Supplementary Table S1

More documents

Recommendations

Info

Bmb012212 1790.899096 2 1790.8923 0.0068 1.40E-08 SLEK FRCP SYELPDGQVITIGNERBmb012614 1790.899096 2 1790.8923 0.0068 1.40E-08 SLEK FRCP SYELPDGQVITIGNERBmb027728 1790.899096 2 1790.8923 0.0068 1.40E-08 SLEK FRCP SYELPDGQVITIGNERBmb012212 1790.893115 2 1790.8923 0.0008 4.00E-02 SLEK FRCP SYELPDGQVITIGNERBmb012614 1790.893115 2 1790.8923 0.0008 4.00E-02 SLEK FRCP SYELPDGQVITIGNERBmb027728 1790.893115 2 1790.8923 0.0008 4.00E-02 SLEK FRCP SYELPDGQVITIGNERBmb012212 3548.663426 3 3548.648 0.015 4.70E-06 GNER CDVD FRCPEALFQPSFLGMESCGIHETVYNSIMKBmb012212 3548.663426 3 3548.648 0.015 1.70E-02 GNER CDVD FRCPEALFQPSFLGMESCGIHETVYNSIMKBmb012212 3119.467136 3 3119.4604 0.0067 7.70E-05 SIMK MQKE CDVDIRKDLYANTVMSGGTTMYPGIADRBmb012212 905.452563 2 905.4519 0.0007 2.60E-03 SIMK DLYA CDVDIRKBmb012614 905.452563 2 905.4519 0.0007 2.60E-03 SIMK DLYA CDVDIRKBmb027728 905.452563 2 905.4519 0.0007 2.60E-03 SIMK DLYA CDVDIRKBmb012212 905.452502 2 905.4519 0.0006 1.30E-02 SIMK DLYA CDVDIRKBmb012614 905.452502 2 905.4519 0.0006 1.30E-02 SIMK DLYA CDVDIRKBmb027728 905.452502 2 905.4519 0.0006 1.30E-02 SIMK DLYA CDVDIRKBmb012212 905.452929 2 905.4519 0.001 1.20E-02 SIMK DLYA CDVDIRKBmb012614 905.452929 2 905.4519 0.001 1.20E-02 SIMK DLYA CDVDIRKBmb027728 905.452929 2 905.4519 0.001 1.20E-02 SIMK DLYA CDVDIRKBmb012212 905.451953 2 905.4519 0.0001 8.20E-03 SIMK DLYA CDVDIRKBmb012614 905.451953 2 905.4519 0.0001 8.20E-03 SIMK DLYA CDVDIRKBmb027728 905.451953 2 905.4519 0.0001 8.20E-03 SIMK DLYA CDVDIRKBmb012212 905.452123 3 905.4519 0.0002 2.20E-02 SIMK DLYA CDVDIRKBmb012614 905.452123 3 905.4519 0.0002 2.20E-02 SIMK DLYA CDVDIRKBmb027728 905.452123 3 905.4519 0.0002 2.20E-02 SIMK DLYA CDVDIRKBmb012212 3102.429173 3 3102.4339 -0.0047 1.10E-06 SIMK MQKE CDVDIRKDLYANTVMSGGTTMYPGIADRBmb012212 2233.029346 2 2233.0268 0.0025 2.60E-09 DIRK MQKE DLYANTVMSGGTTMYPGIADRBmb012212 2233.03789 2 2233.027 0.011 1.40E-10 DIRK MQKE DLYANTVMSGGTTMYPGIADRBmb012212 2233.024706 2 2233.0268 -0.0021 9.50E-07 DIRK MQKE DLYANTVMSGGTTMYPGIADRBmb012212 1530.861852 3 1530.8564 0.0054 5.90E-03 IADR IKII MQKEITALAPSTIKBmb012212 1530.863818 2 1530.8564 0.0074 6.70E-08 IADR IKII MQKEITALAPSTIKBmb012212 1530.863818 2 1530.8564 0.0074 2.60E-07 IADR IKII MQKEITALAPSTIKBmb012212 1530.860753 3 1530.8564 0.0043 4.90E-03 IADR IKII MQKEITALAPSTIKBmb012212 1530.863818 2 1530.8564 0.0074 6.10E-06 IADR IKII MQKEITALAPSTIKBmb012212 1530.862035 3 1530.8564 0.0056 1.90E-02 IADR IKII MQKEITALAPSTIKBmb012212 1164.750432 3 1164.7467 0.0037 6.60E-03 STIK YSVW IKIIAPPERKBmb012614 1164.750432 3 1164.7467 0.0037 6.60E-03 STMK YSVW IKIIAPPERKBmb027728 1164.750432 3 1164.7467 0.0037 6.60E-03 STMK YSVW IKIIAPPERKBmb012212 1164.748693 3 1164.7467 0.002 1.40E-03 STIK YSVW IKIIAPPERK
