1-s2.0-S016816050500406X-main
You also want an ePaper? Increase the reach of your titles
YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.
International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Review<br />
The role and application of enterococci in food and health<br />
M.R. Foulquié Moreno a,1 , P. Sarantinopoulos b,1,2 , E. Tsakalidou b , L. De Vuyst a, *<br />
a Research Group of Industrial Microbiology, Fermentation Technology and Downstream Processing (IMDO), Department of Applied Biological Sciences and<br />
Engineering, Vrije Universiteit Brussel (VUB), Pleinlaan 2, B-1050 Brussels, Belgium<br />
b Laboratory of Dairy Research, Department of Food Science and Technology, Agricultural University of Athens, Iera Odos 75, 118 55 Athens, Greece<br />
Received 19 February 2005; accepted 5 June 2005<br />
www.elsevier.com/locate/ijfoodmicro<br />
Abstract<br />
The genus Enterococcus is the most controversial group of lactic acid bacteria. Studies on the microbiota of many traditional cheeses in the<br />
Mediterranean countries have indicated that enterococci play an important role in the ripening of these cheeses, probably through proteolysis,<br />
lipolysis, and citrate breakdown, hence contributing to their typical taste and flavour. Enterococci are also present in other fermented foods, such<br />
as sausages and olives. However, their role in these products has not been fully elucidated. Furthermore, the production of bacteriocins by<br />
enterococci is well documented. Moreover, enterococci are nowadays used as probiotics. At the same time, however, enterococci have been<br />
associated with a number of human infections. Several virulence factors have been described and the number of vancomycin-resistant<br />
enterococci is increasing. The controversial nature of enterococci has prompted an enormous increase in scientific papers and reviews in recent<br />
years, where researchers have been divided into two groups, namely pro and contra enterococci. To the authors’ impression, the negative traits<br />
have been focused on very extensively. The aim of the present review is to give a balanced overview of both beneficial and virulence features of<br />
this divisive group of microorganisms, because it is only acquaintance with both sides that may allow their safe exploitation as starter cultures or<br />
co-cultures.<br />
D 2005 Elsevier B.V. All rights reserved.<br />
Keywords: Enterococcus; Food; Health; Functional properties; Pathogenesis<br />
Contents<br />
1. The genus Enterococcus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2<br />
2. Functional properties of enterococci . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2<br />
2.1. Bacteriocin production by enterococci. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2<br />
2.2. Citrate metabolism by enterococci. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3<br />
2.3. Proteolysis and lipolysis by enterococci . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5<br />
2.3.1. Proteolysis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5<br />
2.3.2. Lipolysis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6<br />
2.4. Enterococci as probiotics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7<br />
3. Pathogenesis of enterococci. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8<br />
3.1. Cytolytic activity of enterococci . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8<br />
3.2. Antibiotic resistance of enterococci . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9<br />
3.3. Virulence factors of enterococci . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9<br />
* Corresponding author. Tel.: +32 2 6293245; fax: +32 2 6292720.<br />
E-mail address: ldvuyst@vub.ac.be (L. De Vuyst).<br />
1 M.R. Foulquié Moreno and P. Sarantinopoulos have equally contributed to this manuscript.<br />
2 Current address: DSM Food Specialties, Research and Development, Process Technology Department, P.O. Box 1, 2600 MA, Delft, The Netherlands.<br />
0168-1605/$ - see front matter D 2005 Elsevier B.V. All rights reserved.<br />
doi:10.1016/j.ijfoodmicro.2005.06.026
2<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
3.3.1. Aggregation substance. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10<br />
3.3.2. Gelatinase . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10<br />
3.3.3. Extracellular surface protein . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10<br />
3.4. Opsonophagocytic assay to assess the safety of potential enterococcal pathogens . . . . . . . . . . . . . . . . . . . . . . . 10<br />
4. Enterococci in food . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10<br />
4.1. Cheese products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10<br />
4.1.1. Presence of enterococci in cheese . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11<br />
4.1.2. Applicability of enterococci as starter or adjunct cultures in cheese . . . . . . . . . . . . . . . . . . . . . . . . . 12<br />
4.1.3. Applicability of bacteriocinogenic enterococci and/or their enterocins in cheese . . . . . . . . . . . . . . . . . . . 12<br />
4.2. Meat products . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14<br />
4.2.1. Presence of enterococci in meat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14<br />
4.2.2. Applicability of bacteriocinogenic enterococci and/or their enterocins in meat products . . . . . . . . . . . . . . . 15<br />
4.3. Vegetables and olives. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15<br />
5. Conclusions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16<br />
Acknowledgments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16<br />
References . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16<br />
1. The genus Enterococcus<br />
The genus Enterococcus belongs to a group of microorganisms<br />
known as lactic acid bacteria (LAB). Enterococci<br />
are Gram-positive, non-sporeforming, catalase-negative, oxidase-negative,<br />
facultative anaerobic cocci that occur singly,<br />
in pairs, or in chains. From a taxonomic point of view, the<br />
genus Enterococcus has been reviewed several times<br />
(Schleifer and Kilpper-Bälz, 1987; Stackebrandt and Teuber,<br />
1988; Devriese and Pot, 1995; Hardie and Whiley, 1997). In<br />
1984, DNA–DNA hybridisation and 16S rRNA sequencing<br />
studies indicated that the species Streptococcus faecium and<br />
S. faecalis were sufficiently distinct from other streptococci,<br />
and Schleifer and Kilpper-Bälz (1984) proposed their<br />
transfer to the genus Enterococcus. To date, 28 species,<br />
namely E. asini, E. avium, E. canis, E. casseliflavus, E.<br />
cecorum, E. columbae, E. dispar, E. durans, E. faecalis, E.<br />
faecium, E. flavescens, E. gallinarum, E. gilvus, E.<br />
haemoperoxidus, E. hirae, E. malodoratus, E. moraviensis,<br />
E. mundtii, E. pallens, E. phoeniculicola, E. pseudoavium,<br />
