelreglerna under pågående match! Detenda vi kan säga med säkerhet om destuderade tre förbunden är att Korpen harökat sitt deltagarantal av unga individerpå ett remarkabelt sätt.Intervjuerna på RF-nivå avslöjadeockså en stor osäkerhet om utfallet avIdrottslyftet i termer av faktiska siffror.De intervjuade var ändå övertygade omatt Idrottslyftet hade gjort stor nytta i enmängd avseenden – de empiriska beläggenför detta var dock magra – men de varockså medvetna om (när vi ställde närgångnafrågor) att till exempel LOK-stödsstatistikeninte uppvisade den ökning dehade hoppats på. Det är i det här sammanhangetviktigt att notera att man ävenpå ansvarigt departement hyste en stortilltro till idrottens förmåga att genereraönskvärda effekter för barn och ungdomar,speciellt i jämförelse med andrafolkrörelser. Ett utdrag ur en intervju påKulturdepartementet är illustrativt:”… vi brukar säga att rent statsfinansiellt kan mansäga så här att hur mycket pengar man än slängeråt idrotten så får man minst lika mycket tillbakaför de har sån absorptionsförmåga. Det finns såmånga föreningar och aktiva att även om det ärväldigt stora pengar så finns det en förmåga attanvända pengarna därute.”I analysen av relationen mellan statenoch Idrottslyftet kunde vi konstatera attden statliga styrningen var låg, ochdärmed fanns det även ett stort frirum föridrottsrörelsen att forma verksamheten.Det tysta kontraktet mellan stat ochidrottsrörelse fungerar fortfarande ochförtroendet för RF var och är så stort attregeringen inbjöd idrottsrörelsen attformulera förslaget till Idrottslyftet (3,4).En liknande strategi hade regeringen infördet nu pågående Idrottslyftet som börjadeden 1 juli 2011. Den här, nästan osynligastyrningen från staten, är förmodligenmycket effektiv i en situation där bådaparter dels är beroende av varandra (idrottär generellt sett populärt bland väljarnaoch idrotten är i behov av statens pengar),dels hyser ömsesidig tillit till varandra ochhar liknande grundläggande värderingar.Stor frihet och liten kontrollHur bör ett så stort projekt som Idrottslyftetorganiseras centralt på RF och i vilkengrad bör det styras uppifrån (från RF)?Våra analyser visar att i slutet av Idrottslyftetfungerade RF:s interna organisationtack vare ett fåtal skickliga nyckelmedarbetare.Den minimala projektorganisationsom växte fram efter viss initial oenighethar således kunnat hantera detta jätteprojektutan alltför mycket gnissel i maskineriet.Organisationen kan dock betraktassom sårbar och personberoende. För attkunna förbättra de administrativa/statistiskauppgifterna från alla nivåer borde denfasta staben på RF utökas med kompetenserinom dessa områden istället för att somnu utnyttja kansliets allmänna resurser.Mycket av den osäkerhet som nu råderbeträffande vad som verkligen sker iidrottslyftsrelaterade aktiviteter i förbundoch föreningar beror på bristande relevantoch tillförlitlig information. Här behövsspetskompetens som på heltid kan ägna sigåt att förbättra dessa komplexa fenomen.De administrativa systemen måste ocksåutformas så att de inte blir för besvärligaoch betungande för användarna attutnyttja. Sådana förbättringar skulle varatill gagn för RF, som då kunde produceramer kvalificerade rapporter till regeringen,men också underlätta för att få framnödvändiga basdata som bland annat kananvändas till att få fram bättre underlag förutvärderingar av Idrottslyftet.Vår utvärdering har visat att bådeförbunden och föreningarna/projektenupplevde en relativt stor frihet visavinärmast överordnade nivå. RF utövade,generellt sett, en låg grad av kontroll ochhade stort förtroende för förbundens och40 svensk idrottsforskning 1/2012


föreningarnas agerande. RF menade attendast ett fåtal missbrukar tilldelade medeloch att det var bättre att använda morot änpiska. Samtidigt var man inom RF enigaom att missbruk måste beivras. Denutökade kontroll som tillkom på RF:sinitiativ under slutet av Idrottslyftet, ochsom förbunden genomförde, visade att detvar mycket sällsynt att medel användes påett felaktigt sätt. Vi anser att det är viktigatt hitta rätt balans när det gäller kontrollen.Den får inte vara för slapp för då kandet hända att denna kunskap sprider sig isystemet och risken för missbruk kan dåöka (viket vore förödande). Men den börinte heller vara för rigorös eftersom detkräver stora resurser och kan leda till enkänsla av förmyndarmentalitet hos brukarna.Viktigt att utvärdera i tidAvslutningsvis vill vi ta upp en diskussionom några metodologiska problem som haraktualiserats i samband med utvärderingarnaav Handslaget och Idrottslyftet. Dethar nyligen beslutats av regeringen attIdrottslyftet får fortsätta under ytterligareen period. De första 18 månaderna ska detske under likartade betingelser somtidigare men med tydligare fokusering motmångfaldsfrågor, barnrättsperspektiv ochkönsaspekter. Återigen fattades dockbeslutet innan den externa utvärderingenförelåg. I beslutet finns dock en öppning föratt man kan ta hänsyn till viktiga resultatfrån den externa utvärderingen och göraeventuella förändringar efter den 31december 2012. Så här skriver RF tillKulturdepartementet:”RF vill därefter ha möjlighet att styra omsatsningen om de externa utvärderingar som förnärvarande genomförs av Idrottslyftet 1-4 visar attförändringar är befogade” (5).Den nu aktuella utvärderingen har haften helt annorlunda uppläggning. För detförsta valdes de sex forskargrupperna ut avRF efter okända kriterier. För det andrahade RF på förhand bestämt uppläggningenav utvärderingen (utvärderingsmodell).För det tredje bestämde RF (heltenväldigt) vilka förbund som respektivelärosäte skulle utvärdera. Således ett tydligtexempel på styrd uppdragsforskning. Inomdessa ramar kunde sedan forskargruppernaha inflytande på vilken eller vilkadatainsamlingsmetod(er) som skulleanvändas och instrumentkonstruktion. Dekunde också välja undersökningsgrupperinom de utvalda förbunden. Även dennagång började utvärderingarna ganskalångt efter att Idrottslyftet hade startat.RF valde tyvärr att gå på en frivillig linjenär det gällde vilka specialidrottsförbundsom kom att delta i utvärderingen. Detgjorde att endast en tredjedel av förbundenvalde att vara med i utvärderingen.Av erfarenhet vet man att ett sådant urvalblir positivt snedvridet och kan därmedinte ge en representativ bild av verkligheten.I det här fallet blir bilden mer positivän om att representativt urval hade gjorts.På basis av dessa erfarenheter är detviktigt att undvika de misstag som begåttsi de två tidigare externa utvärderingarna.Vi har tidigare diskuterat de brister somfinns beträffande statistiska och andrauppgifter, som är nödvändiga för att få etttillförlitligt datamaterial som underlag förutvärdering och beslut. Vårt förslaginnebär i korthet att det är viktigt att RFengagerar ett antal erfarna och kunnigaforskare och utvärderare i god tid föreårsskiftet 2012-2013 för att utforma enadekvat utvärderingsdesign, som tillåteratt utvärderingen kan starta i början av år2013 då eventuella förändringar kan trädai kraft. Det är mycket viktigt att vara medfrån början, att få möjlighet att samla iningångsdata i relevanta avseenden(förmätningar) som sedan går att jämföramed utgångsvärden (eftermätningar).Designen bör således vara av longitudinellkaraktär och ha inslag av både data påmakronivå (gärna riksrepresentativa) ochintensivdata på mikronivå (enskildaföreningar och projekt). Det bör ocksåvara en blandning av kvantitativa ochkvalitativa data. En mångfald av datainsamlingsmetoder(enkäter, intervjuer,observationer, dokumentanalyser) böreftersträvas.En utvärdering av det här slaget harstora möjligheter att täppa till många avde kunskapshål som finns och skapakunskaper om vilka effekter som faktisktuppnås med den här typen av storanationella satsningar. Efterfrågas sådankunskap, vilket inte är helt säkert, bör RFskyndsamt ta tag i utvärderingen av detnya pågående Idrottslyftet.Referenser1. Idrottsutredningen (1998).Idrott och motion för livet:statens stöd till idrottsrörelsenoch friluftslivets organisationer:betänkande. Stockholm: Regeringskansliet.2. Handslaget-en valfrågawww.rf.se3. Bergsgard, N. A, & Norberg, J.R (2010). Sports policy and politics– the Scandinavian way. InSport in Society Cultures, Commerce,Media, Politics 4, vol. 13,567-582, Routledge.4. Dean, M. (2010). Governmentality:power and rule in modernsociety. (2. ed.) Thousand Oaks,CA: SAGE Publications.5. RF 237/11-27. Stockholm:Riksidrottsförbundet.6. Fahlén, J (2011). Idrottensorganisering. Blå boken. SCIF:sårsbok 2011.7. Patriksson, G. (1987). Idrottensbarn: idrottsvanor, stress,“utslagning”. Stockholm:Friskvårdscentrum.Kontaktowe.strahlman@ped.gu.segoran.patriksson@ped.gu.s1/2012 svensk idrottsforskning 41


UMEÅ UNIVERSITETS UTVÄRDERING AV: HANDIKAPPIDROTTSFÖRBUNDET OCH PARALYMPISKA KOMMITTÉN, BUDO & KAMPSPORT-,GYMNASTIK-, INNEBANDY-, OCH SKIDFÖRBUNDETDet stora lyftet uteblevStaffan KarpDocentPedagogiska institutionenUmeå universitetInger EliassonFil. dr.Pedagogiska institutionenUmeå universitetJosef FahlénDocentPedagogiska institutionenUmeå universitetKim WickmanFil. dr.Pedagogiska institutionenUmeå universitetKent LöfgrenFil. dr.Pedagogiska institutionenUmeå universitetIdrottslyftet har huvudsakligen bidragit till att stärka den ordinarieverksamheten i föreningarna. Trots goda ambitioner både från specialidrottsförbundoch föreningar har den höga graden av handlingsfrihetfrån RF och neråt i organisationen gjort att de kvalitativa språngenhar uteblivit.F o r s k a r g r u p p e n vid pedagogiskainstitutionen på Umeå universitet har haftRiksidrottsförbundets (RF) uppdrag attutvärdera hur ett antal specialidrottsförbund(SF) har arbetat med Idrottslyftet:Budo & Kampsportförbundet, Gymnastikförbundet,Handikappidrottsförbundetoch den Paralympiska kommittén,Innebandyförbundet och Skidförbundet.Syftet med utvärderingen är att belysa hurförbunden, genom riktade insatser somutgår ifrån ett jämställdhets- och jämlikhetsperspektiv,och som genomsyras avriktlinjerna i Idrotten vill, lyckats med attöppna dörrarna för fler barn och ungdomaroch hur man utvecklat verksamhetenså att fler väljer att idrotta längre upp iåldrarna (1).Tre delstudierTre delstudier genomfördes där vi följdekedjan från regeringen till föreningsnivån,det vill säga från ett politiskt formuleratuppdrag till RF via specialidrottsförbundentill lokala aktiviteter på föreningsnivå.I den första delstudien, Förbundsperspektivet,genomfördes intervjuer med förtroendevaldaoch anställda med nyckelpositionerinom specialidrottsförbunden.Syftet var att få en bild av hur centralaaktörer på SF-nivå beskriver och uppfattararbetet med Idrottslyftet och hurerfarenheter från föregångaren Handslagettagits tillvara. Totalt genomfördes 27semistrukturerade intervjuer. I den andradelstudien – Projektansökningarna –analyserades samtliga idrottslyftsprojektsom beviljats medel under Idrottslyftetsförsta och tredje period (hösten 2007-våren 2008 respektive hösten 2009-våren2010). Syftet var att få en bild av varföreningarnas utvecklingsfokus låg,projektens överensstämmelse medriktlinjerna i Idrotten vill samt omprojektens innehåll förändrades över tid.Totalt analyserade vi 2 563 projekt. I dentredje delstudien, Föreningsperspektivet,vände vi oss med en enkät till idrottslyftsansvarigai de föreningar som sökt medelför att genomföra projekt under periodfyra, det vill säga hösten 2010-våren 2011.Syftet var att få en bild av hur specialidrottsförbundensarbete med Idrottslyftetuppfattades på föreningsnivå och hur detvardagliga arbetet med Idrottslyftetgestaltade sig i föreningarna. En webbenkätsändes ut till 1 026 personer varav 486besvarade enkäten.FörbundsperspektivetAlla intervjuade ser positivt på Idrottslyftetsom uppdrag från RF (och regeringen).De flesta anser att Idrottslyftet har en brabalans mellan styrning och autonomi,men flera efterfrågar en tydligare uppföljningfrån RF (och regeringen) av hurmedlen används och vilka resultat somuppnås.De intervjuade menar att målen förIdrottslyftet stämmer väl överens medspecialidrottsförbundens egna mål förverksamheten. De förklarar det med attbåde Idrottslyftet och förbundens ordinarieverksamhet tar sin utgångspunkt iIdrotten vill. Samtliga SF har som mål attverksamheten ska vara jämställd ochjämlik. Genom intervjuerna framkommerdock att endast ett av dem har tydliga42 svensk idrottsforskning 1/2012


strategier och utvecklade metoder för attgenom Idrottslyftet öka jämställdheten iföreningarnas verksamhet, och ingetförbund har det för att öka jämlikheten.Graden av styrning skiljer sig mellan deolika specialidrottsförbunden. Frånmycket låg grad, där föreningarna harnäst intill obegränsad frihet att bestämmavilken typ av verksamhet som kan inrymmasi ett projekt, till relativt hög grad avstyrning, till exempel genom att föreningarnablir erbjudna färdiga paket framtagnapå SF-nivå. Gemensamt för specialidrottsförbundenär att de arbetatstrategiskt för att distribuera medel tillprojekt på föreningsnivå. Man har förenklatansökningsförfarandet, behållitansökningskriterier mellan de olikaperioderna och förenklat återrapporteringentill förbundet. Anmärkningsvärt äratt inget SF har någon planerad aktivitetför att stödja föreningar under genomförandefasen,det vill säga när de beviljadeansökningarna ska omsättas i praktiskverksamhet.Enligt de intervjuade är det svårt attmed säkerhet säga vilka resultat somuppnåtts i föreningarna. Även om vissasaker kan mätas till exempel antaletutbildade ledare, antalet flickor och pojkaroch antalet nya föreningar är det svårt attveta om en eventuell ökning är ett resultatav projekt inom Idrottslyftet, eller om detberor på den ordinarie verksamheten.Uppfattningen är dock att Idrottslyftetbidragit till en ökad tillgänglighet, flerutövare, att fler stannat kvar i föreningarnasamt att nya aktivitetsformer (nyaidrotter) har utvecklats. Däremot är intejämställdhets- och jämlikhetsperspektivensärskilt framträdande i arbetet. En delarbete har gjorts för en ökad jämställdhet,men mycket lite när det gäller en ökadjämlikhet.Ett intressant resultat är det kvalitetstänkandesom de intervjuade menar attflera års arbete med Idrottslyftet medfört.Det har skapat en ökad medvetenhet påalla nivåer om vikten av ett kontinuerligtutvecklingsarbete. Resultaten visar vidareatt specialidrottsförbunden allt mertenderar att arbeta med det extra stödetför Idrottslyftet som om det vore enpermanent resurstilldelning för barn- ochungdomsidrott. Om det extra stödetförsvinner finns, menar man, en uppenbarrisk för stagnation både när det gällerpågående och utvecklandet av nya aktiviteterför barn- och ungdomsidrott.ProjektansökningarnaDe analyserade projektansökningarnasvarar i huvudsak väl mot specialidrottsförbundensutvecklingsplaner, delvisberoende på att planerna till stor del ärmycket allmänt hållna, tillåtande ochinkluderande. I de SF som har merspecificerade utvecklingsplaner är gradenav styrning, mot ambitioner uttryckta iplanerna, tydligare för vilka projekt sombeviljats medel från Idrottslyftet än iövriga SF.Andelen projekt inriktade mot rekryteringvar högre (47 procent period ett och55 procent period tre) än andelen mot attutveckla verksamheten (36 procent periodett och 22 procent period tre). Om resultatenbryts ner på SF-nivå finns dock storaskillnader. Inom Gymnastikförbundet vartill exempel andelen utvecklingsinriktadeprojekt under period tre 52 procent,medan de rena rekryteringsprojektenvar12 procent. För Innebandyförbundetvar förhållandet 60 respektive 18 procent.Något förvånande är det relativt vanligtatt det inte framgår av ansökningarnavilken ålderskategori projekten vänder sigtill. Den samlade bilden är dock attprojekten huvudsakligen vänder sig tillidrottande barn och breddidrottandeungdom. Projekt som vänder sig tillelitinriktade ungdomar är sparsamtBudo & KampsportförbundetGrundat:MedlemmarMän: 26 863Kvinnor: 9 359*Deltagartillfällen: 867 183GymnastikförbundetGrundat:MedlemmarMän: 43 306Kvinnor: 170 428*Deltagartillfällen: 2 061 346HandikappidrottsförbundetGrundat:MedlemmarTotalt: 33 738*Deltagartillfällen: 256 269InnebandyförbundetGrundat:MedlemmarMän: 145 157Kvinnor: 68 308*Deltagartillfällen: 5 203 419SkidförbundetGrundat:MedlemmarTotalt: 181 231*Deltagartillfällen: 410 0142010 års statistik.*Träning & tävling för barn 7-20 år.Att få delta i Paralympics är drömmen för många unga kälkhockeyspelare. Efter tidigare storaframgångar har det gått tyngre för herrlandslaget under senare år.1/2012 svensk idrottsforskning 43


