PPT - Molecular Modelling & Bioinformatics Group

More documents

Recommendations

Info

Threading / Fold Recognition >MyProtein MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQLNPDTRIIGVGRADWD KAAYTKVVREALETFMKETIDEGLWDTLSARLDFCNLDVNDTAAFSRLGAMLDQ KNRITINYFAMPPSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQ VGEYFEECQVYRIDHYLGKETVLNLLALRFANSLFVNNWDNRTIDHVEITV
Structure Alignment http://www.ebi.ac.uk/dali/index.html
Page 1 and 2: Bioinformatics Structural and funct
Page 3 and 4: Material and Evaluation • Exercis
Page 5 and 6: • Bioinformatics or computational
Page 7 and 8: The Human Genome Project
Page 9 and 10: Bioinformatics Computer Tools Model
Page 11 and 12: Growth of the Databases Data Inform
Page 13 and 14: Bioinformatics Tools Linux Perl
Page 15 and 16: Blosum Matrix Protein Sequence Alig
Page 17 and 18: BLAST
Page 19: GenScan
Page 23 and 24: Protein Structure Prediction
Page 25: Homology Modeling >MyProtein MAVTQT
Page 29 and 30: Vienna RNA Package RNAFold Michael
Page 31 and 32: Protein function: Protein Docking
Page 33 and 34: Bioinformatics Databases
Page 35 and 36: FTP accession
Page 38 and 39: Databases Conflicts Gene Prediction
Page 40 and 41: Major Public Databases European Mol
Page 42: UCSC Genome Browser
Page 45: We look forward to working with you
Page 49 and 50: OMIM
Page 53: ENSEMBL
Page 56 and 57: http://www.sanger.ac.uk/
Page 58 and 59: Protein Databases
Page 60 and 61: Swiss-Prot TrEMBL
Page 62 and 63: Protein Data Base http://www.pdb.or
Page 64 and 65: http://www.expasy.org/prosite/
Page 66 and 67: http://www.ebi.ac.uk/interpro/
Page 68 and 69: Gene Ontology http://www.geneontolo
Page 70 and 71: State-of-the-art in Bioinformatics
Page 72 and 73: INB Map
Page 74: http://bioinfo.ochoa.fib.es/
Page 77:
INB:Taberna http://http://taverna.s
show all

PPT - Molecular Modelling & Bioinformatics Group

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?