E. raffinosus, E. ratti, E. saccharolyticus, E. saccharominimus,<br />
E. solitarius, E. sulfureus, and E. villorum, have<br />
been added to the genus on the basis of phylogenetic<br />
evidence strengthened by 16S rRNA DNA sequencing and/<br />
or DNA–DNA hybridization studies. However, some reclassifications<br />
may occur in the near future. For instance, E.<br />
flavescens and E. casseliflavus have insufficient differences<br />
to be classified separately (Devriese and Pot, 1995;<br />
Descheemaeker et al., 1997), and E. avillorum is an earlier<br />
heterotypic synonym of E. porcinus (De Graef et al., 2003).<br />
Enterococci grow optimally at a temperature of 35 -C,<br />
although most species in the genus will grow at temperatures<br />
ranging from 10 to 45 -C. They can also grow in the<br />
presence of 6.5% NaCl, at pH 9.6, and they survive heating<br />
at 60 -C for 30 min. Exceptions include E. dispar and E.<br />
sulfureus (Martínez-Murcia and Collins, 1991), E. malodoratus<br />
(Collins et al., 1984) and E. moraviensis (Svec et al.,<br />
2001), which do not grow at 45 -C, and E. cecorum and E.<br />
columbae, which do not grow at 10 -C (Devriese et al.,<br />
1993). E. avium, E. saccharominimus, E. cecorum and E.<br />
columbae grow poorly or not at all in the presence of 6.5%<br />
NaCl (Devriese et al., 1990, 1993; Vancanneyt et al., 2004).<br />
Most enterococcal species can hydrolyse aesculin in the<br />
presence of 40% bile salts. Enterococcal species possess the<br />
Lancefield group D antigen with the exception of E.<br />
cecorum, E. columbae, E. dispar, E. pseudoavium, E.<br />
saccharolyticus and E. sulfureus (Hardie and Whiley,<br />
1997). E. mundtii and E. casseliflavus are yellow-pigmented,<br />
and E. gallinarum and E. casseliflavus are motile (Schleifer<br />
and Kilpper-Bälz, 1987).<br />
2. Functional properties of enterococci<br />
Studies on the microbiota of traditional cheeses in the<br />
Mediterranean countries, which are <strong>main</strong>ly produced from<br />
raw ewes’ or goats’ milk, and less commonly from cows’<br />
milk, have indicated that enterococci play an important role<br />
in the ripening of these cheeses, probably through proteolysis,<br />
lipolysis, and citrate breakdown, hence contributing to<br />
their typical taste and flavour, (Coppola et al., 1990;<br />
Litopoulou-Tzanetaki and Tzanetakis, 1992; Ledda et al.,<br />
1994; Giraffa et al., 1997; Manolopoulou et al., 2003). They<br />
are also present in other fermented food products, such as<br />
sausages (Franz et al., 1999a, 2003; Giraffa, 2002; Hugas et<br />
al., 2003) and olives (Fernández-Diaz, 1983; Franz et al.,<br />
1996, 1999a; Floriano et al., 1998; Ben Omar et al., 2004).<br />
Enterococci have the ability to produce bacteriocins, the socalled<br />
enterocins, which are small peptides with antimicrobial<br />
activity towards closely related Gram-positive bacteria<br />
including spoilage or pathogenic bacteria, such as Listeria<br />
(De Vuyst and Vandamme, 1994). Moreover, enterococci are<br />
used in some countries as probiotics (Franz et al., 1999a,<br />
2003).<br />
2.1. Bacteriocin production by enterococci<br />
The bacteriocins produced by LAB belong to the large<br />
group of ribosomally synthesised, small, cationic, amphiphilic<br />
(rather hydrophobic), antimicrobial peptides, naturally produced<br />
by microorganisms, which vary in spectrum and mode of
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 3<br />
activity, molecular structure and molecular mass, thermostability,<br />
pH range of activity, and genetic determinants (Klaenhammer,<br />
1993; De Vuyst and Vandamme, 1994; Nes et al.,<br />
1996; Nissen-Meyer and Nes, 1997; Moll et al., 1999; Ennahar<br />
et al., 2000; Cleveland et al., 2001; McAuliffe et al., 2001;<br />
Riley and Wertz, 2002).<br />
Based on structural, physicochemical and molecular properties,<br />
bacteriocins from LAB can be subdivided into three<br />
major classes (Klaenhammer, 1993; Nes et al., 1996).<br />
Nonetheless, this classification is continuously being reviewed<br />
and it is evolving with the accumulation of knowledge and the<br />
appearance of new bacteriocins (Cleveland et al., 2001;<br />
Ennahar et al., 2000; Riley and Wertz, 2002; Rodríguez et<br />
al., 2003). Class I bacteriocins are lantibiotics, i.e. small,<br />
cationic, hydrophobic, and heat-stable peptides that contain<br />
unusual amino acids (e.g. the thioether amino acids lanthionine<br />
and/or 3-methyl-lanthionine) that are post-translationally<br />
formed. Class II bacteriocins are small, cationic, hydrophobic,<br />
heat-stable peptides that are not post-translationally modified,<br />
except for cleavage of a leader peptide from the prebacteriocin<br />
peptide. Within this class, three subclasses can be distinguished:<br />
subclass IIa or pediocin-like bacteriocins with a strong<br />
antilisterial effect, possessing the consensus sequence YGNGV<br />
in their N-terminus; subclass IIb or bacteriocins that require<br />
two polypeptide chains for full activity; and subclass IIc or<br />
bacteriocins that do not belong to the other subgroups. Class III<br />
bacteriocins are a group of large, hydrophilic, heat-labile<br />
proteins.<br />
Since 1955, when the first bacteriocin-like substance within<br />
the group D streptococci was reported (Kjems, 1955), a large<br />
number of enterocins has been studied. Krämer and Brandis<br />
(1975) reported the anti-Listeria activity of the enterocin E1A<br />
produced by E. faecium E1. Nowadays, the ability of<br />
enterococci to inhibit Listeria spp. is well known, which may<br />
be explained by the close phylogenetic relationship of<br />
enterococci and listeriae (Stackebrandt and Teuber, 1988;<br />
Devriese and Pot, 1995). The first enterocin purified to<br />
homogeneity was the enterocin AS-48 produced by E. faecalis<br />
S-48 (Gálvez et al., 1989; Martínez-Bueno et al., 1994), which<br />
was defined as a cyclic peptide antibiotic. Since then, the<br />
number of new enterocins characterised is increasing. However,<br />
many of these molecules have not been purified to<br />
homogeneity. This is the case for the bacteriocins produced<br />
by E. faecalis E-1 (Bottone et al., 1971), E. faecium E1<br />
(Krämer and Brandis, 1975), E. faecalis E23 (Nakagawa,<br />
1979), E. faecium (Harasawa et al., 1980), E. faecium S-34<br />
(Nakagawa and Matsuo, 1981), E. faecium 3(Krämer et al.,<br />
1983), E. faecium 25 (Reichelt et al., 1984), E. faecalis K4<br />
(Kühnen et al., 1985), E. faecalis DS16 (Ike et al., 1990), E.<br />
faecium 100 (Kato et al., 1993), E. faecalis 226 NWC (Villani<br />
et al., 1993), E. faecium NA01 (Olasupo et al., 1994), E.<br />
faecium 7C5 (Torri Tarelli et al., 1994), and E. faecium L1<br />
(Lyon et al., 1995).<br />
Enterocins are found within the class I, class IIa, class IIc,<br />