Ung judospelare.förekommande. En stor andel av projekten(26 procent period ett och 32 procentperiod tre) har samtidigt både idrottandebarn, breddidrottande ungdom ochelitinriktad ungdom som målgrupp. Detär projekt som utvecklar verksamhetenför alla, oavsett ålder och ambitionsnivå,exempelvis sådana vars syfte är att attutveckla föreningens organisation, ta frampolicyer eller att förbättra befintligaanläggningar eller utveckla idrottsmiljöer.Projektansökningarna har kategoriseratsutifrån riktlinjerna i Idrotten vill. Detgäller även projekt inriktade på rekrytering,även om riktlinjerna är utformadeför att verksamheten ska utvecklas.Projekt med syfte att rekrytera ledare harsom exempel kategoriserats som ledarutvecklingoch projekt med syfte att rekryterabarn har kategoriserats som lekfullhet,det vill säga aktiviteter som innebären lekfull sysselsättning. När ansökningarnaanalyserats visar det sig att dehuvudsakligen är inriktade mot ledarutveckling,verksamhetsutveckling ochlekfulla aktiviteter i närområdet. Mångaav riktlinjerna i Idrotten vill förekommermycket sparsamt i ansökningarna. Projektsom handlar om att lära sig fair play, attvisa hänsyn, god idrottsmoral, idrottsetiksamt projekt med syfte att utveckla entrygg social miljö är ovanliga. Detsammagäller projekt där målet är att tillvarataungdomars synpunkter och erfarenheter.Inom samtliga SF är andelen projekt medett framskrivet jämställdhets- ellerjämlikhetsperspektiv mycket lågt, ävenom allt arbete inom Idrottslyftet förväntasutgå ifrån dessa. Under period ett saknade90 procent av projekten sådana perspektiv,och under period tre 88 procent.FöreningsperspektivetDe idrottslyftsansvariga som besvaratenkäten består av två undergrupper. Engrupp som enbart administrerar Idrottslyftet(35 procent) och en grupp som bådeadministrerar och har medverkat somledare i minst ett idrottslyftsprojekt (65procent). De resultat som redovisas nedanär utan undantag svar på frågor med fastasvarsalternativ.En mycket stor majoritet (94 procent)anser att projekt är en mycket bra ellerganska bra form för att åstadkommautveckling. Endast en procent anser attdet är en dålig eller mycket dålig form. Enmajoritet (59 procent) anser dessutom attprojektmedel betyder mycket mer ellernågot mer för att utveckla verksamheten ijämförelse med fasta anslag till idrottsrörelsen.Sjuttionio procent anser att detarbete som bedrivs med att utveckla barnochungdomsidrotten skulle stanna helteller bedrivas i mycket långsammare taktom de extra anslagen från staten tillidrottsrörelsen skulle försvinna.På frågan om vilka idrottslyftsprojektsom genomförts i föreningen visar det sigatt de vanligaste är sådana som har somsyfte att utbilda ledare och projekt somutvecklar tränings- och tävlingsverksamheten.Minst vanliga har projekt varit därsyftet är ökad tillgänglighet till anläggningar/idrottsmiljöeroch sådana där måletär att rekrytera unga ledare. Målgruppenför rekryteringsprojekten har i första handvarit barn och ungdomar i allmänhet, och iandra hand flickor.Av de som besvarat enkäten anger 40procent att de är ganska dåligt eller mycketdåligt insatta i specialidrottsförbundetsutvecklingsplan och 13 procent att de intekänner till den. Av de som svarat att de ärmycket väl insatta (8 procent) eller ganskaväl insatta (39 procent) menar 88 procentatt planen i mycket stor eller ganska storomfattning stämmer med de behov somfinns i den egna föreningen. En relativt storandel (cirka 20 procent) är missnöjda medstödet från sitt SF när det gäller att skrivaansökningar, att genomföra projekten ochatt redovisa resultaten. Endast 22 procentanser att det egna specialidrottsförbundet imycket stor eller ganska stor omfattningtillvaratar erfarenheter från genomfördaprojekt. Sjuttiofyra procent tycker attförbundet varit mycket eller ganskanoggrant när det gäller kontrollen av ommedel har använts i enlighet med beviljadeansökningar. Elva procent menar däremotatt kontrollen är ganska eller mycketbristfällig och en lika stor andel anger attnågon sådan inte har gjorts.När idrottslyftsansvariga som självamedverkat i projekt ombeds ta ställning tillvad Idrottslyftet som företeelse betytt försvensk idrott hamnar dess betydelse förledarutbildning och för utveckling avtränings- och tävlingsverksamheten i toppbland svaren. Medelvärdet för båda dessaalternativ är 4,3 på en femgradig skala (1 =44 svensk idrottsforskning 1/2012


har mycket liten betydelse och 5 = harmycket stor betydelse). På tredje platsfinns utveckling av föreningens organisation(medelvärde 3,9). Minst betydelsehar Idrottslyftet för jämlikheten ochjämställdheten inom svensk idrott (medelvärde3,3). När det gäller vad de projektsom de idrottslyftsansvariga medverkat ibetytt för den egna föreningen liggerledarutbildning i topp (medelvärde 4,2),tätt följt av utveckling av verksamhetenför barn och för breddidrottande ungdom.De projekt som de idrottslyftsansvariga”Om det extrastödet försvinnerfinns, menar man,en uppenbar riskför stagnation”själva har medverkat i har i minst omfattningbidragit till rekrytering av barn ochungdomar och ledare från olika socialaskikt i samhället (medelvärde 3,3 respektive3,0). Avslutningsvis kan vi nämna atten majoritet (53 procent) har uppfattningenatt de projekt som genomförts iföreningen har ändrat karaktär över tid,från rekryteringsprojekt till projekt somutvecklar verksamheten, medan enbart 12procent anser att utvecklingen gått imotsatt riktning.Potentialen togs inte tillvaraSpecialidrottsförbundens mål för arbetetmed Idrottslyftet har i stort sett varitdesamma under den period som vi harstuderat. Strategier och metoder i de SFsom haft en hårdare styrning mot målen iutvecklingsplanerna har dock förändratsöver tid. Över lag svarar målen, strategierna,metoderna och resultaten väl mot dedelar i Idrotten vill som handlar om idrottför barn och breddidrott för ungdom,men i mindre omfattning mot elitinriktadidrott för ungdom. Några av riktlinjerna iIdrotten vill dominerar stort i de projektsom beviljats medel, nämligen ledar- ochverksamhetsutveckling, medan exempelvisprojekt med syfte att ta tillvara ungdomarserfarenheter och synpunkter saknasnästan helt. Sett ur ett barnrättsperspektivär detta naturligtvis oroande. Specialidrottsförbundenhar varit framgångsrikanär det gäller att utveckla metoder ochadministrativa rutiner för att distribueramedel till projekt i föreningarna. Metodernaför uppföljning och kontroll harockså utvecklats över tid, men föreningarnasfrihetsgrader förblir trots det fortsatthöga. Strategier och metoder för att stöttaarbetet i föreningar som beviljats medelför projekt saknas i samtliga SF. Mål förjämställdhet och jämlikhet finns i derasutvecklingsplaner, men det är sämre ställtnär det gäller strategier och metoder förhur målen ska uppnås. Sammantagetindikerar resultaten att Idrottslyftet haftliten betydelse för en ökad jämställdhetoch än mindre för en ökad jämlikhet i destuderade förbunden.Utvärderingen visar att staten har ettstort förtroende för idrottsrörelsensförmåga att förvalta och utveckla sinverksamhet mot ökad tillgänglighet,delaktighet och medbestämmande för allasamhällsmedborgare. När vi följt kedjanfrån regeringen till RF och vidare tillspecialidrottsförbunden och föreningarnahar vi kunnat se att det finns en lågstyrningsgrad, och att det ges en högfrihetsgrad, från den närmast högre nivåntill den underliggande. Det för med sig attidrottsrörelsen inte till fullo tar tillvaraden potential som finns inom Idrottslyftetför utveckling och förändring. Den lågastyrnings- och den höga frihetsgradenbidrar till att centrala och strategiskasatsningar på för idrotten kända problemområdeninte blir av. Vi åsyftar sådantsom snedrekrytering av utövare ochledare från olika sociala skikt, oförmågaatt locka nya grupper, avhopp i tidigaåldrar, bristande förståelse för fair playoch idrottsmoral, brister när det gäller atterbjuda trygga sociala miljöer, svagtradition att efterfråga och ta tillvara barnoch ungdomars synpunkter och erfarenheter.Trots goda ambitioner, både blandförbunden och i de föreningar somgenomför projekt, blir därför vår slutsatsatt Idrottslyftet bidragit till att stärkaordinarie verksamhet mer än att vara enmotor för kvalitativa språng i föreningarsarbete med att utveckla en verksamhet föralla barn och ungdomar som vill idrotta.Referenser1. För en utförlig redogörelseav utvärderingens utgångspunkter,metod, resultat samtåberopade referenser hänvisarvi till utvärderingsrapportenSpecialidrottsförbunden ochIdrottslyftet. Extern utvärderingav Budo & Kampsportförbundet,Gymnastikförbundet, Handikappidrottsförbundet,Innebandyförbundetoch Skidförbundet.Karp, Eliasson, Fahlén, Löfgren& Wickman.Kontaktstaffan.karp@pedag.umu.seinger.eliasson@pedag.umu.sejosef.fahlen@pedag.umu.sekent.lofgren@pedag.umu.sekim.wickman@pedag.umu.se1/2012 svensk idrottsforskning 45


GYMNASTIK- OCH IDROTTSHÖGSKOLANS UTVÄRDERING AV: BADMINTON-, BORDTENNIS-, FOTBOLL- OCH VOLLEYBOLLFÖRBUNDETIdrottslyftet lyfter vad då?Om målet med Idrottslyftet är att göra skillnad i någon djuparemening, kan då RF utforma satsningen på det sätt som de nu gjort?Vilka ska dörrarna öppnas för? Vad menas med att allt arbete ska utgåfrån ett jämställdhets- och jämlikhetsperspektiv?Matthis Kempe-BergmanDoktorandGymnastik- och idrottshögskolanHåkan LarssonProfessor i pedagogikGymnastik- och idrottshögskolanKarin RedeliusDocentGymnastik- och idrottshögskolanG y m n a s t i k - o c h i d r o t t s h ö g s k o l a n suppföljningsarbete har riktats motidrottslyftssatsningar inom badminton,bordtennis, fotboll och volleyboll. Denövergripande forskningsfrågan utarbetadesi dialog med representanter för de fyraförbunden och lyder: Vad innebär Idrottslyftetnär förbunds- och föreningsrepresentanterbeskriver satsningen och dekonkreta projekt som satsningen resulterati? I fokus står hur man tolkat ochförverkligat intentionerna med Idrottslyfteti de fyra idrotterna, det vill säga hurman har sett på och arbetat med ”attöppna dörrarna för fler barn och ungdomaroch utveckla verksamheten så att flerväljer att idrotta längre”. Vi har ocksåintresserat oss för vad riktlinjerna ”alltarbete ska utgå från ett jämställdhets- ochjämlikhetsperspektiv” samt ”allt arbete …ska genomsyras av riktlinjerna i Idrottenvill” har inneburit i de olika idrotterna.Utvärderingens fokus▼▼Några utgångspunkterI uppföljningsarbetet har vi använt oss avett så kallat läroplansteoretiskt ramverk,där förhållandet mellan läroplanens mål(för skolan) och undervisningens utfallstår i centrum. Med hjälp av en läroplansteoretiskansats är det möjligt att nåkunskap om hur läroplaner blir till ochförverkligas (1). I vår uppföljning motsvarasläroplanen av Idrottslyftets intentioner.Inom läroplansteorin talar man omtre arenor där läroplaner (Idrottslyftetsintentioner) skapas och omskapas: formuleringsarenan,transformeringsarenanoch realiseringsarenan. Nedanståendeskiss ger en översiktlig bild av läroplansteorinsplats i uppföljningen (Figur 1).Intervjuer och föreningsbesökUppföljningen bygger på dokumentanalyser,på föreningsbesök (totalt 18 stycken),samt på intervjuer (totalt har 52 personerintervjuats, 44 män och åtta kvinnor). Vihar intervjuat 20 representanter förspecialförbunden (SF) och distriktsförbunden(DF) samt 32 föreningsrepresentanter.Vad gäller intervjuerna på transformeringsarenan(SF, DF) identifieradevi, tillsammans med specialidrottsförbunden,fyra personer på strategiskt viktigapositioner vid respektive förbund. Pårealiseringsarenan valdes, med specialförbundenshjälp, fyra eller fem föreningar irespektive idrott ut för besök. I sambandmed varje besök intervjuades två perso-Regeringen, RFSpecialidrottsförbundDistriktsförbundFöreningFormuleringsarenaTransformeringssarenaRealiseringsarenaFigur 1. Översiktlig bild av läroplansteorins plats i uppföljningen.46 svensk idrottsforskning 1/2012