Bmb012614 1164.748693 3 1164.7467 0.002 1.40E-03 STMK YSVW IKIIAPPERKBmb027728 1164.748693 3 1164.7467 0.002 1.40E-03 STMK YSVW IKIIAPPERKBmb012212 1164.750432 3 1164.7467 0.0037 1.40E-03 STIK YSVW IKIIAPPERKBmb012614 1164.750432 3 1164.7467 0.0037 1.40E-03 STMK YSVW IKIIAPPERKBmb027728 1164.750432 3 1164.7467 0.0037 1.40E-03 STMK YSVW IKIIAPPERKBmb012614 3102.486668 3 3101.473 1.014 1.50E-02 IMKC MQKE DVDIRKDLYANTVLSGGTTMYPGIADRBmb027728 3102.486668 3 3101.473 1.014 1.50E-02 IMKC MQKE DVDIRKDLYANTVLSGGTTMYPGIADRBmb012614 3102.486668 3 3101.473 1.014 2.40E-03 IMKC MQKE DVDIRKDLYANTVLSGGTTMYPGIADRBmb027728 3102.486668 3 3101.473 1.014 2.40E-03 IMKC MQKE DVDIRKDLYANTVLSGGTTMYPGIADRBmb012614 2215.071338 2 2215.0704 0.001 3.00E-03 DIRK MQKE DLYANTVLSGGTTMYPGIADRBmb027728 2215.071338 2 2215.0704 0.001 3.00E-03 DIRK MQKE DLYANTVLSGGTTMYPGIADRBmb012614 2215.079394 2 2215.0704 0.009 3.40E-02 DIRK MQKE DLYANTVLSGGTTMYPGIADRBmb027728 2215.079394 2 2215.0704 0.009 3.40E-02 DIRK MQKE DLYANTVLSGGTTMYPGIADRBmb012614 1548.814623 2 1548.8128 0.0018 2.90E-08 IADR IKII MQKEITALAPSTMKBmb027728 1548.814623 2 1548.8128 0.0018 2.90E-08 IADR IKII MQKEITALAPSTMKBmb012614 1548.81223 3 1548.8128 -0.0006 2.40E-04 IADR IKII MQKEITALAPSTMKBmb027728 1548.81223 3 1548.8128 -0.0006 2.40E-04 IADR IKII MQKEITALAPSTMKBmb012614 1161.617236 2 1161.6188 -0.0016 2.60E-02 RMQK IKII EITALAPSTMKBmb027728 1161.617236 2 1161.6188 -0.0016 2.60E-02 RMQK IKII EITALAPSTMKBmb015061 1270.751653 3 1270.7482 0.0035 2.10E-05 KEEK LLEE LRKEVEALNAKBmb015061 1270.752019 3 1270.7482 0.0038 7.70E-05 KEEK LLEE LRKEVEALNAKBmb015061 2115.070604 2 2115.0681 0.0025 3.10E-13 LEEK ANKL TALLANLEGNQGSLAETQERBmb015061 1925.963353 3 1925.9567 0.0066 5.60E-03 TNQK VKQK TSEELQAAEDKVNHLNKBmb015061 1945.970922 3 1945.9717 -0.0008 3.50E-06 NKVK EKKL QKLEQTLDELEDSLERBmb015061 1244.652392 2 1244.6485 0.0039 7.80E-04 GDLK NKKE LTQEAVADLERBmb015061 1244.65227 2 1244.6485 0.0037 3.10E-06 GDLK NKKE LTQEAVADLERBmb015061 1936.980517 2 1936.9727 0.0078 7.00E-10 KLRR KKHN DLEEANIQHEATLANLRBmb015061 1936.975024 2 1936.9727 0.0023 2.20E-11 KLRR KKHN DLEEANIQHEATLANLRBmb015061 1936.979052 2 1936.9727 0.0063 2.80E-03 KLRR KKHN DLEEANIQHEATLANLRBmb015061 1936.981908 3 1936.9727 0.0092 6.90E-05 KLRR KKHN DLEEANIQHEATLANLRBmb015061 1936.981908 3 1936.9727 0.0092 4.20E-06 KLRR KKHN