and class III bacteriocins mentioned above (Table 1). Other<br />
enterocins that at first were considered as new enterocins, but<br />
were actually identical to existing ones, are listed in Table 2. In<br />
addition, the bacteriocins produced by E. faecalis strains are<br />
referred to as:<br />
Type 1: cytolysin (bacteriocin/hemolysin) from E. faecalis<br />
DS16 (Gilmore et al., 1994). This two-component lantibiotic<br />
displays both hemolytic and bacteriocin activity.<br />
Type 2: the cyclic peptide antibiotic AS-48 (enterocin AS-<br />
48) from E. faecalis S-48 (Martínez-Bueno et al., 1994).<br />
This compound is active towards both Gram-positive and<br />
Gram-negative bacteria. In contrast, the identical enterocin 4<br />
produced by E. faecalis INIA 4 is only active towards<br />
Gram-positive bacteria (Joosten et al., 1996).<br />
Type 3: bacteriocin 31 from E. faecalis YI17 (Tomita et al.,<br />
1996) with a narrow antibacterial spectrum.<br />
Type 4: enterocin 1071A and enterocin 1071B from E.<br />
faecalis BEF 1071 (Balla et al., 2000). These enterocins<br />
present an activity spectrum narrower than Type 2 and<br />
broader than Type 3 enterocins produced by E. faecalis.<br />
Enterocins, as most bacteriocins, have the cytoplasmic<br />
membrane as their primary target. They form pores in the cell<br />
membrane, thereby depleting the transmembrane potential and/<br />
or the pH gradient, resulting in the leakage of indispensable<br />
intracellular molecules (Cleveland et al., 2001).<br />
2.2. Citrate metabolism by enterococci<br />
Citrate is present in many raw materials that are used in food<br />
fermentations, such as fruit, vegetables, and milk, and it is also<br />
used as an additive for the production of fermented sausages.<br />
The behavior of LAB may differ from one species to another,<br />
and not all LAB are able to metabolize citrate. The ability to<br />
metabolize citrate is invariably linked to endogenous plasmids<br />
that contain the gene encoding the transporter, which is<br />
responsible for citrate uptake from the medium. Since citrate<br />
is a highly oxidized substrate, no reducing equivalents, such as<br />
NADH, are produced during its degradation, which results in<br />
the formation of metabolic end products other than lactic acid.<br />
These include diacetyl, acetaldehyde, acetoin, and 2,3-butanediol,<br />
which have very distinct aroma properties and significantly<br />
influence the quality of fermented foods (Hugenholtz,<br />
1993). For instance, diacetyl determines the aromatic properties<br />
of fresh cheese, fermented milk, cream, and butter. The<br />
breakdown of citrate also results in the production of carbon<br />
dioxide, which can contribute to the texture of some fermented<br />
dairy products.<br />
Most of the knowledge on the metabolic pathways involved<br />
in citrate metabolism has been derived from LAB of dairy<br />
origin, although citrate itself does not always support their<br />
growth. This claim is based on the inability of certain LAB to<br />
grow in batch cultures to which excess citrate was added as the<br />
sole energy source. Nevertheless, most LAB are able to cometabolize<br />
citrate in the presence of another energy source,<br />
such as glucose or lactose. The metabolism of citric acid has<br />
been extensively studied and is well documented in strains of<br />
Lactococcus, Lactobacillus, and Leuconostoc (Drinan et al.,<br />
1976; Cogan, 1987; Kennes et al., 1991; Starrenburg and
4<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Table 1<br />
Enterocins produced by enterococci classified as class I, class II, or class III bacteriocins<br />
Class I Producer strain Amino acid sequence of the purified enterocin Reference a<br />
Cyl L L E. faecalis DS16 MENLSVVPSFEELSVEEMEAIQGSGDVQAETTPVQ<br />
Gilmore et al., 1994<br />
CAVAATAAASSAACGWVGGGIFTGVTVVVSLKHC<br />
Cyl L S E. faecalis DS16 VLNKENQENYYSNKLELVGPSFEELSLEEMEAIQGQ<br />
SGDVQAETTPACFTIGLGVGALFSAKFC<br />
Gilmore et al., 1994<br />
Class IIa Producer strain MM b Amino acid sequence of the purified enterocin pI c Reference<br />
Enterocin A E. faecium CTC492 4833 TTHSGKYYGNGVYCTKNKCTVDWAKATTQ<br />
9.0 Aymerich et al., 1996<br />
CIAGMSIGGFLGGAIPGKC<br />
Enterocin CRL 35 E. faecium CRL 35 KYYGNGVTLNKXGXSVNXXXA... Farías et al., 1996<br />
Bacteriocin 31 E. faecalis YI717 5009 ATYYGNGLYCNKQKCWVDWNKASREIGKIIQ<br />
9.7 Tomita et al., 1996<br />
VNGWVQHGPWAPR<br />
Enterocin P E. faecium P13 4630 ATRSYGNGVYCNNSKCWVNWGEAKENIAGIQ<br />
8.3 Cintas et al., 1997<br />
VISGWASGLAGMGH<br />
Mundticin E. mundtii AT06 4290 KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAQ<br />
9.8 Bennik et al., 1998<br />
ANLATGGAAGWSK<br />
Bacteriocin RC714 E. faecium RC714 4937 ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIQ<br />
9.3 del Campo et al., 2001<br />
VNGWVNHGPWAPR<br />
Enterocin SE-K4 E. faecalis K-4 4918 ATYYGNGVYCNKQKCWVDWSRARSEIIDRGQ<br />
VKAYVNGFTKVLG<br />
9.6 Eguchi et al., 2001<br />
Class IIc Producer strain MM Amino acid sequence of the purified enterocin pI Reference<br />
Enterocin AS-48 E. faecalis S-48 7167 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVQ<br />
GSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW<br />
10.6 Martínez-Bueno<br />
et al., 1994<br />
Enterocin B E. faecium T136 5465 ENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPQ 9.6 Casaus et al., 1997<br />
KGPLAWAAGLANVYSKCN<br />
Enterocin L50A E. faecium L50 5190 MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINQ 10.4 Cintas et al., 1998b<br />
KIIEWIKKHI<br />
Enterocin L50B E. faecium L50 5178 MGAIAKLVTKFGWPLIKKFYKQIMQFIGQGWTIDQ 10.7 Cintas et al., 1998b<br />
QIEKWLKRH<br />
Enterocin EJ97 E. faecalis EJ97 5328 MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQQ<br />
YGRYPWERPVA<br />
10.8 Gálvez et al., 1998;<br />
Sánchez-Hidalgo et al., 2003<br />
Enterocin Q E. faecium L50 3952 MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC 9.7 Cintas et al., 2000<br />
Enterocin 1071A E. faecalis BEF 1071 4286 ESVFSKIGNAVGPAAYWILKGLGNMSDVNQAQ<br />
DRINRKKH<br />
10.3 Balla et al., 2000;<br />
Franz et al., 2002<br />
Enterocin 1071B E. faecalis BEF 1071 3899 GPGKWLPWLQPAYDFVTGLAKGIGKEGNKNKWKNV 10.4 Balla et al., 2000;<br />
Franz et al., 2002<br />
Enterocin RJ-11 E. faecalis RJ-11 5049 APAGLVAKFGRPIVKKYYKQIMQFIGEGSAINKIIPQ<br />
WIARMWRT<br />
11.1 Yamamoto et al., 2003<br />
Class III Producer strain MM Amino acid sequence of the purified enterocin pI Reference<br />
Enterolysin A E. faecalis LMG 2333 34501 ASNEWSWPLGKPYAGRYEEGQQFGNTAFNRGGTYQ<br />
FHDGFDFGSAIYGNGSVYAVHDGKILYAGWDPVGGQ<br />
GSLGAFIVLQAGNTNVIYQEFSRNVGDIKVSTGQTVQ<br />
KKGQLIGKFTSSHLHLGMTKKEWRSAHSSWNKDDQ<br />
GTWFNPIPILQGGSTPTPPNPGPKNFTTNVRYGLRVQ<br />
LGGSWLPEVTNFNNTNDGFAGYPNRQHDMLYIKVDQ<br />
KGQMKYRVHTAQSGWLPWVSKGDKSDTVNGAAGMQ<br />
PGQAIDGVQLNYITPKGEKLSQAYYRSQTTKRSGWLQ<br />
KVSADNGSIPGLDSYAGIFGEPLDRLQIGISQSNPF<br />
9.5 Nilsen et al., 2003<br />