ner, vanligen ordföranden samt entränare. Förbunds- och föreningsintervjuernaskiljde sig åt i vissa avseenden, mensex intervjuteman återkom:• Allmänna reflektioner kring Idrottslyftet.• Idrottslyftets inriktning och handläggning.• Hur förbundet/föreningen tänkt kringoch arbetat med att öppna dörrarnaför fler.• Hur förbundet/föreningen tänkt kringoch arbetat med att få fler att idrottalängre.• Jämställdhet och jämlikhet.• Riktlinjerna i RF:s idédokumentIdrotten vill.Öppna dörrarna – inte så lätt”Att öppna dörrarna för fler” översättsofta med att exponera den egna idrottenför fler barn och unga. På realiseringsarenanhandlar detta om att föreningar gördirekta rekryteringsinsatser – de ser tillatt barn och unga på något sätt kommer ikontakt med idrotten ifråga. Tanken är attexponering leder till rekrytering. Undantagetär fotbollen, där nyrekryteringsfrågornainte ses som särskilt problematiska,och heller inte som lika viktiga.Att öppna dörrarna tolkas också somatt inte säga nej till någon: ”Alla får varamed i vår förening, så vad är problemet?”Att det finns grupper som inte är representeradeeller inte intresserade av attvara med ses sällan som föreningens (ellerförbundets) bekymmer. Dörren är juöppen. Om det finns ett problem så liggerdet hos dem som inte är där, snarare än iden verksamhet föreningen bedriver. Omföreningen (eller förbundet) ifråga harmedlemsgrupper som är homogena inågon mening ifrågasätts eller problematiserasdet sällan.Vid en första anblick kan ”öppnadörrarna för fler” ses som en relativtokomplicerad ambition. Eftersom så passmånga barn och ungdomar någon gångunder sin uppväxttid deltar i en föreningsverksamheter kan man väl utgå från attidrottens dörrar i grund och botten ståröppna, kanske till och med på vid gavel?Med vårt material i förgrunden är dockambitionen att öppna dörrarna mersvårdefinierad än så. På en mycketövergripande nivå kan man, för det första,tänka sig att ambitionen handlar om attöppna dörrarna för fler barn och ungdomartill idrottsrörelsen. Med dennatolkning handlar Idrottslyftet om ensträvan efter att nå de barn och ungdomarsom inte idrottar. Tolkningen är rimligutifrån ett nationellt folkhälsoperspektivoch finns möjligen i bakhuvudet hos depolitiker på det nationella planet somhyser förhoppningar om att idrottsrörelsenska ”lösa” samhällets folkhälsoproblem.Sett ur specialförbundens perspektivhandlar ambitionen istället, för detandra, om att öppna dörrarna till denegna idrotten. Här handlar det om att nåde barn och ungdomar som redan idrottar,men som inte deltar i den idrott somförbundet ifråga vill att de ska delta i.Utvärderingen påvisar att förbunden, i sinsträvan efter att växa, inte sällan ser sigsjälva och andra förbund som konkurrenterom ett visst antal barn och ungdomar– de som vill hålla på med idrott så somden vanligen är utformad. Sett ur föreningarnasperspektiv handlar ambitionen,för det tredje, om att öppna dörrarna förfler barn och ungdomar till den egnaföreningen.Sammanfattningsvis kan vi konstateraatt ju närmare föreningarnas verksamheterman kommer, desto mer svårbegripligter sig ambitionen att öppna dörrarna.Alla föreningar vi besökt vill utöka sittmedlemsantal. Ambitionen med Idrottslyftetskulle bli mer begriplig och hanterbarför föreningar och förbund om detfanns åtminstone en eller några övergripandeuttolkningar av vad ”öppna dörrarna”kan tänkas innebära.Få fler att idrotta längreNär intentionen ”att få fler att idrottalängre” ska transformeras och realiseras ide olika idrotterna sker detta på mångaolika sätt. På förbundsnivå översättsintentionen främst med att 1) breddaverksamheter för att tillfredsställa barnsoch ungdomars olika behov, 2) utvecklaoch utbilda idrottens ledarkader och 3)utveckla föreningarna, till exempelavseende deltagar- och ledarrekryteringsstrategier,värdegrundsarbete och styrelsearbete.På föreningsnivån märks en osäkerhetinför intentionen. Att ungdomar slutarBadmintonförbundetGrundat: 1936MedlemmarMän: 19 170Kvinnor: 10 200*Deltagartillfällen: 551 183BordtennisförbundetGrundat: 1926MedlemmarMän: 45 360Kvinnor: 16 182*Deltagartillfällen: 711 616FotbollförbundetGrundat: 1904LicenserMän: 222 194Kvinnor: 77 661*Deltagartillfällen: 18 186 771VolleybollförbundetGrundat: 1961LicenserMän: 3 048Kvinnor: 4 621*Deltagartillfällen: 250 1492010 års statistik.*Träning & tävling för barn 7-20 år.1/2012 svensk idrottsforskning 47


Omid Khoshbakht Spårvägens BTKfödd 1998 kan bli nästa stora svenskapingisspelare.verkar många se som en naturlig sak ochinget de direkt kan påverka; de unga fårandra intressen helt enkelt. Kunskaperoch idéer kring hur man kan göra för attfå fler att fortsätta saknas. Att avhoppsproblematikenkan sättas i samband med ivilken utsträckning den egna föreningensverksamhet förmår möta de ungas behovoch önskemål diskuteras sällan. I mångtoch mycket kan föreningarna sägasbedriva en gigantisk experimentverkstad.Experimenterandet tycks dock inte haföregåtts av en djupare diskussion runtvad som krävs av föreningen för att få flerungdomar att vilja stanna.Att ”utveckla verksamheten så att flerväljer att fortsätta längre” kan vid förstaanblicken, precis som ”öppna dörrarna”,ses som en relativt okomplicerad ambition.I våra ögon ter den sig dock än merkomplicerad. För att kunna utvecklaverksamheten så att fler väljer att fortsättalängre krävs någon sorts kunskap omvarför barn och ungdomar kommer tillföreningen, men också någon sortskunskap om varför de slutar. Mångaledare vi intervjuat ger uttryck för att deinte har den kunskapen. I förbund ochföreningar finns endast begränsadeförutsättningar att kunna avgöra om desatsningar som görs träffar rätt och äreffektiva när det gäller att få ungdomar attvilja fortsätta längre.Jämställdhet en icke-frågaI Idrottslyftets riktlinjer kan vi läsa att:”Allt arbete ska utgå från ett jämställdhets-och jämlikhetsperspektiv”. Vad hardet inneburit i de undersökta idrottslyftssatsningarna?Ett kort svar är – intemycket. Vi kan konstatera att jämställdhets-och jämlikhetsfrågorna varit någotav icke-frågor i förbundens och föreningarnasidrottslyftsarbete. Den dominerandetolkningen har inte varit att alltarbete ska utgå från ett jämställdhets- ochjämlikhetsperspektiv. Det framgår tydligt.Det innebär dock inte att jämställdhetsochjämlikhetsrelaterade projekt saknas.Badminton utmärker sig till exempel medsin ambitiösa satsning Girls of badminton.Hur översätts jämställdhetsfrågorna imaterialet (när frågorna väl aktualiseras)?Till att börja med tolkas jämställdhet,genomgående, som något enkönat – somen flick- och kvinnofråga – och inte somen fråga om styrkeförhållandet mellangruppen kvinnor och gruppen män (somär den tolkning som uttrycks i Idrottensjämställdhetsplan) (2). Ett annat dominerandemönster är att jämställdhet geskvantitativa innebörder och förstås somnågot mätbart. Jämställdhet handlar dåfrämst om: könsfördelning bland aktiva(att flickor slutar tidigare än pojkar är envanlig uppfattning, och många beklagaratt det är så); fördelning av resurser tilltjej-/dam- kontra kill-/herridrott; representationbland ledare och tränare, i olikastyrelser och bland domare; könsrättvisfördelning av träningstider; samt materi-48 svensk idrottsforskning 1/2012


alfrågor (har och får tjejer och kvinnorsamma materiella förutsättningar somkillar och män?).Jämställdhet är fortsättningsvis,åtminstone i många av intervjuerna, någotsom kommer av sig själv, eller något somhar med vanligt sunt förnuft att göra.Ibland ses jämställdhet som ovidkommande:”Det handlar väl om alla människor?””Varför ska bara kön räknas?”Ett relativt stort antal intervjupersonerger också uttryck för ganska stereotypauppfattningar om hur pojkar och flickor”är”. En dominerande och ofta oproblematiseraduppfattning är till exempel attflickor är sociala och pojkar tävlingsinriktade.Ett normkritiskt förhållningssätt,där man frågar sig hur allmängiltiga dessabilder egentligen är och varför flickor ochpojkar ”blir som de blir”, är ovanligt.Ovanliga är också funderingar kringvarför många föreningar har lika mångapojkar och flickor i barnaåren menbetydligt fler pojkar i tonåren.Vi har vidare noterat att Idrottslyftet,precis som Handslaget, rymmer relativtmånga satsningar på flickors idrott (3).Flicksatsningarna verkar dock inte manatill eftertanke kring mäns och kvinnorsvillkor inom den egna idrotten. Kanskehänger det samman med antagandet att”problemet” är flickorna och kvinnornamer än idrottens utformning. Vi tror attdet ligger en klar utvecklingspotential i attutmana denna förståelse av vad somutgör problemet. Den traditionellaambitionen att anpassa idrotten efter kön,skulle till exempel – med fördel – kunnakompletteras med en ambition att utmanatraditionella föreställningar om könen.Varför behövs tjejsatsningarna överhuvudtaget?Det har inte skapats något Boysof badminton, varför då? Vad är det iförbundens egna verksamheter som göratt pojkars och mäns deltagande intekräver samma typ av satsningar somflickors och kvinnors?Jämlikhet ett obekant begreppJämlikhet är ett i stort sett obekantbegrepp i förbunden och föreningarna.När begreppet väl aktualiseras blir detofta, för att prata idrottslyftsspråk,synonymt med att öppna dörrarna till denegna idrotten för så många som möjligt.Begreppet kopplas också samman medsärskilda satsningar på resurssvaga barnoch ungdomar (framför allt i fråga omsocial och etnisk bakgrund samt funktionshinder).Vi kan konstatera att RF har en jämställdhetsplanoch att Idrotten vill äridrottsrörelsens gemensamma idéprogram.Samtidigt är jämlikhet ett begreppsom normalt sett inte ingår i RF:s terminologi.Att förbunds- och föreningsrepresentanternaär osäkra och ambivalentainför jämlikhetsbegreppet är därför inteså konstigt. Man kan tänka sig att jämlikhetgår att relatera till den avsiktsförklaringi Idrotten vill som framhåller att ”allasom vill, oavsett nationalitet, etnisktursprung, religion, ålder, kön eller sexuellläggning samt fysiska eller psykiskaförutsättningar, får vara med i föreningsdrivenidrottsverksamhet” (4). Man kanockså tänka sig att jämlikhetsfrågor kanrelateras såväl till ambitionen att öppnadörrarna för fler som till ambitionen att fåfler att fortsätta längre. En annan potentielljämlikhetsfråga som kan kopplassamman med Idrottslyftets riktlinjer, mensom lyser med sin frånvaro i vårt material,gäller homosexuella, bisexuella ochtranspersoners villkor inom idrotten.Erbjuder förbund och föreningar envälkomnande och inkluderande atmosfärför hbt-personer? Problemet är att mycketfå av de som vi har mött under utvärderingengör kopplingarna ovan. Att det iden kortfattade formuleringen av Idrottslyftetsintentioner dyker upp ett begreppsom inte är känt inom idrottsrörelsenföranleder inte någon undran blandidrottens företrädare. Det är en tänkvärdproblematik.Avslutningsvis kan vi konstatera attjämlikhet och jämställdhet ofta tenderaratt flyta ihop i vårt material. Begreppenkokas ner till att handla om ”vanligt suntförnuft” eller till ett oproblematisktkonstaterande att ”alla är välkomna”.Idrotten vill – osynlig och synligOm man ser till andemeningen i Idrottenvill, och inte bara till skriften, kan vikonstatera att de fyra idrotternas idrottslyftsarbetedelvis genomsyrats av riktlinjernai programmet. Innehållet går oftaigen i vårt material, åtminstone mellanraderna. Samtidigt har dokumentet intepå något konkret sätt legat till grund förFörslag till RF och specialidrottsförbundenRF:• Ta ställning till om syftetmed satsningar av typenIdrottslyftet är att göraskillnad eller att stimuleratill mer verksamhet medbefintlig inriktning.• Beakta att den idrottsrörelsesom ska realiserasatsningen i dagsläget intehar ett aktivt förhållningssätttill begrepp somjämställdhet och jämlikhet,och inte heller till idrottensövergripande idéprogramIdrotten vill.Specialidrottsförbunden:• Lägg ner möda på att göraen uttömmande tolkning avuppdraget.• För ett öppet samtal kring,och öka kunskapen om,kritiska frågor inom denegna idrotten. T.ex. vilkaunga som hittar till idrotten,vilka som fortsätter, vilkasom hoppar av, hurkönsfördelningen ser ut,samt i vilken utsträckningbarn med annan kulturellbakgrund än svensk deltar.• Ta ställning till vad begreppsom jämställdhet ochjämlikhet och idéprogrammetIdrotten vill skainnebära för förbundet.• Använd idrottens måldokumentoch handlingsplaner(t.ex. Idrotten vill ochIdrottens jämställdhetsplan)aktivt i kommunikationenmed föreningar ochindivider.1/2012 svensk idrottsforskning 49


Referenser1. Vår användning av läroplansteorinbygger i stor utsträckning påframställningen i Göran Lindesbok Det ska ni veta! En introduktioni läroplansteori. 2006.2. Idrottens jämställdhetsplan.www.rf.se. 9 september 2011.3. Svender, J. & Larsson, H. Somhand i handsken – en satsning påflickors idrott eller på idrottensflickor? Riksidrottsförbundet,FoU-rapport nr. 2007:12.4. Idrotten vill. www.rf.se. 1 september2011. s. 4.Kontaktmatthis.kempe-bergman@gih.sehakan.larsson@gih.sekarin.redelius@gih.seutformningen av Idrottslyftets inriktning ide olika förbunden, varken vid bedömningenav projektansökningar eller vidutformningen av satsningar på föreningsnivå.Fotbollen skiljer ut sig en aning.Fotbollens spela, lek och lär, som delvisersatt Idrotten vill inom fotbollen, haranvänts på ett relativt aktivt sätt påförbundsnivå och var allmänt känd i deföreningar vi besökte.Frånvaron av referenser till och merspecifik kännedom om innehållet iIdrotten vill kan möjligtvis kopplas till enuppfattning som framkommer hos någraintervjupersoner, nämligen att man inomidrottsrörelsen sällan diskuterar ”de storafrågorna” (till exempel idrottens värdegrundsfrågor).Nytänkande eller mer av samma?Under vårt uppföljningsarbete har vislagits av hur sparsmakade riktlinjerna förIdrottslyftet är på den översta nivån isystemet, det vill säga RF- och regeringsnivån.Vi har inte kunnat finna några merfylliga anvisningar till specialidrottsförbundenangående vad det skulle kunnatänkas innebära att följa Idrottslyftetsintentioner och riktlinjer. Hur ska manförstå dem? Möjligen kan man tänka sigOm barns rättigheter i idrotten:För barnets bästa– en antologi om idrott ur ett barnrättsperspektivLäs om internationellforskning, selektion, synenpå tävlan, kön, funktionsnedsättning,behov av fysiskaktivitet, hälsorisker, rättenatt uttrycka sina åsikter ochbli lyssnad på, rätten tillfritid och om barnkonventionensmöjligheter.att innehållet i formuleringarna (av RF)ses som så pass självklart att det intebehöver ges någon mer uttömmandetolkning. De mycket sparsmakade anvisningarnafår dock, menar vi, problematiskakonsekvenser. Vi har besökt fleraföreningar med ett stort socialt patos, därman till exempel gjort idrottslyftssatsningari socialt utsatta områden, storasatsningar på tjejers idrott, där manöppnat upp verksamheten för barn medfunktionsnedsättning och så vidare. Mensatsningarna har inte skett utifrån någonnationellt förankrad idrottsövergripandestrategi, utan mer efter lokala initiativ.Ambitionsnivån här och nu har varit hög,men de mer långsiktiga ambitionerna harsaknats. I samtliga idrotter framhålls dockbetydelsen av Idrottslyftet; att det är enviktig satsning som gör skillnad. I vårtolkning har detta att göra med att de(oprecisa) idrottslyftsmålen faller väl in iden verksamhetsutveckling som föreningarna(och även förbunden i viss utsträckning)ändå ser som sin uppgift. I vårtmaterial råder ingen konflikt mellan vadföreningarna och förbunden åtar sig attgöra genom att erhålla idrottslyftsstöd ochvad de i vanliga fall ändå arbetar med(eller vill och känner att de borde arbetamed om de hade resurser). De vidatolkningsramarna gör att förbunden harrelativt fria händer att utforma satsningenså som de önskar. Det är ett resultat somär värt att begrunda.Om man från statens och RF:s sida ärnöjda med den befintliga verksamhetenoch vill ge den extra resurser via satsningarsom Idrottslyftet, om man vill attverksamheten ska leva vidare i nuvarandeskepnad, då räcker det naturligtvis medatt göra som nu – ge mycket kortfattadeoch allmänna anvisningar. Om man frånstatens och RF:s sida däremot har ambitionenatt satsningar av Idrottslyftets slagska betyda något särskilt, att satsningenska leda till en djupare och beståendeförändring i något avseende, behöverförbund och föreningar mer handfastvägledning i hur de ska arbeta och vadarbetet ska leda till.Beställ på:www.idrottsbokhandeln.se50 svensk idrottsforskning 1/2012För barnets bästaEn antologi om idrottur Ett barnrättspErspEktiv