DLEEANIQHEATLANLRBmb015061 1341.643115 2 1341.6438 -0.0007 2.20E-06 EKER AGLD AQYFSEVNDLRBmb015061 1341.643115 2 1341.6438 -0.0007 6.60E-06 EKER AGLD AQYFSEVNDLRBmb015061 1451.763952 3 1451.7605 0.0034 3.50E-02 KIVK ADEA QLQHQLNEVQSKBmb015061 1434.738452 2 1434.734 0.0045 1.20E-06 KIVK ADEA QLQHQLNEVQSKBmb015061 1631.932775 3 1631.9331 -0.0003 1.70E-02 QLSK LADE IKVSLTTQLEDTKRBmb015061 1631.930956 2 1631.9331 -0.0021 3.00E-03 QLSK LADE IKVSLTTQLEDTKRBmb015061 1088.535344 3 1088.5335 0.0018 4.30E-02 DTKR ATLL LADEEARER
Page 1 and 2: Protein ID Precursor_mass Charge Ob
Page 3 and 4: Bmb027728 1171.574389 2 1171.5715 0
Page 5 and 6: Bmb012212 1623.856127 2 1623.841 0.
Page 7 and 8: Bmb015061 1936.981908 3 1936.9727 0
Page 9 and 10: Bmb005542 1344.734685 3 1344.7308 0
Page 11 and 12: Bmb008789 1615.838915 2 1615.8364 0
Page 13 and 14: Bmb003475 1053.631762 2 1053.61 0.0
Page 15 and 16: Bmb015183 1405.784246 3 1405.7802 0
Page 17 and 18: Bmb003747 3360.353369 3 3360.44 -0.
Page 19 and 20: Bmb000670 1798.950597 3 1798.935 0.
Page 21 and 22: Bmb032178 1945.95316 3 1945.9487 0.
Page 23 and 24: Bmb012614 976.451098 2 976.4487 0.0
Page 25 and 26: Bmb027728 1354.62749 2 1354.6238 0.
Page 27 and 28: Bmb012212 1790.899096 2 1790.8923 0
Page 29 and 30: Bmb015061 1125.55498 2 1125.5539 0.
Page 31 and 32: Bmb005542 1599.852724 2 1598.843 1.
Page 33 and 34: Bmb003475 2798.360204 3 2798.344 0.
Page 35 and 36: Bmb004930 1687.932543 2 1687.891 0.
Page 37 and 38: Bmb015062 971.507238 3 971.5062 0.0
Page 39 and 40: Bmb036625 1850.909716 2 1850.886 0.
Page 41 and 42: Bmb028514 1137.67058 2 1136.59 1.08
Page 43 and 44: Bmb012386 1321.697924 2 1321.6937 0
Page 45 and 46: Bmb012212 976.451098 2 976.4487 0.0
Page 47: Bmb012614 1354.62749 2 1354.6238 0.
Page 51 and 52: Bmb005542 1344.736333 3 1344.7308 0
Page 53 and 54: Bmb011274 1368.725164 3 1368.7196 0
Page 55 and 56: Bmb020953 1585.823657 2 1585.8258 -
Page 57 and 58: Bmb030760 1317.792773 2 1317.7893 0
Page 59 and 60: Bmb012212 1198.709277 2 1198.7059 0
Page 61 and 62: Bmb012614 1354.62456 2 1354.6238 0.
Page 63 and 64: Bmb027728 1132.529955 2 1132.5274 0
Page 65 and 66: Bmb015061 1058.540942 2 1058.5382 0
Page 67 and 68: Bmb005542 1808.979467 3 1808.9757 0
Page 69 and 70: Bmb016644 1262.644213 2 1262.6413 0
Page 71 and 72: Bmb031723 1077.534459 3 1077.5328 0
Page 73 and 74: Bmb003475 1053.605029 2 1053.6096 -
Page 75 and 76: Bmb011274 1512.758123 3 1512.752 0.
Page 77 and 78: Bmb024911 1183.672724 2 1183.6685 0
Page 79 and 80: Bmb000857 1139.592724 2 1139.5999 -
Page 81 and 82: Bmb014252 1970.057787 2 1970.038 0.