a Reference dealing with the actual purification and amino acid sequence analysis.<br />
b MM (Da) calculated theoretically from the amino acid sequence (http://www.basic.nwu.edu/biotools/proteincalc.html).<br />
c pI calculated theoretically from the amino acid sequence (http://www.embl-heidelberg.de/cgi/pi-wrapper.pl).<br />
Hugenholtz, 1991; Hugenholtz et al., 1993; Palles et al., 1998;<br />
Kimoto et al., 1999; Goupry et al., 2000). In contrast, more<br />
limited and sporadic data concerning citrate metabolism by<br />
Enterococcus strains are available (Coventry et al., 1978;<br />
Hagrass et al., 1991; Urdaneta et al., 1995; Freitas et al., 1999).<br />
Nevertheless, during the last few years more studies have<br />
focused on citrate metabolism by enterococci (Sarantinopoulos<br />
et al., 2001a,b, 2003; Rea and Cogan, 2003a,b). This increased<br />
interest in citrate metabolism by Enterococcus strains has<br />
probably arisen due to the fact that enterococci, in particular the<br />
major species E. faecium and E. faecalis, frequently occur in<br />
large numbers in many cheeses, especially those manufactured<br />
in the Mediterranean area. Milk citrate catabolism by enterococci<br />
may explain, among other mechanisms, the role of<br />
enterococci in the development of the distinctive organoleptic<br />
properties of these cheeses.
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 5<br />
Table 2<br />
Enterocins described in the literature similar to existing enterocins<br />
Enterocin Actual enterocin Producer strain Reference<br />
Enterocin 4 Enterocin AS-48 E. faecalis INIA 4 Joosten et al., 1996<br />
Enterococcin EFS2 E. faecalis EFS2 Maisnier-Patin et al., 1996<br />
Bacteriocin 21 E. faecalis OG1X Tomita et al., 1997<br />
Enterocin 7C5 E. faecium 7C5 Folli et al., 2003<br />
Enterocin 900 Enterocin A E. faecium BFE 900 Franz et al., 1999b<br />
Enterocin 1146 E. faecium DPC1146 O’Keeffe et al., 1999<br />
Enterocin EFM01 E. faecium EFM01 Ennahar and Deschamps, 2000<br />
Enterocin P21 E. faecium P21 Herranz et al., 2001<br />
Enterocin 81 E. faecium WHE 81 Ennahar et al., 2001<br />
Enterocin N15 E. faecium N15 Losteinkit et al., 2001<br />
Enterocin BC25 E. faecium BC25 Morovský et al., 2001<br />
Enterocin CCM 4231 E. faecium CCM 4231 Foulquié Moreno et al., 2003a<br />
Enterocin 900 Enterocin B E. faecium BFE 900 Franz et al., 1999b<br />
Enterocin P21 E. faecium P21 Herranz et al., 2001<br />
Enterocin 81 E. faecium WHE 81 Ennahar et al., 2001<br />
Enterocin RZS C13 E. faecium RZS C13 Foulquié Moreno et al., 2003a<br />
Enterocin RZS C5 E. faecium RZS C5 Foulquié Moreno et al., 2003a<br />
Enterocin I Enterocin L50 E. faecium 6T1a Floriano et al., 1998<br />
Enterocin B2 E. faecium B2 Moreno et al., 2002<br />
Enterocin AA13 Enterocin P E. faecium AA13 Herranz et al., 1999<br />
Enterocin G16 E. faecium G16 Herranz et al., 1999<br />
Enterocin B1 E. faecium B1 Moreno et al., 2002<br />
Enterocin B2 E. faecium B2 Moreno et al., 2002<br />
Enterocin 1071A Enterocin 1071A E. faecalis FAIR-E 309 Franz et al., 2002<br />
Enterocin 1071B Enterocin 1071B E. faecalis FAIR-E 309 Franz et al., 2002<br />
Enterocin B2 Enterocin 1071 E. faecium B2 Moreno et al., 2002<br />
Almost 60 years ago, Campbell and Gunsalus (1944) and<br />
Gunsalus and Campbell (1944) showed that pH had a very<br />
significant effect on product formation from citrate in<br />
enterococci. Twenty-five years later, Devoyod (1969) pinpointed<br />
that E. faecalis subsp. liquefaciens had the ability to<br />
metabolize citrate in the absence of carbohydrates. Since then<br />
there appears to have been little work on citrate metabolism by<br />
enterococci, until Hagrass et al. (1991) studied two strains of E.<br />
faecalis, isolated from a fermented milk product. They showed<br />
that compounds, such as acetaldehyde and diacetyl, were<br />
produced via citrate metabolism. Raffe (1994) observed that E.<br />
faecalis strains, grown in skim milk, could produce lactic acid<br />
from lactose, and acetic acid from citrate. During the same<br />
period, Urdaneta et al. (1995) studied citrate metabolism in<br />
three E. faecalis strains, grown in synthetic media, having<br />
citrate as the sole energy source. All strains not only grew in<br />
those media, but they also produced acetate as the final<br />
product. Moreover, Freitas et al. (1999) concluded that E.<br />
faecalis and E. faecium strains, which were grown in sheeps’<br />
and goats’ milk, produced relatively high amounts of lactic<br />
acid and lower amounts of formate and acetate, indicating<br />
indirectly that lactose and citrate were co-metabolised.<br />
Recently, Sarantinopoulos et al. (2001b) showed that E.<br />
faecalis FAIR-E 229, a strain isolated from Cheddar cheese,<br />
was able to grow in skim milk, and co-metabolism of lactose<br />
and citrate took place. Moreover, when increasing initial<br />
concentrations of citrate were used as the sole energy source,<br />
the <strong>main</strong> end products were acetate and formate, as a result of<br />
citrate consumption. Surprisingly, the same strain did not<br />
utilize citrate in MRS broth containing lactose instead of<br />
glucose, and in MRS broth containing glucose with increasing<br />
citrate concentrations. This phenomenon was explained by<br />
Rea and Cogan (2003a) who studied the factors affecting cometabolism<br />
of citrate and glucose by growing and resting<br />
cells of three E. faecalis and two E. faecium strains. It was<br />
suggested that the presence of glucose prevents citrate<br />
utilization through catabolite repression, so that citrate can<br />
only be utilized when all of the glucose in the medium is<br />
consumed. The same authors suggested that catabolite<br />
repression by glucose and fructose occurs in E. faecalis<br />
strains, but this is not the case when galactose or sucrose are<br />
used as energy sources (Rea and Cogan, 2003b). In contrast,<br />
Sarantinopoulos et al. (2003) observed co-metabolism of<br />
glucose and citrate for an E. faecium strain, grown in MRS<br />
broth, both under aerobic and anaerobic conditions and<br />
uncontrolled pH. These results fully support the findings of<br />
Sarantinopoulos et al. (2001a) who, after an extensive<br />
screening of 129 E. faecalis, E. faecium and E. durans<br />
strains for general biochemical properties, showed that the<br />
above set of strains exhibited strain-to-strain variation<br />
concerning citrate metabolism, but with the majority of the<br />
E. faecalis strains able to utilize citrate.<br />
2.3. Proteolysis and lipolysis by enterococci<br />
2.3.1. Proteolysis<br />
The degradation of casein plays a major role in the<br />
development of texture in cheese. In addition, some peptides<br />
contribute to the formation of flavour, whereas other,<br />
undesirable bitter-tasting peptides can lead to off-flavours.