MALMÖ HÖGSKOLAS UTVÄRDERING AV: KLÄTTER-, ORIENTERING-, RIDSPORT-, SIM- OCH TAEKWONDOFÖRBUNDETFler stannar menfärre börjar?Idrottslyftet har allt mer blivit en del av förbundens ordinarie verksamhet.Satsningen har öppnat dörrarna för fler, men få har klivit övertröskeln. En stor del av medlen har hamnat i stora idrotter och hos desocioekonomiskt välmående i tätbefolkade kommuner.Susanna HedenborgProfessor i idrottsvetenskapMalmö högskolaI d e n h ä r a r t i k e l n diskuterar vigenerella iakttagelser av Idrottslyftetutifrån Idrottsstödsutredningens slutsatserom Handslaget (1). Vi gör en kvalitativbedömning utifrån erfarenheterna frånvåra fem förbundsvisa utvärderingar(Klätter-, Orientering-, Ridsport-, Sim ochTaekwondoförbundet) men också utifrånkunskap om andra förbund, från andrautvärderare och från i sammanhangetrelevanta nyckelpersoner inom idrottsrörelsen.RF är mer intresserade av kvalitativadata än kvantitativa, eftersom dekvantitativa uppgifterna ändå kommer invia projektrapporteringen. Här följersåledes ett försök att tolka och karakteriseraett antal iakttagelser som vi bedömerär generella för idrottsrörelsens idrottslyftsarbete.En del av ordinarie verksamhetEn tillfällig verksamhet går nu in på sittnionde år. Redan detta enkla konstateranderymmer en rad förutsättningar somhar satt sin prägel på idrottslyftsverksamheten.Förbunden betraktar Idrottslyftetsom en tidsbegränsad verksamhet somallt mer permanentas. De ser det ocksåsom ett styrinstrument för sina föreningar.Föreningarna förhåller sig tillprojektformens tidsbegränsade karaktärsamt projektens konsekvenser för denordinarie verksamheten.Fortfarande innebär detta inte attidrottslyftsarbetet har blivit en del avförbundens ordinarie verksamhet, eftersomsatsningen dels är av tillfällig karaktäroch dels ska kunna innehålla sådanverksamhet som inte tidigare räknadessom ordinarie verksamhet. Men vare sigman har förädlat framgångsrika handslagsprojekt,eller gjort nya satsningarsom visat sig nödvändiga via Handslaget,har de fyra idrottslyftsåren inneburit enrutinisering av arbetet.De flesta förbund har skapat en idrottslyftsorganisationsom bygger vidare på desom fanns under Handslaget. Det är i höggrad samma människor som gör sammabedömningar av projektidéer som degjorde i Handslaget. Här kommer skillnadernamellan förbunden in. I mångaförbund sköts arbetet av en tjänsteman/kvinna, som arbetar självständigt utifrånövergripande policybeslut från förbundsstyrelsen.De större förbunden har fler änen person som arbetar med Idrottslyftet,de minsta förbunden har knappt en. Dettaär en del av en mer generell fördelningsproblematik.Ju större förbund och ju merresurser, desto mer omfattande idrottslyftsarbete.Det har också sin motsvarighetpå lokal nivå – ju större förening, jumer administrativt lönearbete och ju flervälutbildade medlemmar, desto fler ochbättre ansökningar. Det här ger skillnadermellan förbunden, men också mellanföreningarna i de olika förbunden.Den utgångspunkt för Handslaget somförenade idrottsrörelsen och det politiskasystemet (regering och riksdag) var attförsöka nå barn och ungdomar mellan7-20 år som inte redan var aktiva idrottare.Ungefär 60-70 procent av alla barnoch ungdomar var kring sekelskiftet,liksom i dag, aktiva i en idrottsförening.Förklaringarna till att resten inte varaktiva varierar, alltifrån att de aldrigKalle JonassonDoktorand i idrottsvetenskapMalmö högskolaTomas PetersonProfessor i idrottsvetenskapMalmö högskolaKatarina SchenkerFil.dr. i idrottsvetenskapMalmö högskolaHelena TolvhedFil. dr.Historiska InstitutionenStockholms universitet1/2012 svensk idrottsforskning 51


RidsportförbundetGrundat: 1912MedlemmarMän: 16 073Kvinnor: 150 369*Deltagartillfällen: 3 023 765KlätterförbundetGrundat: 1973MedlemmarMän: 4 142Kvinnor: 2 130*Deltagartillfällen: 19 866OrienteringförbundetGrundat: 1938MedlemmarMän: 53 563Kvinnor: 38 787*Deltagartillfällen: 338 126SimförbundetGrundat: 1904MedlemmarMän: 56 537Kvinnor: 61 773*Deltagartillfällen: 1 978 407TaekwondoförbundetGrundat: 1996MedlemmarMän: 6 136Kvinnor: 3 030*Deltagartillfällen: 460 6512010 års statistik.*Träning & tävling för barn 7-20 år.kommit i kontakt med föreningsidrottentill att de hade provat och sedan lämnat.Recepten för att aktivera flera, eller”öppna dörrarna för flera”, innehöll därförallt ifrån traditionell prova på-verksamheti skolorna till utvecklandet av nya verksamhetsformer,vilka inte tidigare ingått iföreningarnas verksamhet. Det som frånbörjan därmed i betydande utsträckningvar en försöksverksamhet, där man bådeorganisatoriskt och innehållsmässigt lättusen blommor blomma och provadesåväl nya idéer som gränserna för vad somvar möjligt och önskvärt, har efter åtta årav Handslag och Idrottslyft alltmerfångats in i organisationernas ordinarielogik och verksamhet. Det gäller på såvälförenings- distrikts- som förbundsnivå.Idrottslyftshandläggarna, som ofta harvarit med om hela eller större delen avresan, har skapat rutiner för alla led iarbetet och har i viss mån professionaliserats– både via hands-on-kunskapen, viautbildningar och i möten med andraidrottslyftshandläggare. De kan i i dagtämligen väl både bedöma ansökningarnasinnehåll (samt värdesätta dem ikronor) och kapaciteten hos dem som stårsom projektansvariga. Liksom de flestaprojektansvariga på lokal nivå vet de vadsom fungerar. Dessa kunskaper, på bådelokal och central nivå, trycker dels mot detsom allt oftare börjar dyka upp i förbundensarsenal som ”paket”, dels mot detsom kallas ”projektslentrian”, det vill sägaatt man skickar in samma ansökan varjeår. Paketen kan ses som centralt utformadelösningar vilka kan fungera i allaföreningar och distrikt. Innehållet ärsådant som förbundet anser värdefullt föridrottsgrenens utveckling.Tanken bakom att skapa paket är inte iförsta hand att uppmuntra till experimentmed nya verksamhetsformer för att fångaupp barn och ungdomar vilka inte redanär medlemmar i idrottsrörelsen. Snararehandlar det om förbunds- förenings- ochmedlemsutveckling i vid mening, verksamhetsom ändå skulle bli genomförd,om inte Idrottslyftet hade kommit, omdärtill medel hade funnits. Den normerandeaspekten ligger dels i att det ärförbundet som har formulerat innehållet,dels i att en ansökan om ett paket inte kanförväntas bli avslagen. Den här utvecklingenhar förstärkts av att det i Idrottslyf-tet, till skillnad från i Handslaget, finnsavsatt betydande resurser för förbundsutveckling.När Handslaget konstruerades fanns entydlig betoning från statens sida av att allapengar skulle gå till föreningarna och(nästan) inga till förbunden. Föreningarnaskulle i sin tur uppmuntras till attutveckla nya verksamhetsformer. Det kantolkas som ett försök från statsmakternassida (mer eller mindre bejakat av förbunden)att bidra till förändring och utvecklingav idrottsverksamhet utifrån ettnerifrån och upp-perspektiv. Ett annatsätt att formulera den första övergripandeslutsatsen är att efter åtta år av Handslagoch Idrottslyft har rutiniseringen, professionaliseringenoch normeringen gradvisövergått till att styras av ett uppifrån ochner-perspektiv.Rekrytera eller behålla?Parollen att ”få fler att stanna kvar” fannsinte med bland de fem teman som Handslagetutgick ifrån, men växte fram inomrörelsen i slutet av handslagsperioden,förmodligen delvis som en reaktion motatt arbetet med att ”öppna dörrarna förfler” inte visade sig så framgångsrikt(föreningarna fick inte fler medlemmar).Å andra sidan var detta med att aktiveradem som inte redan var aktiva det centralainslaget i handslagskonstruktionen.När idrottsrörelsen själv fick bestämmainnehållet i Idrottslyftet blev kombinationenav att rekrytera och att behålla iställetutgångspunkten för arbetet. UnderIdrottslyftet har betoningen sedan förskjutitsännu mer mot behållaperspektivet.Härtill finns en rad förklarandefaktorer. Organisationsteoretiskt tenderarreproduktion av befintlig verksamhetoftast segra över förändring, inte minstnär förändring innebär kritik av denbefintliga verksamheten. Förändringsprocessersom är djupgående tenderar attgenomföras under kort tid, ju längre tidengår desto mindre djupgående blir förändringenoch ju mer tenderar den att kunnainordnas i den tidigare ordinarie verksamheten.Skälen till att barn och ungdomar inteär aktiva i föreningsidrotten är många.Idrottsföreningar är vana vid att erbjudasin idrott till alla, men endast vana vid attta hand om dem som sedan kommer52 svensk idrottsforskning 1/2012


frivilligt. Handslaget och Idrottslyftet harhandlat om ”de andra” – de som inte ärintresserade, de som aktivt tar avståndfrån att delta i föreningsidrotten, de somav olika skäl inte kan och de som harprovat men slutat. Från rekryteringen tillhögre utbildning vet vi att när ambitionenär att rekrytera nya, ofta studieovanagrupper, krävs det större resurser ochansträngningar för att lyckas. Beredskapenför att handskas med denna problematikkan generellt sett antas vara låg iföreningarna, med de starkt normativavärderingar som den befintliga verksamhetengrundas på. Nya verksamhetsformerkan på föreningsnivå dessutom sesbåde som en möjlighet, men också som etthot mot den traditionella verksamheten.För om ett idrottslyftsprojekt som tillämparnya verksamhetsformer blir framgångsriktoch aktiverar en grupp barneller ungdomar som tidigare inte varitföreningsaktiva, återstår sedan frågan omvad som händer när projektet tar slut.Tre scenarier verkar här vara möjligaoch vanliga. Det första är att projektet(och projektpengarna) tar slut, ochdärmed tar också aktiviteten slut. Sannolikhetenär då stor att de aktiva slutar, detvill säga de inte ser den ordinarie verksamhetensom ett alternativ. Det andra äratt föreningen permanentar projektverksamhetensom en del av den ordinarieverksamheten, man bygger helt enkelt utföreningens verksamhet. Det tredje är attprojektverksamheten växer in i ochförändrar den traditionella verksamheten.Det sistnämnda finns det tämligen fåexempel på inom Handslaget och Idrottslyftet.Här uppstår på föreningsnivåsamma problematik som Handslaget ochIdrottslyftet hela tiden har utgjort för helaidrottsrörelsen, från föreningsnivå ochupp på RF-nivå. I grunden handlar det omatt svensk idrottsrörelse fångar upp enmajoritet av varje årgång flickor ochpojkar med sin verksamhet. De flesta sominte fångas upp säger nej tack till verksamhetenjust eftersom den ser ut somden gör.Den ser ut som den gör av både internaoch externa skäl. De interna skälenhandlar om den verksamhet som bedrivs.Den kan hålla barn och ungdomar ifrånsig av många skäl. I många idrottsgrenarmåste man börja mycket tidigt för atthänga med. De som startar senare slutaroftare och tidigare. Företeelser somselektion, rangordning och utslagning,nivågruppering och tidig specialisering,föräldra- och ledarpress etcetera känner visom skäl till att flickor och pojkar lämnaridrotten i unga år, emellanåt även omman faktiskt vill stanna kvar. Mångaslutar eftersom de vill prioritera andraintressen än idrotten. Många idrotterkräver ett föräldraengagemang somkanske inte finns och så vidare.De externa skälen är de som samhälletskapar genom de djupgående strukturellafaktorer som delar upp samhällsmedborgarnai olika grupper och där de olikagrupperna förhåller sig till idrottsaktivitetpå olika sätt (kön, social klass, etnisktbakgrund, religiös tillhörighet, sexuellläggning och biologisk ålder). Det ärdärför som många idrottsgrenar i praktikenär stängda för exempelvis barn till enensamstående, lågutbildad, arbetslösflerbarnsmamma med utländsk bakgrund.De förändringar av den ordinarieverksamheten som skulle krävas för attöppna dörrarna för alla, och sedan kunnabehålla dem, kan lätt uppfattas som att deinkräktar på verksamhetens själ. Sammaeffekt kan uppstå om en ordinarie verksamhetska anpassas till konsekvenser avde yttre skälen. Ofta samverkar också inreoch yttre faktorer till att göra det svårt fören förening att rekrytera och behållaockså den sista procenten.Antalet aktiva har minskatMålsättningen med Idrottslyftet var att fåfler barn och ungdomar att börja idrottaoch att fler ungdomar ska välja att idrottalängre upp i åldrarna. Baserat på statistiktillgänglig på RF:s hemsida över deltagartillfällenför år 2002-2010 kan mankonstatera att de tre miljarder som statengett till idrottsrörelsen inte på ett övergripandeplan har resulterat i en ökning avantalet LOK-stödsberättigade deltagartillfällen.Gruppen 7-20 år i Sverige harenligt SCB:s statistik minskat med3 procent under åren 2002-2010. AntaletLOK-stödsberättigade deltagartillfälleninom idrottsrörelsen har, enligt enuträkning baserad på RF:s statistik, undersamma period minskat med 6,4 procent(2). (Figur 1)Klätterförbundet och Taekwondoför-SLUTSATSER• Idrottslyftet har alltmer – viaen rutinisering, professionaliseringoch normering – bliviten del av förbundensordinarie verksamhet. Ju merden blir det, desto mer bliren utvärdering av Idrottslyftetäven en utvärdering avden ordinarie verksamheten.• Idrottslyftet har öppnatdörrarna för fler. Menbarn- och ungdomsidrottenhar inte fått fler medlemmarunder de åtta åren medHandslaget och Idrottslyftet.Tillgänglig statistik tydersnarare på att aktiviteten ochantalet aktiva har minskat. Åandra sidan tyder tillgängligkunskap på att idrotten harlyckats behålla flera än deskulle ha gjort utan Idrottslyftet.• RF har i större utsträckningagerat styrande med blandannat utvecklingsplaner ochett centralt och mernormerande återrapporteringssystem.Idrottslyftet harinneburit att förbunden ihögre grad har fått värna omsin självständighet. Detinnebär att förbundens målmed Idrottslyftet tenderaratt knytas allt närmare måleni förbundens strategiskautvecklingsplaner. RF:sfördelningspolitiska principerhar fått samma effekter somunder Handslaget. En storandel av medlen har hamnati stora barn- och ungdomsidrotter,samt i tätbefolkadeoch socioekonomisktvälmående sammanhang.1/2012 svensk idrottsforskning 53


