Databases and Comparisons - CMB Education - Karolinska Institutet

More documents

Recommendations

Info

Example of EMBL entry, cont.RN [1]RA Sutcliffe R.G.;RT ;RLRLRLXXRN [2]...XXDRDRSubmitted (25-OCT-1990) to the EMBL/GenBank/DDBJ databases.Sutcliffe R.G., Dept. of Genetics, Church Sreet Glasgow University,Glasgow G11, 5JS.GDB; 120056; HSD3B1.SWISS-PROT; P14060; 3BH1_HUMAN.XXFH Key Location/QualifiersFHFT source 1..1528FTFTFTFT/organism="Homo sapiens"/tissue_type="placenta"/clone_lib="lambda gt11"/clone="1/6,B/6"Linköping University & Karolinska Institutet 26
Example of EMBL entry, cont.FT CDS 1..1122FT/db_xref="PID:g23862"FTFTFTFTFTFTFTFTFTFT/db_xref="SWISS-PROT:P14060"/EC_number="1.1.1.145"/product="3-beta-hydroxy-5-ene steroid dehydrogenase"/translation="MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ"FT mRNA 1..1528FT/evidence=EXPERIMENTALFT/note="3-beta-hydroxy-5-ene steroid dehydrogenase"FT polyA_signal 1511..1516Linköping University & Karolinska Institutet 27
Page 1 and 2: Introduction to BioinformaticsDatab
Page 3 and 4: Genome comparisons
Page 5 and 6: Completed genomesGenome sizeMb10000
Page 7 and 8: Genome comparisonsH. sapienscluster
Page 9 and 10: Protein foldingDNAProtein?Linköpin
Page 11 and 12: Molecular modellingHomology modelli
Page 13 and 14: Docking of bile acids into class I
Page 15 and 16: Predictions of important regionsCom
Page 17 and 18: Conserved amino acid residuesLinkö
Page 19 and 20: Databases with sequence information
Page 21 and 22: Example of Swissprot entryID 2BHD_S
Page 23 and 24: TrEMBLA computer-annotated suppleme
Page 25: Example of EMBL entryID HS3B5H5E st
Page 29 and 30: Example of PDB entryHEADER OXIDORED
Page 31 and 32: Example of PDB entry, cont.SEQRES 1
Page 33 and 34: Pairwise sequence comparisons
Page 35 and 36: Why comparisons?Identification of p
Page 37 and 38: Results from diagonal plot analysis
Page 39 and 40: Improved comparisons 1Not just cons
Page 41 and 42: Selection of scoring matrixThe scor
Page 43 and 44: Using scoring matrixS 0 0 0 0 0=4C
Page 45 and 46: PAM, cont.The PAM series are based
Page 47 and 48: BLOSUMOne assumption inherent in th
Page 49 and 50: Improved comparisons 2Introduction
Page 51 and 52: Gap penaltyThe score from all pairs
Page 53 and 54: Lipman & PearsonFASTAIdentities / S
Page 55 and 56: Results from FASTA run, histogramop
Page 57 and 58: Results from FASTA run, alignment>>
Page 59 and 60: Caution with the interpretationsAn
Page 61 and 62: EBI home pageLinköping University
Page 63 and 64: http://www.ebi.ac.uk/fasta33/Linkö
Page 65 and 66: BLASTFast algorithmLocal installati
Page 67 and 68: NCBI home pageLinköping University
Page 69 and 70: Basic BLASTLinköping University &
Page 71 and 72: Basic BLAST, resultsLinköping Univ
Page 73 and 74: FASTA parametersScoring matrix- BLO
Page 75 and 76: Statistics, high penalties (48, 8)L
Page 77 and 78:
Effect on alignment by gap penaltie
Page 79 and 80:
Multiple sequence alignmentsCharact
Page 81 and 82:
Clustering + AligningClustalAll-aga
Page 83 and 84:
ClustalW main menu****************
Page 85 and 86:
Pairwise alignment parameters******
Page 87 and 88:
ClustalW at EBI, Submission formLin
Page 89 and 90:
waiting ...Linköping University &
Page 91 and 92:
ClustalW, Scores TableLinköping Un
Page 93 and 94:
ClustalW, Guide Tree & CladogramLin
Page 95 and 96:
JalViewA new experimental option ha
Page 97 and 98:
Sequence formats in ClustalW Pearso
Page 99 and 100:
Kalign, AlignmentLinköping Univers
Page 101 and 102:
PSI-BLASTQuery sequenceFound homolo
Page 103 and 104:
PSI-BLAST, resultsLinköping Univer
Page 105 and 106:
Expect valuesThe first of these (up
Page 107 and 108:
Advanced OptionsIn the "Advanced Op
Page 109 and 110:
Set the output formatting optionsBy
Page 111 and 112:
Output from initial BLAST searchThe
Page 113 and 114:
Examination, cont.Sequences produci
Page 115 and 116:
Examination, cont.sp|P42297|YXIE_BA
Page 117 and 118:
Performing PSI-BLAST iterationsThe
Page 119:
Assignment 1Sequence comparisons- F
show all

Databases and Comparisons - CMB Education - Karolinska Institutet

Create successful ePaper yourself

Delete template?

Save as template?