6<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Also, the secondary degradation of amino acids is considered<br />
to have a major impact on the flavour development in cheese.<br />
Besides the indigenous milk proteolytic enzymes and rennin<br />
used for protein coagulation, LAB cell wall-associated<br />
proteinases and intracellular peptidases released after cell<br />
lysis in the curd are considered to play an important role in<br />
casein hydrolysis during cheese preparation (Wilkinson et al.,<br />
1994).<br />
Studies performed so far concerning proteolysis by LAB are<br />
<strong>main</strong>ly restricted to the genera Lactococcus and Lactobacillus<br />
(Pritchard and Coolbear, 1993; Sousa et al., 2001). The<br />
biochemical pathways, which lead to casein degradation and<br />
peptide/amino acid transportation, are believed to be the same<br />
in the case of the other LAB, including the genus Enterococcus.<br />
However, only sporadic data exist in the literature<br />
regarding the proteolytic system of enterococci, in comparison<br />
with other LAB species. Even though there are no commonly<br />
accepted laboratory methods in the literature for determining<br />
proteolytic and peptidolytic activities, such activities are<br />
generally low for Enterococcus strains, with the exception of<br />
E. faecalis strains (Dovat et al., 1970; Arizcun et al., 1997;<br />
Macedo and Malcata, 1997; Suzzi et al., 2000; Andrighetto et<br />
al., 2001).<br />
The very first work concerning the proteolytic system of<br />
enterococci was performed by Somkuti and Babel (1969). They<br />
studied an extracellular proteinase, which was produced by an<br />
E. faecalis var. liquefaciens strain. This proteinase was able to<br />
hydrolytically degrade casein in an intensive way and it was<br />
less active against h-lactoglobulin and a-lactalbumin. In<br />
another relevant study during that period, Wallace and Harmon<br />
(1970) examined an intracellular protease of an E. durans<br />
strain. The protease was particularly active against casein and<br />
h-lactoglobulin, but it was not able to hydrolyze bovine serum<br />
albumin. Furthermore, Dovat et al. (1970) studied the<br />
proteolytic activity of enterococci in milk and showed that<br />
they exhibited low proteolytic activity, with the exception of<br />
strains belonging to the species E. faecalis var. liquefaciens.<br />
Almost 20 years later, Carrasco de Mendoza et al. (1989)<br />
determined in a more systematic study the extracellular<br />
proteolytic activity of 61 Enterococcus strains using sodium<br />
caseinate as substrate. They suggested that the proteolytic<br />
activity was strain- and time-dependent. After 48 h of<br />
incubation, strains belonging to E. faecalis species were more<br />
proteolytic, and this was more evident after 120 h. Furthermore,<br />
Wessels et al. (1990) examined 108 E. faecium, E.<br />
faecalis, and E. durans strains, isolated from various dairy<br />
products. A large percentage of these strains of all species were<br />
able to grow at 7 -C, and more than half of them showed<br />
proteolytic activity at psychrotrophic temperatures.<br />
In another work, Hegazi (1990a) studied the proteolysis of S.<br />
faecalis subsp. liquefaciens 3/6 in skim milk with some<br />
additives. It was suggested that calcium lactate and some<br />
inorganic phosphate salts do not influence casein hydrolysis. In<br />
contrast, calcium carbonate, which is frequently used as an<br />
additive in cheese manufacturing, resulted in a markedly<br />
reduction of hydrolysis levels. Also, low NaCl concentrations<br />
(2%, w/v) positively influenced casein breakdown, while higher<br />
concentrations inhibited it. The same author concluded that the<br />
activity of an extracellular proteinase produced by the same<br />
strain (S. faecalis subsp. liquefaciens 3/6) was reduced when<br />
the strain was grown in milk that was processed at high<br />
temperature (Hegazi, 1990b). This specific proteinase was able<br />
to hydrolyze casein, h-lactoglobulin and a-lactalbumin. The<br />
activity of the enzyme was strongly reduced in the presence of<br />
EDTA and for that reason it was considered a metalloenzyme.<br />
At the same time, Garcia de Fernando et al. (1991a,b)<br />
examined in depth the extracellular proteinase production by E.<br />
faecalis subsp. liquefaciens. The microorganism grew well and<br />
developed extracellular proteinase activity on proteinaceous<br />
media. The molar mass of the enzyme has been estimated to be<br />
approximately 30 kDa by Sephadex gel filtration and approximately<br />
26 kDa by sodium-dodecyl sulphate-polyacrylamide<br />
gel electrophoresis (SDS-PAGE). The isoelectric point has<br />
been found to be 4.6 and maximum enzyme activity of the<br />
proteinase has been observed at pH 7.5 and 45 -C. The enzyme<br />
hydrolyzed casein, bovine serum albumin, a-lactalbumin and<br />
h-lactoglobulin. Macedo et al. (2000) suggested that an E.<br />
faecium strain isolated from Serra cheese exhibited neglecting<br />
aminopeptidolytic and endopeptidolytic activity in synthetic<br />
media, in comparison with strains belonging to the species of<br />
L. paracasei, L. lactis, and Leuconostoc mesenteroides.<br />
Furthermore, Villani and Coppola (1994) examined the<br />
proteolytic activity of 24 E. faecium and 60 E. faecalis strains,<br />
after growth in skim milk, at 37 -C for 6 h. All E. faecalis<br />
strains were much more proteolytic, in comparison with the E.<br />
faecium strains. Quite recently, Andrighetto et al. (2001)<br />
showed that the majority of the 124 enterococcal strains<br />
studied, isolated from traditional Italian cheeses, displayed<br />
weak proteolytic activities in milk, but 30 of them belonging to<br />
the E. faecalis species were more proteolytic. Finally, the same<br />
conclusion was drawn in another systematic study performed<br />
by Sarantinopoulos et al. (2001a), who screened 129 E.<br />
faecium, E. faecalis, and E. durans strains for biochemical<br />
properties relevant to their technological performance. It was<br />
found that all strains exhibited low extracellular proteolytic and<br />
peptidolytic activities, with the E. faecalis strains being<br />
generally more active.<br />
2.3.2. Lipolysis<br />
Lipids have a major effect on the flavour and texture of<br />
cheese. They contribute to cheese flavour in three ways: (i)<br />
being a source of fatty acids, especially short-chain fatty acids,<br />
which may be converted to other sapid and aromatic<br />
compounds, especially methyl ketones and lactones; (ii) being<br />
a cause of oxidation of fatty acids, leading to the formation of<br />
various unsaturated aldehydes that are strongly flavored and<br />
thus cause a flavour defect referred to as oxidative rancidity;<br />
(iii) being solvents for sapid and aromatic compounds,<br />
produced not only from lipids, but also from proteins and<br />
lactose. Milk fat hydrolysis during cheese manufacture and<br />
ripening is due to the endogenous milk lipase, the lipolytic<br />
enzymes of starter cultures and non-starter bacteria, lipases<br />
from psychrotrophic bacteria, and–depending on the cheese<br />
variety–exogenous enzyme preparations (El Soda et al., 1995).