Referenser1. SOU 2008:59.2. RF:s statistik, utbetalt LOKstöd:deltagaretillfällen tidsserie2002-2010 (2012-01-01)3. SCB:s befolkningsregister.4. Åkesson, J. Var hamnadehandslagspengarna? ”Stor” blevstörre och ”liten” kunde intehänga med. 2007.5. Åkesson, J & Norberg, J. R.Den fungerade föreningen. Enutvärdering av Idrottslyftet. Omidrottsföreningars förutsättningaratt ta del av den idrottspolitiskasatsningen Idrottslyftet(kommande). (2012).Kontaktsusanna.hedenborg@mah.sekalle.jonasson@mah.setomas.peterson@mah.sekatarina.schenker@mah.sehelena.tolvhed@historia.su.se3,50 3,00 2,50 2,00 1,50 1,00 0,50 0,00 54 svensk idrottsforskning 1/2012bundet kan redovisa en positiv utvecklingsedan år 2003, det vill säga att en positivtrend startade när Handslaget startade.Ridsportförbundet, Orienteringsförbundetoch Simförbundet har vikande siffrorför samma period, även om Orienteringsförbundetredovisar en uppgång för år2008 och Simförbundet redovisar enuppgång för år 2009. Totalt sett har intefler börjat idrotta på grund av Idrottslyftet,även om antalet deltagartillfällen harökat inom Klätterförbundet och Taekwondoförbundet.Att föreningarna har lyckatsbehålla fler genom Idrottslyftet berorförmodligen på att en allt större del avprojekten har haft en förenings- ochmedlemsutvecklande inriktning. Störreresurser har kunnat läggas på träningsochtävlingsutveckling, ledarskapsutbildning,redskaps- och anläggningsförbättringliksom på sociala aktiviteter kringträning och tävling.Mest stöd till välmåendeDe specialidrottsförbund som vi harutvärderat har under åren förfinat sinadministration och hantering av idrottslyftsansökningar.Varje förbund har dockhaft sina rutiner. Införandet av RF:ssystem IdrottOnline Klubb, har medförten styrning och normering, samtidigt somdet har medfört tekniska och administrativaproblem. Alla förbund har numeratillgång till samma typ av uppgifter frånföreningarna, så även RF. Ett annat2002 2003 2004 2005 2006 2007 2008 2009 2010 -./0ring Orientering Ridsport Simning Taekwondo Tot RF Tot SE Sverige Figur 1. Förändring av antalet LOK-stödsberättigade deltagartillfällen mellan 2002-2010 i ett antalspecialidrottsförbund samt för hela RF. 1 motsvarar respektive förbunds antal deltagartillfällen år1. Förändring 2002. Statistiken av antalet för Sverige LOK-stödsberättigade bygger på SCB:s befolkningsregister deltagartillfällen (7-20-åringar) mellan och 2002-2010 är även den i ett antallidrottsförbund standardiserad samt till 1 för hela år 2002 RF. (3). 1 motsvarar respektive förbunds antal deltagartillfällen årStatistiken för Sverige bygger på SCB:s befolkningsregister (7-20-åringar) och är även denrdiserad till 1 för år 2002 (3). problem handlar om oönskade effekter avRF:s princip att fördela handslagsmedeltill specialidrottsförbunden utifrån derasrelativa storlek. Resultatet blev nämligeninte enbart att de stora idrotterna fick bästförutsättningar för att locka till sig ännufler. Följden blev även att handslagspengarnai huvudsak kanaliserades till detrelativt välmående idrottslivet i mervälbeställda kommuner (4). Syftet medHandslaget var att ”öppna dörrarna förfler”. Bäst förutsättningar gavs dockföreningar inom: a) idrotter som redanvarit lyckosamma med att locka till sigmånga barn och ungdomar, b) tätbefolkadekommuner där idrottsutbudet redanvar omfattande och varierat c) socioekonomisktvälmående sammanhang därbarn och ungdomars aktivering inomidrotten redan var hög (5).Stora förbund har fått mest Idrottslyftsmedel.Detta har dock inte alltid inneburitatt stora förbund har ökat sina LOKstödsberättigadedeltagartillfällen.Tvärtom visar statistiken att flera storaförbund har ett minskat antal sådanatillfällen. Bland de 12 förbund med flestLOK-stödsberättigade deltagartillfällen år2002 har Basketförbundet, Innebandyförbundetoch Tennisförbundet ökat i antaletdeltagartillfällen sedan dess, det vill sägaåret innan Handslaget startade. Baskethar dock haft en negativ trend sedan år2004. Om man kompenserar för nedgångeni de aktuella barnkullarna haräven Friidrottsförbundet och Fotbollsförbundetökat något, även om det i detsenare fallet är marginellt. Faktumkvarstår att Idrottslyftsmedel har kanaliseratstill det välmående idrottslivet. Enstudie av Joakim Åkesson och JohanNorberg vid Malmö högskola visar att enstor andel av Idrottslyftsmedlen hamnat istora barn- och ungdomsidrotter, samt itätbefolkade och socioekonomiskt välmåendekontexter (läs mer på sid. 5 i den härtidningen). Frågan är i vilken form dessamedel sedan har nått barn- och ungdomar.Inte heller kan man dra slutsatsenatt små förbund generellt har haft positivautvecklingstrender under Idrottslyftsåren.Några har haft stabila utvecklingstrender,exempelvis Triathlonförbundet, Klätterförbundetoch Dövidrottsförbundet,medan andra inte har haft det.


LINNÉUNIVERSITETETS UTVÄRDERING AV: DANSSPORT-, FRIIDROTTS-, GOLF-, ISHOCKEY- OCH KONSTÅKNINGSFÖRBUNDETEtt lyft undervarierande villkorFörbund och föreningar är positiva till Idrottslyftet, även om villkorenhar sett olika ut. Fler har börjat idrotta och verksamheten utvecklas,vilket ger förhoppningar om att fler fortsätter inom idrotten. Mendeltagarmönstren har inte förändrats.L i n n é u n i v e r s i t e t e t har haft förmånenatt granska den verksamhet inom Idrottslyftetsom Danssportförbundet, Friidrottsförbundet,Golfförbundet, Ishockeyförbundetoch Konståkningsförbundetsvarat för. Det har för oss utvärderarevarit ett givande samarbete, som präglatsav öppenhet och tilltro.Syftet med Idrottslyftet har varit attöppna dörrarna till idrotten för fler barnoch ungdomar samt att utveckla verksamhetenså att fler väljer att fortsättaidrotta längre upp i åldrarna. Arbetet skaenligt Riksidrottsförbundet (RF) utgåfrån ett jämställdhets- och jämlikhetsperspektivoch genomsyras av de riktlinjersom anges i idrottens idéprogram Idrottenvill (1).Vi har i vår utvärderingsstrategi valt enförklaringsinriktad utvärderingsmodell.Det innebär att vi dels vill beskriva vadIdrottslyftets har resulterat i (måluppfyllelseoch andra effekter), dels vill förklaradet vi kommit fram till mot bakgrund avde förutsättningar som verksamheten har(2,3).Den förklaringsinriktade strategin harsin grund i den så kallade ramfaktorteorinstankemodell, som baseras på tregrundpelare: ramar – process – resultat(4,5). Synen på utvärdering har ocksåstora likheter med den modell för kulturanalyssom Henriksen med flera utvecklatför studier av talangutveckling ochsom vi delvis utnyttjat i vårt analysarbete(6).Syftet med vår utvärdering är attbeskriva och kritiskt granska Idrottslyftetoch de olika specialidrottsförbundensarbete med att utveckla egna mål ochstrategier. Syftet är också att studeravilket genomslag dessa fått på föreningsnivå.Ett ytterligare delsyfte är att geförbunden stöd i sitt arbete med Idrottslyftetgenom förbundsspecifika granskningarsom genomförts i samråd medförbunden.En positiv bild av IdrottslyftetVi kan omedelbart slå fast att såvälförbund som föreningar generellt ärmycket positiva till Idrottslyftet. Idrottslyftetsbåda huvudsyften, det vill säga attöppna dörrarna till idrotten för fler barnoch ungdomar samt att utveckla verksamhetenså att fler väljer att fortsätta idrottalängre upp i åldrarna har realiserats, meni varierande grad. De allra flesta föreningarnaär överens om att den verksamhetsom genererats via stöd från Idrottslyftetinte hade blivit av utan detta stöd. Dettycks dock finnas en tendens att manbörjat se Idrottslyftet som en permanentbudgetförstärkning, vilket leder till en stororo från både förbund och föreningar införden dag då dessa satsningar eventuelltupphör. I så fall skulle cirka 30 procent avdet ekonomiska stödet till idrotten försvinna.Oron beror i första hand på attmedlen från Idrottslyftet i stor utsträckningi dag utgör grunden för idrottsrörelsenskvalitets- och utvecklingsarbete.I likhet med RF:s samlade redovisningvisar våra studier att man inom fleraidrotter kunnat se en påtaglig nyrekryteringav barn och ungdomar. Det har ihuvudsak gällt de kategorier som redanfinns i verksamheten, framför allt yngrepojkar, medan nyrekryteringen av barnoch ungdomar med utländsk bakgrundeller med funktionsnedsättning förefallervara tämligen liten. Existerande könsmönsterhar därmed inte heller förändrats.PG FahlströmLektorInstitutionen för pedagogik,psykologi och idrottsvetenskapLinnéuniversitetetPer GerrevallProfessorInstitutionen för pedagogik,psykologi och idrottsvetenskapLinnéuniversitetetMarie HedbergDoktorand och adjunktInstitutionen för pedagogik,psykologi och idrottsvetenskapLinnéuniversitetetSusanne LinnérLektorInstitutionen för pedagogik,psykologi och idrottsvetenskapLinnéuniversitetet1/2012 svensk idrottsforskning 55


DansportförbundetGrundat: 1968MedlemmarMän: 13 009Kvinnor: 26 011*Deltagartillfällen: 165 583FriidrottförbundetGrundat: 1895MedlemmarMän: 200 337Kvinnor: 314 292*Deltagartillfällen: 1 536 738GolfförbundetGrundat: 1904MedlemmarMän: 371 739Kvinnor: 161 600*Deltagartillfällen: 466 103IshockeyförbundetGrundat: 1922MedlemmarMän: 142 500Kvinnor: 7 500*Deltagartillfällen: 4 166 455KonståkningförbundetGrundat: 1904MedlemmarMän: 2 642Kvinnor: 13 218*Deltagartillfällen: 562 8612010 års statistik.*Träning & tävling för barn 7-20 år.Olika villkorDen ekonomiska tilldelningen till specialidrottsförbundengörs på basis av detlokala aktivitetsstödet. De förbund somhar störst tilldelning när verksamhetenmäts i antalet deltagartillfällen får ocksåstörst bidrag från Idrottslyftet. Ur ettkvalitativt perspektiv kan man diskuteraom Idrottslyftets resurser enligt dennafördelningsgrund landar där behovet avstöd och utveckling är som störst.Större förbund har också andra möjligheteratt ställa en administrativ organisationpå fötter. Det innebär att dessaförbund i större utsträckning kan mobiliseraoch stödja föreningarna och på såsätt få en ökad verksamhet som avspeglasdels i antalet deltagartillfällen, dels iutbudet av olika typer av aktiviteter. Detfinns därför en risk att fördelningsmodellenistället konserverar rådande storleksförhållanden,om inte de mindre förbundengör någonting kvalitativt bättre somleder till en påtaglig ökning i antaletdeltagartillfällen.I all projektstyrd verksamhet, därmedel beviljas i konkurrens och utifrånlokala initiativ, är betydelsen av kompetensbetydelsefull. De föreningar som hartillgång till relevant kompetens har ettförsteg framför andra genom att man kanleverera goda projektansökningar och harett större antal anställda eller andraresurspersoner som kan genomföraprojekten. I många föreningar är justbrist på ledare en vanlig förklaring till attman å ena sidan inte sökt projektmedeloch å andra sidan inte kunnat fullfölja denverksamhet man fått projektmedel för.Vi har vidare kunnat konstatera attresursflödet i vissa delar är omständligt.När förbunden exempelvis anordnarverksamheter inom Idrottslyftets regi, fårföreningarna bidrag för att man skakunna betala avgifterna för dessa aktiviteter.Det blir en administrativ rundgång avmedel, då ersättningen går från förbundetoch ut till föreningarna, för att sedan tavägen tillbaka till förbundet som ersättningför förbundets kostnader. Som vi serdet leder detta till en tämligen onödig ochkostsam byråkrati, som man bör se över.Om man ska kunna öppna dörrarna förfler så måste man, bildligt talat, ha någradörrar att öppna. Vi har kunnat se attvillkoren varierar när det gäller tillgångentill anläggningar som möjliggör en meromfattande verksamhet. Inom exempelviskonståkningen är rekryteringen av nyayngre deltagare i allmänhet inte någotstörre problem, tvärtom står barn i kö föratt få vara med. Den stora begränsningenär istället tillgången till istider. Det finnsoftast inte några utomhusanläggningar.Verksamheten blir då beroende av den tidden får sig tilldelad i de inomhusanläggningarsom konståkningen i regel delarmed ishockeyn.Anläggningsfrågan illustrerar förhållandetatt Idrottslyftets kvantitativa mål ställsmot kvalitativa mål eller de värderingarsom genomsyrar Idrotten vill. När antaletdeltagare ställs mot varandra utfallerjämförelsen oftast till ishockeyns fördel,eftersom det i ishockeyn är fler deltagarepå is samtidigt. Vi har på liknande sättkunnat urskilja en konkurrens om anläggningarnär det gäller friidrott och fotboll.När det uppstår anläggningsbrister ställsockså olika värden och verksamheter motvarandra. Elit- eller tävlingsorienteradverksamhet ställs mot breddorienteradverksamhet.Fria eller bundna projekt?Under Idrottslyftets första år tillämpadenågra av förbunden en öppen ansökningsprocessi förhållande till Idrottslyftetssyften och lät föreningarna utforma sinaprojektansökningar tämligen fritt. Förbundetangav varken ekonomiska eller andrabegränsningar, utöver dem som Idrottslyftetställt krav på.Efter hand har några förbund begränsatfriheten till ett antal områden som föreningenska hålla sig inom. Även beloppenhar i högre grad standardiserats. Föreningarnavet då vilka bidrag som de kan få frånIdrottslyftet. Men det har fortfarandefunnits en viss frihet att formulera egnaprojekt inom ramen för dessa innehållsområden.En öppen ansökningsprocess ställerhögre krav på förbundets rådgivandeinsatser, och härigenom har man kunnatutveckla ett gott samarbete mellan förbundoch föreningar.Inom ett av förbunden ledde erfarenheternafrån Handslaget till att man valde attenbart erbjuda stöd till ett antal centraltutformade projekt. Motiven för styrningenvar flera. Från förbundets sida säger mansig vara klar över vilka utvecklingsinsatser56 svensk idrottsforskning 1/2012


som den egna idrotten behöver. Vidarefinns en strävan efter att alla föreningarska kunna delta oavsett vilken kompetenssom föreningen har för att utformaprojektansökningar. Genom den härstyrningen har man både fått till stånd enomfattande verksamhet och en i stort settmangrann uppslutning.Föreningarna har haft något varierandeinställningar till förbundsstyrningen.Många tycker att det är bra att förbundetstyrt Idrottslyftet, men det finns ocksåflera föreningar som skulle vilja ha störremöjligheter att anpassa verksamhetenefter egna behov. Det är naturligtvis medstyrning som med mycket annat – detman vinner på gungorna förlorar man påkarusellen. Föreningen vinner i deltagande,men förlorar i kreativitet ochnytänkande.Utbildning på gott och ontUtbildning har kommit att spela en storroll inom Idrottslyftet. Inom samtligaförbund går en betydande del av Idrottslyftetsresurser till anordnandet avutbildningar för ledare. Ofta tillämpas enmodell, där de som deltagit i förbundetsutbildningar i sin tur ska utbilda föreningensledare.Som pedagoger delar vi tilltron till attutbildning kan förändra och utveckla enverksamhet. Utbildning vara ett medel föratt föra ut ett visst kunnande i organisationen.Det kan också mobilisera och skapaförutsättningar för att man ute i organisationenutifrån egna villkor kan bedrivautveckling.Vi har kunnat konstatera att fokus iutbildningarna i allmänhet ligger på detrent idrottsliga, men även på generellafrågor som rör ledarskap inom barn- ochungdomsidrott. De utbildningar vi studeratberör inte nämnvärt mångfalds- ellerjämlikhetsfrågor. Det finns exempel på friaprojekt som har en tydlig inriktning motjämställdhet eller jämlikhet, men när dethandlar om verksamhetens utveckling så ärutbildningarna mera traditionella ochgenerella.Utbildningarnas innehåll innebär enstyrning av idrotten. Det blir då väsentligtatt studera den form i vilken framtidaidrottsledare stöps. Utbildningarnasinnehåll bör utformas med tanke på dekonsekvenser som Idrottslyftet för med sigi termer av större och mer heterogenabarn- och ungdomsgrupper, där förhållandetmellan deltagande och tävling blir merkomplext.Som vi ser det behöver utbildningarnadärför i högre grad ge en grund för innehållsligutveckling av verksamheten ochbehandla nya perspektiv på tränarrollen,Konståkningssporten har sett fleraframgångar på sistone. Det gällersärskilt systrarna Helgesson. På EMtidigare i år nosade storasysterViktoria på en medalj medanjunioren Joshi på bilden blev tia.1/2012 svensk idrottsforskning 57