Page 83 and 84: Bmb021504 1066.685094 3 1066.6848 0
Page 85 and 86: Bmb027728 976.449267 2 976.4487 0.0
Page 87 and 88: Bmb012212 2507.186254 3 2507.177 0.
Page 89 and 90: Bmb012614 1954.073535 2 1954.0648 0
Page 91 and 92: Bmb027728 905.452136 2 905.43 0.022
Page 93 and 94: Bmb015061 1159.633227 2 1159.6322 0
Page 95 and 96: Bmb005542 1229.68767 2 1229.6853 0.
Page 97 and 98: Bmb032868 1435.753222 2 1435.7544 -
Page 99 and 100:
Bmb028865 1143.640673 2 1143.6347 0
Page 101 and 102:
Bmb011628 1090.57622 2 1090.5743 0.
Page 103 and 104:
Bmb020953 2101.124242 3 2101.093 0.
Page 105 and 106:
Bmb038322 1393.716723 2 1393.689 0.
Page 107 and 108:
Bmb000857 1863.947314 2 1863.917 0.
Page 109 and 110:
Bmb028401 1982.046361 3 1981.146 0.
Page 111 and 112:
Bmb039472 765.472724 2 765.4734 -0.
Page 113 and 114:
Bmb012614 976.449816 2 976.4487 0.0
Page 115 and 116:
Bmb027728 2507.181859 3 2507.177 0.
Page 117 and 118:
Bmb012212 1623.847094 2 1623.8415 0
Page 119 and 120:
Bmb027728 1161.619189 2 1161.6188 0
Page 121 and 122:
Bmb005542 1344.734502 3 1344.7308 0
Page 123 and 124:
Bmb008789 1620.840795 3 1620.836 0.
Page 125 and 126:
Bmb033948 1393.716723 2 1393.7114 0
Page 127 and 128:
Bmb015183 1120.600512 2 1120.6001 0
Page 129 and 130:
Bmb004877 1408.831957 2 1408.8275 0
Page 131 and 132:
Bmb012672 1321.63933 2 1321.6387 0.
Page 133 and 134:
Bmb012212 1028.603442 2 1028.6004 0
Page 135 and 136:
Bmb012614 1515.754827 3 1515.7496 0
Page 137 and 138:
Bmb027728 1548.817723 3 1548.8128 0
Page 139 and 140:
Bmb016644 1457.85808 2 1457.84 0.01
Page 141 and 142:
Bmb028865 1143.636523 2 1143.6347 0
Page 143 and 144:
Bmb015183 1405.78333 3 1405.7802 0.
Page 145 and 146:
Bmb033948 1109.593188 2 1109.574 0.
Page 147 and 148:
Bmb019690 1291.570727 2 1291.5666 0
Page 149 and 150:
Bmb020698 1219.69608 3 1219.691 0.0
Page 151 and 152:
Bmb012212 976.451281 2 976.4487 0.0
Page 153 and 154:
Bmb012614 2507.187169 3 2507.177 0.
Page 155 and 156:
Bmb027728 1132.530566 2 1132.5274 0
Page 157 and 158:
Bmb015061 1058.542162 2 1058.5382 0
Page 159 and 160:
Bmb005542 1001.614306 2 1001.6106 0
Page 161 and 162:
Bmb011628 1438.7083 2 1438.678 0.03
Page 163 and 164:
Bmb000857 1658.81853 2 1658.8177 0.
Page 165 and 166:
Bmb002610 1027.552724 2 1027.5575 -
Page 167 and 168:
Bmb023836 1432.71477 2 1432.689 0.0
Page 169 and 170:
Bmb000281 2342.485448 3 2340.245 2.
Page 171 and 172:
Bmb012212 976.451342 2 976.4487 0.0
Page 173 and 174:
Bmb012614 1171.574023 2 1171.5715 0
Page 175 and 176:
Bmb027728 905.452136 2 905.4519 0.0
Page 177 and 178:
Bmb005542 1808.984423 2 1808.9757 0
Page 179 and 180:
Bmb015183 1025.61394 2 1025.6106 0.
Page 181 and 182:
Bmb015063 1345.721349 3 1345.7148 0
Page 183 and 184:
Bmb004930 909.504443 2 909.5044 0 1
Page 185 and 186:
Bmb022619 1131.612231 2 1131.6082 0
show all

Supplementary Table S1

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?