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 7<br />
LAB are generally considered to be weakly lipolytic, as<br />
compared with other groups of microorganisms. However, it is<br />
believed that lipolytic activity by LAB plays an important role<br />
in the determination of the special aroma of many different<br />
cheeses. Certain LAB, which are used as bulk starter cultures<br />
(Lactococcus and Lactobacillus), together with some other<br />
bacteria (Leuconostoc, Enterococcus, Pediococcus, and Micrococcus),<br />
which can survive pasteurization and/or contaminate<br />
cheese during maturation, are believed to significantly<br />
contribute to cheese fat hydrolysis (El Soda et al., 1995;<br />
Collins et al., 2003). Concerning the lipolytic activity of<br />
enterococci, limited and often contradictory data exist in the<br />
literature.<br />
The first work regarding the lipolytic and esterolytic<br />
activities of enterococci was performed by Lund (1965), who<br />
determined electrophoretically the presence of esterases in cellfree<br />
extracts of E. faecalis, E. faecium and E. durans strains.<br />
The electrophoretic pattern of the E. faecalis strains was<br />
different compared to the patterns of the other two species.<br />
Moreover, E. faecalis strains exhibited higher activity, as<br />
determined on the basis of the intensity of the esterolytic bands.<br />
At the same time, Dovat et al. (1970) studied the lipolytic<br />
activity of 16 Enterococcus and 5 Streptococcus strains, after<br />
they had grown in skim milk, milk cream and skim milk in the<br />
presence of tributyrin, using as substrate Nile Blue Sulphate<br />
Agar. It was concluded that enterococci were more lipolytic.<br />
The hydrolysis rate reduced with increasing molecular mass<br />
(tripropionin>tributyrin>tricaprin >tricaprylin), while triolein<br />
was not hydrolyzed at all. In the same study, the volatile fatty<br />
acids produced were chromatographically determined, showing<br />
that enterococci, and especially the E. durans strains, produced<br />
more acetic acid than the Streptococcus strains.<br />
A few years later, Martínez-Moreno (1976) showed that<br />
Enterococcus strains (E. durans, E. faecium, and E. faecalis)<br />
isolated from Manchego cheese, were active only against<br />
tributyrin and not against milk fat. Chander et al. (1979a,b) in<br />
two consecutive studies examined the influence of certain fatty<br />
acids on the growth of and lipase production by E. faecalis, and<br />
they purified and characterized this lipase. It was observed that<br />
low-molecular-mass fatty acids (C3, C4, C6, and C10)<br />
enhanced lipase production, in contrast to high-molecular-mass<br />
fatty acids (C12, C14, C16, C18, and C18:2) that inhibited<br />
lipase production. The molar mass of this specific enzyme has<br />
been estimated to be approximately 21 kDa and the isoelectric<br />
point has been found to be 4.6. The maximum enzyme activity<br />
of the lipase has been observed at pH 7.5 and 40 -C. The<br />
enzyme was able to hydrolyze tributyrin more than tricaproin,<br />
tricaprylin, and triolein.<br />
After 10 years of silence on the lipolytic system of<br />
enterococci, new studies have been published. Carrasco de<br />
Mendoza et al. (1992) concluded that the lipolytic activity of<br />
enterococci in milk was strain-dependent. Most of the strains<br />
examined exhibited low activity and only a few strains<br />
belonging to E. faecalis species were characterized as lipolytic.<br />
In the same period, Tsakalidou et al. (1993) used synthetic<br />
substrates to detect photometrically and post-electrophoretically<br />
the esterolytic activities of E. faecium and E. durans. E.<br />
durans strains were active against low-molecular-mass fatty<br />
acids up to 4-nitrophenyl-caprylate (C8), while E. faecium was<br />
active up to 4-nitrophenyl-stearate (C18). Differences between<br />
the two species were also obvious for the post-electrophoretic<br />
detection of esterases. Moreover, Tsakalidou et al. (1994a)<br />
described the purification and characterization of an intracellular<br />
esterase of an E. faecium strain isolated from Feta cheese.<br />
The enzyme with a molecular mass of 45 kDa was optimally<br />
active at 35 -C and pH 8.0. It could hydrolyze synthetic<br />
substrates of low and medium molecular mass (C2 to C12)<br />
with the highest activity against 4-nitrophenyl-butyrate (C4).<br />
Tsakalidou et al. (1994b) observed that enterococci generally<br />
exhibited higher esterolytic activities than other LAB<br />
species. In contrast, Villani and Coppola (1994) reported that<br />
enterococci showed low lipolytic activity when grown in whole<br />
milk. However, Tavaria and Malcata (1998) suggested that an<br />
E. faecium strain isolated from Serra da Estrela cheese was able<br />
to hydrolyze milk fat more extensively than a Lactococcus<br />
lactis subsp. lactis strain. In addition, Hemati et al. (1998)<br />
reported that enterococci isolated from Domiati cheese<br />
exhibited greater esterolytic activity in comparison with<br />
Lactobacillus strains.<br />
In another much more systematic study, Sarantinopoulos et<br />
al. (2001a) showed that, among 129 enterococci, the majority<br />
(90%) hydrolyzed all substrates from tributyrin (C4) to<br />
tristearin (C18) with a decreasing extent. In addition,<br />
concerning esterases, all strains were active on the synthetic<br />
substrates used, from 4-nitrophenyl-acetate (C2) to -stearate<br />
(C18), with decreasing activity. Generally, E. faecalis strains<br />
were the most lipolytic and esterolytic, followed by the E.<br />
faecium and E. durans strains. Finally, while enterococci<br />
isolated from Beyaz cheese showed a pronounced lipolytic<br />
activity (Durlu-Ozkaya et al., 2001), the ones isolated from<br />
Semicotto Caprino cheese were not able to hydrolyse<br />
tributyrin, independent of the species (Suzzi et al., 2000).<br />
2.4. Enterococci as probiotics<br />
The definition of a probiotic has been evolving with the<br />
increasing understanding of the mechanisms by which they<br />
influence human health (De Vuyst et al., 2004). The term was<br />
first introduced to describe substances produced by one<br />
microorganism (protozoa) that stimulate the growth of other<br />
microorganisms (Lilly and Stillwell, 1965). Nowadays, the<br />
definition most commonly used is that of Fuller (1989), i.e.<br />
‘‘probiotics are live microbial feed supplements, which<br />
beneficially affect the host animal by improving its intestinal<br />
microbial balance’’. In 1992, the definition was expanded to<br />
include food and non-food uses as well as the use of mono and<br />
mixed cultures (Havenaar and Huis in’t Veld, 1992). Hence, a<br />
probiotic can be described as a preparation of or a product<br />
containing viable, defined microorganisms in sufficient numbers,<br />
which alter the microbiota (by implantation or colonization)<br />
in a compartment of the host and that exert beneficial<br />
health effects in this host (De Vuyst et al., 2004). They are<br />
applied in foods such as yogurt, fermented and non-fermented<br />
milks, infant formulas, and pharmaceutical preparations.