Referenser1. Idrotten vill. Idrottsrörelsenidéprogram. Riksidrottsförbundet.2009.2. Franke-Wikberg, S. Enstrategi för utvärdering och lokalutveckling av utbildningskvalitet.Arbetsrapport Nr 81 .1990.3. Lundahl, C & Öquist, O. Idénom en helhet: utvärdering påsystemteoretisk grund. 2002.4. Dahllöf, U. Ability grouping,content validity and curriculumprocess analysis. 1971.5. Lundgren, U. P. Ramfaktorteorioch praktisk utbildningsplanering.Pedagogisk Forskningi Sverige, årg 4, nr 1, s. 31–41.1999.6. Henriksen K. m.fl. Psychologyof Sport and Exercise. 2010. Vol11, s. 212-222.7. Engström, L-M. Forskningom Handslagets genomförandeoch resultat – En utvärderandesammanställning gällande Handslaget.2008.8. Peterson, T. När fältenkorsas – om handslagsprojektpå skoltid. Paper presenterat vidÅrskonferensen för Svensk föreningför Beteendevetenskaplig ochSamhällsvetenskaplig Idrottsforskning(SVEBI). 2008.9. Houlihan, Barrie (2010).Policy convergence in elite sportdevelopment: A critical review ofthe evidence. Key-noteföreläsningvid EASM:s forskningskonferens,Prag, 2010.Kontaktpergoran.fahlstrom@lnu.seper.gerrevall@lnu.semarie.hedberg@lnu.sesusanne.linner@lnu.sevad det innebär att delta i träning ochtävling, vad som är kvinnligt och manligtetcetera. Det är vidare svårt att åstadkommaen förändring under enstakatimmar eller dagar, vilket ofta är den tidman har till sitt förfogande. Utbildningkan under dessa premisser istället innebäraatt existerande föreställningarpermanentas och förs vidare.De öppnade dörrarnaDörrarna har öppnats för fler barn ochungdomar, men inte i någon störreutsträckning för nya kategorier barn ochungdomar. För att de ska vilja stanna kvarär det kanske naturligt att de ska kunnakänna en omedelbar samhörighet meddem som finns innanför dörrarna. Menden som känner sig främmande i någotavseende blir med tiden antingen utstötteller väljer själv att lämna verksamheten.Att exempelvis vara nybörjare somtonåring i en verksamhet, där andranybörjare är avsevärt yngre är en realitetför många av våra invandrande ungdomar.Heterogenitet är något som vigenerellt i samhället har det en smulasvårt att hantera.Idrottslyftet har således inte i någonhögre grad förmått förflytta de gränsersom utgör ett hinder för nya grupper barnoch ungdomar att börja idrotta. Exempelvishar, som vi tidigare nämnt, andelenbarn och unga med utländsk bakgrundeller med funktionshinder inte blivitstörre. De som börjar med en ny idrott ärframför allt yngre barn, medan det harvisat sig svårt att attrahera de något äldreungdomarna. Dessutom kan det ju vara såatt om man utvecklar verksamheten så attfler ungdomar stannar kvar så minskarmöjligheten rekrytera nya utövare.Utfallet av denna granskning påminnerdärför mycket om de resultat som Lars-Magnus Engström redovisade i utvärderingenav Handslaget (7). Det är förståsväsentligt att ställa sig frågan vad dettaberor på. En förklaring kan vara att desom inte finns med i idrottsrörelsenmedvetet har valt att stå utanför. De ägnarsig istället åt andra aktiviteter än idrott.Barn och ungdomar som inte har någotintresse av att idrotta, engagerar sig inteheller i de aktiviteter som anordnas inomIdrottslyftets försorg.En fråga man behöver ställa sig är i vadmån Idrottslyftet verkligen i ett störreperspektiv har lett till en verksamhetsutvecklingsom utmanar befintlig kultur ochbefintliga ramar. Att föreningarna har svårtatt möta en mer heterogen skara ungdomarförklaras ofta med att man saknar ledareför att kunna möta varierade behov. Manskulle alltså kunna säga att en effekt avIdrottslyftet är mer av samma men avbättre kvalitet.Idrottslyftet och idrottens kärnaFrågan kvarstår vilken väg idrotten ska taför att öppna dörrarna för fler och behållaungdomar högre upp i åldrarna. Idrottenskaraktär och utformning är historiskt ochkulturellt betingad och mot en sådanbakgrund kan förbundens oförmåga atterbjuda en annorlunda verksamhet bliförståelig. Därför finns det förmodligen ensorts, kanske omedveten, förförståelse somgör att det är svårt att tänka sig en förändringav den egna idrottens regler ochorganisation.Men om vi fortsätter tankekedjan ienlighet med Idrottslyftets ambitioner, ärdet alltså idrotternas uppgift att skapaaktiviteter som gör att fler nya barn ochungdomar kommer med. Ungdomar som,med Tomas Peterson ord, ”redan tackat nejtill verksamheten” (8).I vilken omfattning och på vilket sätt skadå en idrott ändra sin utformning för attmöta nya grupper, så att de också får ta delav de positiva värden som idrottens ansesstå för i enlighet med till exempel Idrottenvill? När, i så fall, upphör den att vara justdenna specifika idrott? Om man gör dennaanpassning finns dessutom risken att denyrekryterade ungdomarna kommer attkänna sig lurade när verksamheten såsmåningom övergår i specialidrottenstraditionella utformning för att passa in itävlingsformer, klassindelningar och såvidare.En annan, kanske något provocerande,fråga är: Måste alla vara med i idrott?Propositionstexten säger att Idrottslyftetska öppna dörrarna för fler barn- ochungdomar och utveckla verksamheten såatt de väljer att idrotta längre. Innebär detatt de per definition måste komma med iföreningsverksamhet under RF:s tak? Alltför att de ska få ta del av the magic dust ofsport. (9)58 svensk idrottsforskning 1/2012


HALMSTAD HÖGSKOLAS UTVÄRDERING AV: TYNGDLYFTNINGS- OCH STYRKELYFTFÖRBUNDETStarka män söker kvinnorMännen dominerar stort i bägge idrotterna. Inom föreningarna fannsen önskan att i prioritera jämställdhets- och jämlikhetsarbetet men fåinvolverade det i projekten. Men de som har gjort det har ocksårekryterat fler flickor och kvinnliga tränare.I v å r u t v ä r d e r i n g av Svenska tyngdlyftningsförbundetsoch Svenska styrkelyftförbundetsarbete med Idrottslyftetgenomförtde vi totalt 23 intervjuer och 50besvarade enkäter. Syftet med vårt arbetehar varit att förutom utvärderingen ävenkunna bidra till utveckling för de definierademålgrupperna. Vi har, utifrånsamtliga resultat, utformat en modell överarbetsprocessen och interaktionen mellanföreningarna och de bägge specialidrottsförbunden(Figur 1).TyngdlyftningsförbundetI intervjuerna framgick klart att Svenskatyngdlyftningsförbundet är medvetna omIdrottslyftets innebörd, det vill säga attdet är ungdomsidrotten som ska främjas.Förbundet har skapat riktlinjer bestämdaav ansvariga för Idrottslyftet och styrelsen,vilket är mycket positivt. Det är ocksåbra att förbundet har gjort vissa undantagi materialfrågor när det gäller flick- ochungdomsutrustning. Vi anser att det främjarjämställdheten då flickor är en minoritetinom tyngdlyftning. Annars arbetarTyngdlyftningsförbundet inte så utpräglatmed jämställdhetsfrågor och gör det inteheller inom Idrottslyftet, eftersom deanser att jämställdheten främjas naturligtvia tyngdlyftningskulturen. Förbundet bördock sträva efter att i framtiden ha någonsorts handlingsplan angående ämnet ifråga (1). Något som naturligt finns, kanlika naturligt försvinna.Unga flickor bör med fördel ha kvinnligainstruktörer då instruktören avsamma kön delar erfarenheter frånliknande situationer. Flickor uppleverockså att det är lättare att diskutera frågorom sin egen kroppsutveckling, ätstörningaroch frågor som sexualitet med entränare eller rådgivare av samma kön (2).Vidare framkom att förbundet inteföljer upp de föreningar som beviljatsprojektmedel. Då det i en efterkontakt kanframkomma viktig information anser viatt en sådan borde genomföras. Det är iåterkopplingar och i efterkontakter somlärdom kan urskiljas (3).Tyngdlyftningsförbundets mätpunkterär antal licensierade utövare samt antalettävlingslag. Dessa är förmodligen demätpunkter som är mest tillförlitligaeftersom det inte går att kartlägga varjeenskild lyftare. Självklart kan synpunkterresas hur pålitligt det är då en person kanha licens utan att tävla. Förbundetupplever dock att det går att urskilja enökning på ungdomssidan. Problemet ärdäremot att det inte går att säga attökningen enbart beror på Idrottslyfteteller ens att Idrottslyftet är en del iresultatet. En annan problematik är attdet finns skaderisker med tyngdlyftning,framför allt i unga åldrar då tekniken inteär inlärd (4). För att även unga ska kunnautöva tyngdlyft har förbundet utformatalternativa träningsmetoder där lyftblandas med hopp och lek. Det är ett brasätt att få barn att ha kul vilket bör varaFörbundsarbetsprocessFöre – Under – EfterInteraktionIdrottslyftetsresultatFigur 1. Modell över Idrottslyftets arbetsprocess.Figur 1: Modell över Idrottslyftets arbetsprocess.Hansi HinicUniversitetsadjunkt i psykologiHögskolan i HalmstadHampus LostinProjektassistentHögskolan i HalmstadFöreningarsarbetsprocess1/2012 svensk idrottsforskning 59


TyngdlyftningsförbundetGrundat: 1922MedlemmarMän: 13 138Kvinnor: 3 756*Deltagartillfällen: 71 026StyrkelyftförbundetGrundat: 1996MedlemmarMän: 17 958Kvinnor: 5 520*Deltagartillfällen: 137 6012010 års statistik.*Träning & tävling för barn 7-20 år.prioriterat ett i ung ålder. Den viktigastefaktorn för att få barn att delta är just attde vill ha kul (5).Förbundet har valt att bromsa vissaansökningar, det vill säga de väntar medutbetalning av medel till dess att föreningeninkommit med en utvärdering avföregående år. Det här anser vi vara såvälpositivt som negativt. Det är positivteftersom alla föreningar utvärderar sinaprojekt och förbundet kan därmed få merstatistik och information. Men negativtdå det skapar ett tvång och en press påföreningarna att prestera både under ochefter projektets gång. En för hög presskan komma att sänka motivationen hosföreningen till att genomföra projekt iframtiden. Det är en grannlaga fråga sombör beaktas.Vi anser vidare att förbundet gör rätt iatt satsa på material och ledarutbildningtillsammans med träningsläger ochtävlingsverksamhet eftersom det gynnarfysisk, psykisk, social och kulturellutveckling (6). Dessa utvecklingsområdenformar och utvecklar människor positivtredan i ung ålder och fram tills individernaär vuxna (7). Vi anser vidare attmotivation till utövande och trivsel äravgörande faktorer för om barn fortsättermed idrott eller inte. Ledares närvaro ochledarstil är faktorer som visat sig integreraoch påverka en individs motivationtill deltagande i idrott (8). Föreningar bördärför se till att ha bra utrustning samtnärvarande ledare för att attrahera flersamt bibehålla fler utövare längre.Tyngdlyftningsförbundet har utvecklingsplanerom hur projekten ska kunnautvärderas. Förbundet tänker upprättamedlemsregister över utövare i olikaåldrar oavsett om de har licens eller inte.Vi anser att det kan vara en bra metodom det är konkreta siffror förbundet ärute efter.Vidare vill de i framtiden involvera sinjämställdhetsgrupp i syfte att förbättrasitt arbete med just jämställdhet ochjämlikhet. Vi anser att det är en riktigtbra idédå fler projekt skulle kunna nå flickor i enstörre utsträckning (9). Idrotten ska varajämställd och vara lika viktig för kvinnorsom för män, för flickor som för pojkarsamt alla ska vara lika viktiga föridrotten (7).Tyngdlyftningens föreningarÖverlag synes förankringsarbetet fungeraväl då såväl styrelsen som ledarna ärinvolverade. Det visar att de kommunicerarmed varandra vilket är bra införframtida arbete/projekt. Glädjande ärockså att samarbetet mellan föreningarnaoch förbundet upplevs som bra och gott.Bra utvecklat samarbete är viktigt införframtiden, framför allt då det gäller barnoch ungdomar inom idrotten.Ett av de övergripande syftena medidrottslyftsprojekten som diskuterades avde involverade klubbarna var att utveckladen nuvarande verksamheten. För attkunna erbjuda en god träningsmiljö skade bland annat inhandla nytt material,såsom skivstänger och skor. En delidrottslyftsansökningar syftade även tillatt bland annat subventionera medlemsavgiftenoch resor till tävlingar, vilketockså genomfördes. Motivet till en sådansubvention var att kunna locka ochbehålla fler medlemmar genom att göradet mindre dyrt att delta i idrotten. Ävenmöjligheten att bjuda in förebilder varnågot som en del projekt syftade till ochgenomfördes. Ur motivationssynpunktkan detta vara en mycket effektiv idé dåde unga utövarna får se att det går attlyckas, vilket även är motiverande för enindivids personliga faktorer såsommålsättning och behov (10).Inom föreningarna fanns en önskan atti prioritera jämställdhets- och jämlikhetsarbeteti högre grad än vad som är fallet idagsläget, dock var det få föreningar somaktivt involverade frågan i de olikaprojekten. Den upplevda svårigheten medatt rekrytera flickor kan vara anledningentill att föreningarna förbiser flickrekryteringeni de olika projekten (11). Vi anserdäremot att föreningar som strävar efteratt öka andelen kvinnliga tränare är pårätt väg för att underlätta rekryteringen aväven unga flickor. En kvinnlig tränare ären förebild och kan bemöta flickor på ettnaturligt och pedagogiskt sätt.Att stärka sammanhållningen blandmedlemmarna är viktigt för att bådekunna nyrekrytera och bibehålla yngreadepter i framtiden, anser föreningarna.Det finns ett samband mellan sammanhållningoch individuell tillfredställelse.Det senare utgör i sin tur en större del aven individs inre motivation. En satsning60 svensk idrottsforskning 1/2012


på sammanhållning kan influera en högregrad av individuell tillfredställelse ochindirekt även inverka på individernasmotivation.StyrkelyftförbundetSvenska styrkelyftförbundet använder sigav vissa grundkriterier för föreningar attsöka medel för idrottslyfts projekt och föratt underlätta arbetet med Idrottslyftet.Det är positivt då det innebär att förbundetpå så sätt kan främja rätt målgrupp.Ingen förening som enbart satsar påvuxenidrott ska kunna dra nytta av medelsom är tänkt att gynna ungdomsidrott.Dessa grundkriterier är att utbilda ledaresatsa på flickidrott och vissa materialinköp,vilket ligger i intresse för Idrottslyftetsmål. Det ligger väl i linje med forskning(6,12).Från och med Idrottslyftets femte årkommer Styrkelyftförbundet att anpassaansökningsstrukturen från 100 procentallmänna ansökningar till 70 procentförbundsprojekt. Förändringen är drastisk,men vi anser att det kan underlättaföreningarnas möjlighet att genomföraprojekt då de är mer medvetna vadpengarnas ändamål är. Det borde ävenmedföra att fler söker eftersom detunderlättar arbetet med allt från att tafram en projektidé till arbetet underuppbyggnadsfasen och planeringsfasen.Förbundet har uppfattat en ökning avantalet ansökningar samt att det är flermindre föreningar som ansöker ommedel. De tär positivt eftersom mindreföreningar ofta har sämre ekonomiskaförutsättningar än större.Vidare framgår det att man i förbundetär mycket angelägna om att ungdomsrekryteringarnai styrkelyft bör prioriterasoch arbetas med. En av svårigheterna medatt rekrytera unga är att skaderisken ärhög och förbundet inte vill att barn ska taskada av att utöva styrkelyft (4). Vi anseratt detta är en mycket viktig del att tahänsyn till och att denna problematik lyftsupp och aktivt arbetas med på samtliganivåer, inte minst på förbundsnivå. Omett barn skadar sig under den tid somskelettet utvecklas kan barnet komma attfå men i vuxen ålder (13). Därför är detviktigt att satsa på grundinlärningen istyrkelyft.Efter att en förening fått idrottslyftsmedelfinns en kontinuerlig kommunikationmellan förbundet och föreningen i fråga.Vi anser att det är mycket främjande ochstödjande för föreningen (14). Det visar attförbundet bryr sig om utgången och villhjälpa föreningarna att lyckas. Däremotavstannar kontakten vid ett projekts slut,vilket det inte borde göra då efterarbetetoch återkopplingen ger många lärdomarför framtida projekt. Styrkelyftförbundethar en egen lösning för att återkoppla tillavslutade projekt. De uppmuntrar föreningarnaatt skriva en artikel i förbundstidningenför att inspirera andra samt för atti förebyggande syfte för framtida projektredogöra för olika hinder som de stött på iprojektet. Det är en bra form av återkopplingdå problematiken med vissa projektkan motarbetas eller undvikas i liknandekommande projekt. Det är dock viktigt attman inom förbundet är medvetna omdessa problem och inte enbart hänvisartill förbundstidningen för föreningar attleta själva.Avslutningsvis vill förbundet attjämställdhet ska genomsyra framtidaprojekt. De vill även stödja och drivajämställdhetsprojekt. Jämställdheten kangynnas av att förbundet använder sig avkontinuerlig kontakt med projektföreningarna.Förbundet kan fungera som ettextra stöd och se till att jämställdhetspro-1/2012 svensk idrottsforskning 61


Referenser1. Ecceles, J. S., & Harold, R.D.Journal of Applied Sport Psychology1991. 3:7-35.2. Fitzgerald, L. F., & Nutt, R.The Counseling Psychologist1986. 14:180-216.3. Locke, E.A., & Latham, G.P.American Psychologists 2002.57:705-717.4. Mason, T. A. British Journal ofSports Medicine 1977. 5:61.5. Gould, D., & Horn, T. Participationmotivation in young athletes.Psychological foundationsof sport. 1984. s. 359-370.6. Smith, R.E., & Smoll, F.L.Journal of Appled Sport Psychology1997. 9:114-132.7. Riksidrottsförbundet. Idrottenvill. 2009.8. Amorose, A. J., & Horn, T. S.Journal of Sport and ExercisePsychology 2000. 22:63-84.9. Martin, J.J., Waldron, J.J.,McCabe, A., & Yun, S.C. Journalof Clinical Sport Psychology2009. 3:127-138.10. Vallerand, R. J., & Rousseau,F. L. Intrinsic and extrinsicmotivation in sport and exercise.Handbook of sport psychology.2001. s. 389-416.11. Sirard, J.R., Pfeiffer, K.A., &Pate, R.R. Journal of AdolescentHealth 2006. 38:696-703.12. Acosta, R.V., & Carpenter,L.J. Women in intercollegiatesport. 2002.13. Malina, R.M. The young athlete.Children and youth in sport.1996. s.161-186.14. Rees, T. Influence of socialsupport on athletes. Social psychologyof sport. 2007. s. 223-232.15. Burke, K.L. Journal of InterdisciplinaryResearch in PhysicalEducation 1997. 2:39-52.Kontakthansi.hinic@hh.sehampus.lostin@hotmail.comjekten inte avbryts eller missköts avprojektföreningen. Då flickor, bådeutövare och ledare, är en minoritet inomidrotten anser vi att ett extra stöd inomdessa projekt är mycket nödvändigt ochviktigt för att kunna motivera flickor (12).Samtidigt håller vi med förbundet om attman bör eftersträva en generell satsningpå unga eftersom få barn och ungdomarägnar sig åt styrkelyft.Styrkelyftningens föreningarInom föreningarna upplever de kontaktenmed Styrkelyftförbundet som mycket god.Både de föreningar som haft kontakt medförbundet och de som inte nyttjat kontaktenfullt ut har känt att förbundet har varitmycket tillmötesgående. En god kontaktoch kommunikation mellan föreningaroch förbund är en viktig del under ettsamarbete, vilket bör förebygga missförståndoch oklarheter (15). Vidare ansågföreträdare för föreningarna att motiverandeträningsläger och resor är en viktigdel för att behålla barn och unga inomidrotten samt för att få dem intresseradeav verksamheten. Omgivningen är för enidrottare mycket viktigt ur motivationssynpunkt(10). Vidare kan gruppaktiviteteröka en grupps sammanhållning, vilketvidare har en inverkan på den individuellatillfredställelsen och den inre motivationenför utövaren. Vi anser att en motiverandemiljö kan både ge inre och yttremotivation till att delta. Genom att trivas isin träningsmiljö och få göra någottillsammans med andra samt att få kännaglädje i idrottande kan inte nog betonas.Då fler föreningar har rapporterat ökandemedlemsantal krävs även kompetentatränare för att ta hand om de nya ungdomarna(6).Resultatet visade att flera föreningarupplevde att deras verksamheter förändratspositivt efter genomförda projekt. Enförening menade att de utvecklats, fåttutbildade ledare och blivit en bättredriven verksamhet. Mer utbildning ochfler licenser är goda indikationer på attIdrottslyftet givit positiva utfall. Det gårdock inte att säkert påvisa en ökningeftersom uppgifterna det baseras påuppfattningar hos föreningarna själva.Det var enbart ett fåtal föreningar somtog hänsyn till jämställdhet och jämlikheti sina projekt, dock ville samtliga föreningarutöka antalet utövande flickor ochbehålla de som redan finns inom föreningen.Det är budskap och handlingar sommotsäger varandra. Finns en strävan efterjämställdhet, då det är brist på flickor ivissa föreningar, borde även idrottslyftsprojektenvara inriktade på just jämställdhetoch jämlikhet (12). En förening utveckladesmycket inom jämställdhetsområdet,vilket var glädjande. Något som inte varlika positivt var att andra föreningarbetonade fler problem än möjligheter.Resultaten visade att den viktigasteframtidsfrågan från föreningarna är att fåbort den negativa bilden av styrkelyft. Detär mycket bra att föreningarna vet vad devill satsa på i framtiden. Både föreningaroch förbund bör sträva efter att få idrottenatt framstå som ren och fri från dopningoch droger.Handlingsplaner rekommenderasSammanfattningsvis kan vi konstatera attfinns önskemål om att bättre arbeta medjämställdhets och jämlikhetsfrågorna påsåväl förbunds- som föreningsnivå. Villman rekrytera fler flickor och kvinnligatränare måste man också arbeta meddessa aspekter. Föreningar som har gjortdet har också rekryterat fler. En handlingsplanvore därför att rekommenderaför fler föreningar. Glädjande är också attfler föreningar har positiva erfarenheterav idrottslyftsprojekt i termer av nyrekryteringaroch ledarrekrytering. Dock kandet vara svårt att konkret säga om idrottslyftsprojektenvarit orsaken till dennaökning, men det har säkert spelat en roll.Avslutningsvis kan vi konstatera fler småföreningar har visat intresse att sökaidrottslyftsmedel för att utveckla sinverksamhet. I denna process har förbundeten stor roll i framtiden.62 svensk idrottsforskning 1/2012


RAMBÖLLS UTVÄRDERING AV: SKOLSAMVERKAN OCH TILLGÄNGLIGHET I IDROTTSLYFTETEn utvecklingsmotorsom inte startadeIdrottslyftet skulle nå de barn och ungdomar som idrotten traditionelltsett har svårt att nå och behålla. Det är en grupp som ställer andra kravpå idrotten. Idrottslyftet hade potential att fungera som en utvecklandekraft i svensk idrott, men den möjligheten har inte utnyttjats.R a m b ö l l h a r p å u p p d r a g av Riksidrottsförbundet(RF) genomfört enutvärdering av de projekt som finansieratsav de två delarna: Skolsamverkan ochTillgänglighet i Idrottslyftet. Uppdragetgenomfördes under perioden januari 2010till oktober 2011 och hade som primärtsyfte att värdera och förklara resultatet avSkolsamverkan och Tillgänglighet på enprogramövergripande nivå. Utvärderingenhar också haft ett tydligt framåtsyftandefokus – det vill säga att belysalärdomar från denna upplaga av Idrottslyftetsom kan bidra till att vidareutvecklakommande programsatsningar för attmaximera måluppfyllelse och mervärde.Idrottslyftet som möjliggörareSyftet med Idrottslyftet var att nå ochbehålla fler barn och unga i idrotten, detvill säga att mobilisera dem som inteidrottar och hålla kvar dem som traditionelltsett slutar. Ett sätt att mobiliseramålgruppen var att fördjupa samarbetetmed grund- och gymnasieskolan. Idrottslyftetgav föreningar och skolor möjlighetenatt med hjälp av projektmedelutveckla former för att aktivera elevernamer, men också att skapa möjlighet attvisa upp bredden av det lokala idrottsutbudet.Vid sidan om kännedom om utbudet ärtillgång till anläggningar och idrottsmiljöeren viktig grundförutsättning för attkunna nå och behålla medlemmar iidrotten. Satsningar på nya anläggningaroch idrottsmiljöer har under tidigareprogram bara varit möjliga att genomförai storstäderna (Stockholm, Göteborg ochMalmö). I och med Idrottslyftet kundedock föreningar över hela landet sökamedel för att skapa nya platser för aktivitet(aktivitetsytor) och därigenom bidratill bättre förutsättningar för barn ochungdomars idrottande.Sammanlagt har Skolsamverkan(år 1-3) omfattat cirka 7 800 projektgenomförts av cirka 5 460 föreningar (3-5).Inom Tillgänglighet har totalt under helaperioden 667 projekt beviljats medel. Avdessa har 145 (36 procent av det totalaantalet projekt) avsett fotboll, 42 ridsport(drygt sex procent) och 37 golf (knapptsex procent) för att nämna de tre störstaidrotterna.Rambölls övergripande bedömning äratt Idrottslyftet är en viktig förutsättningför föreningsidrottens verksamhet ochdärmed också för de värden kopplade tillfysisk aktivitet som föreningsidrotten villbidra till. Idrottsrörelsen bygger i högutsträckning på ideellt engagemang därde enskilda föreningarna i regel harbegränsade möjligheter till insatser somligger utanför den löpande verksamheten.För dessa föreningar har Idrottslyftetspelat en central roll som möjliggörareoch drivkraft i satsningar på Skolsamverkanoch ökad Tillgänglighet. Här finns etttydligt värde av programmet för attbehålla de medlemmar som redan finnsinom idrotten och de grupper som idrottentraditionellt har attraherat och fått attstanna kvar.För att uppfylla de långsiktiga målenom att nå och behålla fler barn ochungdomar i idrotten krävs dock åtminstoneytterligare två saker. För det förstamåste idrotten nå och involvera rättmålgrupp. För det andra måste föreningarnautveckla sin verksamhet för attkunna möta målgruppens behov. Utvärde-Olov Wolf-WatzChef avdelningen förvälfärdsanalysRamböll ManagementConsulting1/2012 svensk idrottsforskning 63


ingen visar att projekten har haft ett stortvärde lokalt, men att de har tagit sikte justpå behov i den egna verksamheten snarareän på behov hos målgruppen. Annorlundauttryckt har programmet inte nått maximaleffekt av framför allt två skäl:• Programmet har inte nått rätt målgrupp.Däremot har programmetbidragit till att behålla de medlemmaridrotten redan har haft och traditionelltsett lyckats attrahera.• Programmet har inte utvecklat denordinarie verksamheten för att hanterade hinder som finns för deltagande.Projekten har inte nått målgruppenIdrottslyftet avsåg att göra en skillnad fören viss grupp barn och ungdomar ochderas deltagande. Målgruppens behov hardock kommit att få en sekundär betydelse ide enskilda projekten. Endast cirka enfemtedel av projekten (17 procent i Skolsamverkanoch 20 procent i Tillgänglighet)har enligt föreningarna baserats på enmålgruppsanalys och få av projekten haranpassat verksamheten mot den avseddamålgruppen.Projekten inom Skolsamverkan ochTillgänglighet har inte heller riktat sigspecifikt till målgrupper med lågt deltagande.Statistik för vilka ålderskategoriersom nås av skolsamverkansprojekten visaratt det är vanligast att föreningen riktatprojektet mot årskurs 4-6 och klart minstmot gymnasiet. Eftersom de flesta avhoppensker mellan 15 och 19 år innebär detatt det snarare är ålderskategorier medhögt deltagande som nåtts av insatsernainom Skolsamverkan.Ramböll kan konstatera att Idrottslyftetinte har styrt mot målgrupper som är svåraatt nå. Det innebär att programmet i litenutsträckning kan antas ha bidragit med enförändring för den målgrupp som programmetpekat ut som den primära.Tillsammans med den samlade bilden avmedlemsutvecklingen (som visar på ettkonstant medlemsantal) i Sverige underperioden drar Ramböll slutsatsen, att denpotentiella effekten av Skolsamverkan ochTillgänglighet framför allt har handlat omatt inte tappa den grupp barn och ungasom idrotten historiskt sett varit bra på attattrahera och behålla.Idrotten har inte utvecklatsRamböll bedömer också att den verksamhetsutvecklandepotentialen i satsningeninte har realiserats. Programmets målsättningarom att nå och behålla fler bland degrupper idrotten traditionellt inte når ochtraditionellt tappar innebär att det finns enverksamhetsutvecklande ambition.Omkring 90 procent av alla barn ochungdomar i skolåldern har, under enkortare eller längre tid, varit med i enidrottsförening (6). Idrottslyftet avsåg att nåde tio procent som av olika skäl inte attraherasav idrottens ordinarie erbjudande –idrotten måste därför förändras i någotavseende för att kunna attrahera dengruppen. En viss del av detta utvecklingsarbetehandlar om faktorer som föreningensjälv förfogar över – det vill säga denverksamhet som den enskilda föreningenbedriver. Den är dock inte frikopplad frånidrottens struktur i termer av regelverk ochövriga incitamentsstrukturer inom vilkaföreningarna verkar. Det har tidigarekonstaterats att idrottens regelverk ochtävlingssystemets uppbyggnad försvårar enutveckling av barnidrotten i den riktningsom eftersträvas i RF:s idédokumentIdrotten vill (2). Seriesystemen styr mot entävlingslogik vilket i sin tur manifesteras aven tidig specialisering, fokus på talanger ochutslagning.Ramböll bedömer att satsningen inte,varken lokalt i föreningarna eller centralt,tillräckligt tydligt har präglats av en verksamhetsutvecklandeambition. Idrottslyftethar när satsningen fungerat som bäst, ståttför ett alternativ vid sidan om traditionelltidrottande (framför allt i skolsamverkansprojekt),men det har varit avgränsat tillprojekten i tid och rum och har inte påverkatföreningarnas verksamhet eller idrottensstrukturer. Inte heller i de projekt somligger i linje med de centrala intentionernaär det sannolikt att projekten får någonstörre betydelse för de enskilda föreningarnasverksamhet i framtiden. I och med detblir också värdet av Idrottslyftet begränsattill projektens deltagare och kan endaståterskapas genom ett ytterligare tillskott avexterna medel.Även om projekten har haft ett lokaltvärde har mekanismerna som skulle kunnastödja insatsens värden på samhällsnivåvarit för svaga. Föreningarnas drivkrafteratt söka projektmedel har tillåtits variera. I64 svensk idrottsforskning 1/2012