8<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Probiotic consumption is reported to exert a myriad of<br />
beneficial effects, including enhanced immune response,<br />
balancing of colonic microbiota, vaccine adjuvant effects,<br />
reduction of fecal enzymes implicated in cancer initiation,<br />
treatment of diarrhea associated with travel and antibiotic<br />
therapy, control of rotavirus and Clostridium difficile-induced<br />
colitis, and prevention of ulcers related to Helicobacter pylori.<br />
Probiotics are also implicated in the reduction of serum<br />
cholesterol, the antagonism against food-borne pathogens and<br />
tooth decay organisms, the amelioration of lactose malabsorption<br />
symptoms as well as candidiasis and urinary tract<br />
infections (Saavedra, 2001). A group of requirements have<br />
been identified for a microorganism to be defined as an<br />
effective probiotic (Salminen et al., 1996). These include the<br />
ability to (a) adhere to cells; (b) exclude or reduce pathogenic<br />
adherence; (c) persist and multiply; (d) produce acids,<br />
hydrogen peroxide, and bacteriocins antagonistic to pathogen<br />
growth; (e) be safe, noninvasive, noncarcinogenic, and<br />
nonpathogenic; and (f) coaggregate to form a normal balanced<br />
flora.<br />
Strains that are used as probiotics for man have been<br />
isolated from the human gastrointestinal tract and usually<br />
belong to species of the genera Lactobacillus and Bifidobacterium.<br />
However, strains belonging to species of other LAB,<br />
among them enterococci, have been used in the past as<br />
probiotics too, such as E. faecium, E. faecalis, S. thermophilus,<br />
L. lactis subsp. lactis, Leuconostoc mesenteroides, Propionibacterium<br />
freudenreichii, Pediococcus acidilactici, Sporolactobacillus<br />
inulinus, E. coli, Bacillus cereus (Ftoyoi_), and the<br />
yeast Saccharomyces cerevisiae (Fboulardii_) (Fuller, 1989;<br />
O’Sullivan et al., 1992; Holzapfel et al., 1998). Even though<br />
strains of E. faecium and E. faecalis species have been applied<br />
in human, probiotic supplements, E. faecalis strains have also<br />
been widely used as veterinary feed supplements. Since<br />
February 2004, 10 preparations (9 different strains of E.<br />
faecium) are authorized as additives in feeding stuffs in the<br />
European Union (European Commission, 2004).<br />
A well-studied Enterococcus strain used as probiotic is E.<br />
faecium SF 68, which is produced in Switzerland (Cylactin\<br />
LBC SF68 ME10, F. Hoffmann-La Roche Ltd., Basel,<br />
Switzerland). It has been proposed to be clinically effective<br />
in the prevention of antibiotic-associated diarrhea (Wunderlich<br />
et al., 1989) and in the treatment of diarrhea in children<br />
(Bellomo et al., 1980). E. faecium SF 68 has been tested in<br />
adults with acute diarrhea in two hospitals in Belgium<br />
(Buydens and Debeuckelaere, 1996). Although this type of<br />
diarrhea was self-limited (>95% recovered by 6 days), the use<br />
of the enterococci shortened the duration of diarrhea by 1–3<br />
days. E. faecium SF 68 has also been studied as a feed<br />
probiotic. E. faecium SF 68 used in a dry dog food<br />
significantly enhanced cell-mediated and humoral immune<br />
functions in dogs (Benyacoub et al., 2003). In Denmark, a<br />
fermented milk product that contains E. faecium SF 68 (GAIO;<br />
MD Foods, Aarhus, Denmark) has been sold for several years<br />
because of its hypocholesterolemic effect on individuals<br />
(Agerbaek et al., 1995). However, two long-term studies (12<br />
weeks and 6 months, respectively) failed to show any reduction<br />
in cholesterol levels in individuals who received GAIO,<br />
compared with that in control subjects at the end of the<br />
treatment (Richelsen et al., 1996; Sessions et al., 1997). In a<br />
recent work, the same fermented milk product GAIO was used<br />
to study the relationship of the E. faecium SF 68-containing<br />
probiotic and a vancomycin treatment. It was concluded that E.<br />
faecium SF 68 from the GAIO product was not found to<br />
acquire vancomycin resistance during the study period (Lund et<br />
al., 2000).<br />
Rossi et al. (1999) used the strain E. faecium CRL 183 for<br />
the development of a novel fermented soymilk product with<br />
potential probiotic properties. E. faecium CRL 183 in<br />
combination with Lactobacillus jugurti resulted in a 43%<br />
decrease in cholesterol in vitro. Also, the probiotic strain E.<br />
faecium PR88 (E. faecium Fargo 688\ from Quest International,<br />
Naarden, The Netherlands) was studied in a human<br />
clinical trial. The consumption of this strain led to alleviation of<br />
the symptoms of irritable bowl syndrome in humans (Allen et<br />
al., 1996). The strain was used for the production of a probiotic<br />
Cheddar cheese. It did not affect cheese composition, but an<br />
improvement of the flavour of the cheese was obtained<br />
(Gardiner et al., 1999).<br />
Another probiotic product available on the market that<br />
contains an E. faecium strain is Walthers ECOFLOR (Walthers<br />
Health Care, Den Haag, The Netherlands). The producer claims<br />
the efficacy of the E. faecium strain against diarrhea, its anticarcinogenic<br />
effect, the production of enterocins active towards<br />
L. monocytogenes, the possible decrease of the LDL-cholesterol<br />
level, as well as its sensitivity to vancomycin and the<br />
production of L(+) lactic acid (personal communication).<br />
However, the producer provides no scientific evidence.<br />
The use of enterococci as probiotics re<strong>main</strong>s a controversial<br />
issue. While the probiotic benefits of some strains are well<br />
established, the emergence and the increased association of<br />
enterococci with human disease and multiple antibiotic<br />
resistances (see below) have raised concern regarding their<br />
use as probiotics. The fear that antimicrobial resistance genes<br />
or genes encoding virulence factors can be transferred to other<br />
bacteria in the gastrointestinal tract contributes to this<br />
controversy (Franz et al., 2003).<br />
3. Pathogenesis of enterococci<br />
Enterococci are among the most common nosocomial<br />
pathogens and they have been implicated as an important<br />