vissa fall skiljer de sig inte från de samhällsvärdensom programmet tar siktemot. I andra fall kan det dock handla omlokala förenings- och verksamhetsspecifikadrivkrafter. Ramböll bedömer attsatsningen följaktligen har rymt projektmed starkt bidrag till samhälleliga värden,men också projekt som bara har haft ettlokalt och snävt värde. Det kan till exempelhandla om projekt som endast bidragittill att flytta medlemmar mellan föreningar,när nya aktivitetsytor inte kommitden egentliga målgruppen till del, ellernär medlen avsatts till förbättrade förutsättningarför redan aktiva. Projekt somhar en sådan karaktär att medlemmarnainte hade slutat utan dessa förbättradeförutsättningar. Om idrotten i framtidenska kunna försvara det anslag den har serRamböll att det finns anledning att strävamot att de projekt som finansieras möterföreningarnas drivkrafter, men ocksåbidrar till värden på samhällsnivå. Men enförutsättning är att den verksamhetsutvecklandepotentialen i programmet tastillvara.Ramböll bedömer att de faktorer somförklarar programmets resultat kanhärledas till hur det har organiserats ochstyrts från RF:s sida. Men också att denstyrmodell som valts kan spåras tillstatens dubbla syn på hur idrotten skaparvärde i samhället.Olösta utmaningarÄven om mandatet över de slutliga beslutenom medeltilldelning har skiljt sig mellanSkolsamverkan och Tillgänglighet så hardecentralisering varit ett gemensamt drag iIdrottslyftets styrmodell. I fallet medSkolsamverkan har beslut om att beviljaeller avslå projektansökan fattats avdistriktsförbunden, medan det slutligabeslutet om nya aktivitetsytor har fattats avRF centralt. Decentraliseringen som principhar dock även kommit att omfatta merinnehållsliga aspekter. Exempelvis haransvaret för genomförandet av den behovsanalyssom ska motivera enskilda projektlegat på föreningarna.Den decentraliserade styrningen harutgått ifrån principen att föreningarnasjälva bäst kan fatt besluten om hur målgruppenkan gynnas av verksamheten. Enmångfald av föreningar skulle själva fåarbeta med de behov som de upplever attmålgruppen har i sin verksamhet. Det harfunnits en stor tillit till föreningarnasarbete och en liten systematisk kontroll avmedeltilldelningen. I förlängningen menarRamböll att den nerifrån och upp-strategisom använts har möjliggjort en ökadI och med Idrottslyftet kundeföreningar över hela landet sökamedel till bland annat anläggningar.Under tidigare satsningarvar det bara möjligt i storstäderna.1/2012 svensk idrottsforskning 65


anpassning till lokala behov men att dessabehov inte primärt utgått från målgruppensbehov.För att nå den avsedda målgruppenkrävs det en specifik analys av vilkaförutsättningar som påverkar barnen ochungdomarnas vilja att börja eller fortsättaatt idrotta. Utan en bakomliggande analysav vilka barn och ungdomar som i dag intebefinner sig inom idrottsrörelsen, ellersom i dag idrottar men som riskerar attsluta inom en snar framtid, kan innehålleti insatserna inte utformas för att möta deidentifierade behoven hos målgruppen.Ramböll bedömer dock att i och med attbehovsanalysen har decentraliserats hardet skapats utrymme för glidningarmellan RF och distriktsförbunden, menockså mellan distriktsförbund och föreningar,i tolkningen av Idrottslyftetsmålsättningar.Programmets målsättning om att nåoch behålla fler barn och unga i idrottenär bred och öppnar för olika tolkningar.Två tolkningar av målen har existeratparallellt inom såväl RF som distriktsförbunden– att programmet ska leda till flerbarn och unga i aktivitet och till fler barnoch unga medlemmar i föreningarna. Dethar således inte funnits en ensam tydliglogik för satsningen från centralt håll,vilket återspeglas lokalt. Anledningen tillatt RF har valt breda målformuleringaroch ett decentraliserat ansvar uppfattarRamböll också till stor del beror på att RFhar månat om att Idrottslyftet ska vara enbred satsning, som ska komma så mångaenskilda barn och ungdomar som möjligttill del. Samtidigt som det har funnits enavsedd målgrupp har RF inte velatdetaljstyra projekten för att på så sättriskera att föreningar avstår från att sökamedel och initiera projekt. Men valet harfått effekter på programmets träffsäkerhet,eftersom det har öppnat för en lokalomtolkning av målsättningarna. I dendecentraliserade styrningen av Idrottslyftetfinns ett implicit antagande om attföreningarna själva gör den bästa bedömningenav den logiska kopplingen mellanaktiviteter, projektmål och programmål.Ramböll har dock uppfattat att denna typav analyser sällan har genomförts ipraktiken, vilket minskat effektiviteten iprojekten och deras bidrag till programmålen.Ramböll bedömer därför sammantagetatt RF:s möjligheter att styra satsningenhar kringskurits av flera faktorer som kanspåras till den grundläggande organiseringenoch planeringen av satsningen.Breda målsättningar, en svag intern programlogik,stuprör i genomförandet, ensvag uppföljning tillsammans med endecentralisering av behovsanalys ochbeslutsfattande har försvårat för RF attdriva satsningen åt det håll som de önskat.Tydligare styrning behövsIdrottslyftet sjösattes i syfte att bidra meden specifik nytta för en specifik målgrupp.Samtidigt har formerna för genomförandetav programmet riggats utifrån en principom att idrottens värde uppstår i föreningarnautan behov av central kontroll överprojektens inriktning, behovsanalys ochrelation till programmets mål.Idrottslyftet kan i det här avseendetspegla statens dubbla syn på idrotten ochpå ideell sektor i stort – det vill säga å enasidan ska idrotten leverera ett specifiktvärde eller tjänst, å andra sidan bidrar dentill samhälliga värden bara genom attmedlemmar mobiliseras (7). Ramböll görtolkningen att den idrottspolitiska ambitioneninte bara handlar om att stärka barnochungdomsidrotten i sig själv, utan ocksåom att bidra till samhälleliga värden, såsomfolkhälsa och demokratisk utveckling. Envanlig tanke inom idrottsrörelsen är tillexempel att föreningslivet kan utgöra enskola i demokratiska processer, där unga lärsig värdet av kollektivt arbete, formerna förett rättvist beslutsfattande, konsten atthantera en ordförandeklubba och så vidare.Å ena sidan intar därmed staten positionenatt idrottsrörelsen inte har ett egenvärde. Åandra sidan ser man det, tillspetsat, somtillräckligt att säkra att idrottsrörelsen finnsoch kan fortsätta växa för att dessa andravärden ska uppstå. Medeltilldelningen tillidrottsrörelsen, liksom Idrottslyftet specifikt,har enligt Ramböll därför i hög gradpräglats av antagandet om att en styrningmot samhällsvärden inte är nödvändig,vilket i sin tur medfört att staten i praktikenkommit att hantera idrottsrörelsen påsamma sätt som sektorer som anses ha ettegenvärde. Idrottslyftet kan därför sägasbalansera på två skilda principer som inteenkelt låter sig förenas. Rambölls bedömningär att de värden RF (och i förläng-66 svensk idrottsforskning 1/2012


ningen regeringen) avsåg att uppnå iprogrammet inte har nåtts fullt ut medden valda modellen för organisering ochstyrning. För att programmet ska kunnases som framgångsrikt räcker de inte medatt Idrottslyftet bidragit till en stärktidrottsrörelse, om denna inte givit ettavtryck på en bredare samhällsnivå.Idrottslyftets resultat accentuerar detvägval som Idrotten står inför i stort. IIdrotten vill – idrottens idédokument,finns det en stark betoning på att idrottenska vara öppen för alla ”oavsett nationalitet,etniskt ursprung, religion, ålder, köneller sexuell läggning samt fysiska ellerpsykiska förutsättningar” (1). Samtidigtframgår det av Rambölls utvärdering attidrotten i dag inte med nödvändighet nårde samhälleliga värden som uttrycks iIdrotten vill genom att göra mer avsamma. Idrottslyftet har inte inneburitnågon väsentlig skillnad för de gruppersom man traditionellt har svårt att nå ochbehålla, trots att det var programmetsuttryckliga syfte. Här framträder ett glappmellan idrottens värderingar och vad denlevererar, som Ramböll menar understry-ker behovet av en tydligare avsiktligriktning i idrottens fortsatta utvecklingsarbete.Oavsett om idrotten i framtidenstår fast vid den inkluderande ambitioneneller inte måste det valet göras medvetet– idrotten måste veta vad den väljer menockså vad den väljer bort – den kan intevara allt för alla samtidigt. Ramböll ser attIdrottslyftet i framtiden kan fylla funktionensom motor för en sådan förändring,men det förutsätter att programmet styrsannorlunda. En utvecklad styrning har idet sammanhanget ett egenvärde oavsettvilken väg idrotten väljer, eftersom detmöjliggör en koppling mellan vad man göroch vad man vill uppnå. För att maximeraIdrottslyftets framtida värde och för attkunna motivera ett fortsatt statligt stöd idenna form, menar Ramböll som sin övergripanderekommendation att RF börfrångå den traditionella synen på huridrotten bidrar med värde. Istället bör RFta ett tydligare grepp kring styrningen avsatsningen mot de resultat man vill uppnåför de målgrupper man vill åstadkommaförändringen för.Referenser1. Riksidrottsförbundet. Idrottenvill. 2005. s. 8.2. Riksidrottsförbundet. Idrottenvill – en utvärdering av barn- ochungdomsidrotten. 2007 s. 9-11.3. Riksidrottsförbundet Ett årmed Idrottslyftet – Rapport omår 1. 2008.4. Riksidrottsförbundet Ett årmed Idrottslyftet – Rapport omår 2. 2009.5. Riksidrottsförbundet Ett årmed Idrottslyftet – Rapport omår 3. 2010.6. SOU 2008:59. Föreningsfostranoch tävlingsfostran – Enutvärdering av statens stöd tillidrotten. s. 204.7. Wijkström, F. m.fl. Staten ochdet civila samhället. Idétraditioneroch tankemodeller i denstatliga bidragsgivningen tillideella organisationer. 2004.s.11-13.Kontaktolov.wolf-watz@r-m.com15:e IBEC kongressenStockholm 17-21 juni 2012Välkommen till ”15 th International Biochemistryof Exercise Conference (IBEC)” i StockholmUnder fyra dagar kommer det att presenteras vetenskap inom ämnen sommuskelmetabolism, mitokondriefunktion och biogenes, så kallat “crosstalk”mellan celler, nutrition och träning, träningsanpassning och mycket mer.Program och mer information hittar du på www.ibec2012.orgSponsorer:1/2012 svensk idrottsforskning 67


POSTTIDNING B-POSTBEGRÄNSAD EFTERSÄNDNINGVid definitiv eftersändning återsändes försändelsenmed nya adressen på adressidanAVSÄNDARE: CIF, Box 5626, 114 86 StockholmIdrott & Samhällsnytta– ett dialogmöte23-24 maj 2012 i GöteborgIdrott & SamhällsnyttaDU KOMMER ATT MÖTA företrädare för idrotten, politiken och den akademiskaav den senaste forskningen. I programmet här bredvid kan du botanisera bland alla– ett dialogmötevärlden för att tillsammans samtala om idrottens förhållande till samhället och ta delde intressanta perspektiv som kommer att fungera som bränsle under detta intensivadygn.Vi vill att dialogmötet:• Ska utrusta dig med ny och nyanserad kunskap om ämnet i sig för att du dels skakunna fatta egna kloka beslut och dels kunna påverka andra att fatta kloka beslut.• Ska vara en kreativ mötesplats för idé-, erfarenhets- och kunskapsutbyte.• Ska inspirera dig att omsätta ovanstående i handling.• Ska väcka nya och intressanta frågor för fortsatt forskning.23–24 maj 2012 i Göteborg10.10–10.45 Idrottens rum – trender, behov ochVi vänder oss till:• Idrottens egna representanter på alla nivåer.• Politiker med idrott som sitt intresse- och ansvarsområde.• Forskare och lärare på landets högskolor och universitet som är intresserade avidrott.För program och anmälan:http://eventus.trippus.se/idrottochsamhallsnytta2012PROGRAM ONSDAGEN DEN 23 MAJ12.00–13.00 Registrering13.00–13.15 Välkomna – Karin Mattsson WeijberRF, Per Nilsson CIF och Frank Andersson VSIF13.15–14.00 Inledning14.00–15.15 Idrottens samhällsnytta urfilosofiskt och historiskt perspektivFöreläsare: Docent Johan R. Norberg, Malmöhögskola och docent Mikael Lindfeldt ÅboakademiKommentator: Professor och f.d. ordförande iNorges idrottsförbund Hans B. Skaset15.15–15.45 Fika15.45–16.45 Idrott, kön och medbestämmandeFöreläsare: Professor Jorid Hovden, Norgestekniske-naturvitenskaplige universitet,TrondheimKommentatorer: Malin Eggertz-Forsmark,ordförande Gymnastikförbundet och KristinaCarestam Landgren, fd förbundskapten innebandyoch sportchef Pixbo Wallenstam IBK17.00–18.00Valbart seminarium AIdrott, politik och politisk aktivismFöreläsare: Professor Ulf Bjerreld, GöteborgsuniversitetKommentatorer: Hampus Magnusson moderatpolitiker i kommunstyrelsen Göteborg, enstyrelseledamot i Örgryte IS (tba)Valbart seminarium BMedialsieringen av idrottenFöreläsare: Ekon. dr. Pernilla Petrelius-Karlberg,Handelshögskolan StockholmKommentatorer: Peter Gentzell, VD SvenskElihandboll, Tom Hollowell, verksamhetschefOrienteringsförbundet och Åsa Edlund Jönsson,projektledare Sveriges Television.18.00–18.30 Samtal, twitter och frukt18.30–19.30 Psykologiska och beteendemässigafördelar av idrott i ungdomsårenFöreläsare: Professor Håkan Stattin, ÖrebrouniversitetKommentatorer: Professor em. Lars-MagnusEngström, GIH Stockholm och Dallas Diabaté,Malmö Boxningsklubb.19.30 MingelmiddagPROGRAM TORSDAGEN DEN 24 MAJ08.30–09.30 Sportspegeln – samtal om gårdagenmed blicken mot morgondagenSamtalsledare: Peter Olsen med gästerDiskussioner/twitterflöde09.30–10.10 Idrott och några samhällsekonomiskavärdenFöreläsare: Docent Lars Behrenz, Linnéuniversitetet.ansvarFöreläsare: Lektor Karin Book, Malmö högskola10.45–11.15 Fika11.15–11.45 Nya idrottstrender11.45–12.30 … och vad händer nu inom idrotten?Peter Olsen leder ett samtal med företrädareför RF, CIF, VSIF samt flera medverkande idialogmötet12.30–13.15 LunchArranggörer:

Hooray! Your file is uploaded and ready to be published.

Saved successfully!

Ooh no, something went wrong!