cause of endocarditis, bacteremia, and infections of the urinary<br />
tract, central nervous system, intra-abdominal and pelvic<br />
infections, as well as of multiple antibiotic resistances (Endtz<br />
et al., 1999; Franz et al., 1999a). Several virulence factors have<br />
been described (Jett et al., 1994) and the number of antibioticresistant<br />
enterococci (ARE), especially vancomycin-resistant<br />
enterococci (VRE), is increasing (Endtz et al., 1999).<br />
3.1. Cytolytic activity of enterococci<br />
In 1949, Sherwood et al. reported on some h-hemolytic<br />
group D streptococci that inhibited growth of other bacteria. In
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 9<br />
the following years, other research groups observed the same<br />
phenomenon (for reviews, see Jett et al., 1994; Haas and<br />
Gilmore, 1999). The evidence that bacteriocin and hemolytic<br />
activities were provided by a single compound came when both<br />
activities were simultaneously lost after exposure to UV<br />
irradiation but were simultaneously regained by reversion<br />
(Brock and Davies, 1963). Granato and Jackson (1969,<br />
1971a,b) found convincing data that E. faecalis hemolysin/<br />
bacteriocin was a natural bifunctional component. For simplicity,<br />
the hemolysin/bacteriocin produced by E. faecalis has been<br />
termed cytolysin (Gilmore et al., 1990). Amino acid analysis of<br />
the purified E. faecalis cytolysin revealed that it belongs to the<br />
class I lantibiotics (Gilmore et al., 1994). Cytolysin is unique<br />
among the lantibiotics in that it is able to lyse eukaryotic cells in<br />
addition to its bactericidal effect. As a class I lantibiotic,<br />
cytolysin forms pores in the cytoplasmic membrane of bacterial<br />
target cells. Sequence and complementation analysis revealed a<br />
gene cluster containing six genes that are required for cytolysin<br />
production (Gilmore et al., 1994; Saris et al., 1996). The two<br />
genes that encode the cytolysin subunits are designated cylL L<br />
(encoding for a peptide of 68 amino acids) and cylL S (encoding<br />
for a peptide of 63 amino acids). Only the strains that are able to<br />
express and secrete both subunits are hemolytic (Booth et al.,<br />
1996). The cytolysin genes are located on the highly transmissible<br />
pheromone-responsive conjugative plasmid pAD1 (Ike et<br />
al., 1990). Pheromones are small peptides (seven to eight amino<br />
acids) secreted by E. faecalis that promote conjugative transfer<br />
of plasmids between strains (Ike and Clewell, 1984). These<br />
peptides are chromosomally encoded and are referred to as<br />
pheromones because they elicit a specific mating response from<br />
plasmid-carrying donor cells. Typically, multiple pheromones<br />
are secreted simultaneously by a given E. faecalis strain. In<br />
addition to pheromones, each pheromone-responsive plasmid<br />
encodes a secreted peptide that acts as a competitive inhibitor of<br />
its corresponding pheromone (Jett et al., 1994).<br />
Cytolysin is considered a virulence factor of E. faecalis<br />
strains in animal models (Ike et al., 1984; Huycke et al., 1991;<br />
Jett et al., 1992; Chow et al., 1993; Singh et al., 1998).<br />
However, the role of this factor in enterococcal pathogenicity<br />
re<strong>main</strong>s unclear. In a recent study, E. faecalis isolated from<br />
patients with endocarditis or bacteremia and from healthy<br />
volunteers were investigated for their ability to adhere to Int-<br />
407 and Girarti heart cell lines (Archimbaud et al., 2002). No<br />
link between the presence of some virulence factors such as<br />
gelatinase, aggregation substances, and cytolysin, and the<br />
ability of the strains to adhere to these cells could be found.<br />
3.2. Antibiotic resistance of enterococci<br />
Antibiotic resistance encompasses both natural (intrinsic)<br />
resistance and acquired (transferable) resistance. Enterococci<br />
possess a broad spectrum of antibiotic resistances within these<br />
two types (Klare et al., 2001). Examples of intrinsic resistance<br />
are vancomycin (VanC type) resistance in E. gallinarum, and<br />
resistance towards streptogramins in E. faecalis, as well as<br />
resistance to isoxazolylpenicillins, cephalosporins, monobactams,<br />
aminoglycosides (low level), lincosamides (mostly), and<br />
polymyxins. The resistance to ampicillin (especially in E.<br />
faecium), tetracyclines, macrolides, aminoglycosides (high<br />
level), chloramphenicol, trimethoprim/sulfamethozaxole, quinolones,<br />
and streptogramins (in E. faecium and related species)<br />
are acquired, as well as resistance towards glycopeptides<br />
(vancomycin). VRE possess vanA, vanB, vanD, and vanE type<br />
resistance genes (Klare et al., 2001). Ampicillin, vancomycin<br />
and gentamicin are the most clinically relevant antibiotics to<br />
cure infections with multiple ARE strains. It should be noted<br />
that the extensive use of vancomycin has steadily raised the<br />
number of VRE over the past two decades and therefore the<br />
percentage of invasive nosocomial enterococci displaying<br />
high-level vancomycin resistance (Endtz et al., 1999). However,<br />
antibiotic resistance as such cannot explain the virulence<br />
of enterococci. Unfortunately, VRE are also highly resistant to<br />
all standard anti-enterococcal drugs (Landman and Quale,<br />
1997), and, therefore, VRE constitute a serious risk group.<br />
Dutka-Malen et al. (1995) developed a PCR assay to detect<br />
glycopeptide resistance genotypes.<br />
Glycopeptide-resistant enterococci are phenotypically and<br />
genotypically heterogeneous. Of the six different VRE phenotypes<br />
known to date (Leclercq et al., 1988, 1992; Quintiliani et<br />
al., 1993; Perichon et al., 1997; Fines et al., 1999; McKessar et<br />
al., 2000), phenotypes VanA and VanB are of the highest<br />
clinical importance as they are most frequently observed in two<br />
predominant enterococcal species, E. faecalis and E. faecium<br />
(Murray, 1997, 1998; Cetnikaya et al., 2000). VanA-type strains<br />
display high-level inducible resistance to both vancomycin and<br />
teicoplanin, following the acquisition of transposon Tn1546 or<br />
closely related mobile genetic elements (Arthur et al., 1993).<br />
VanB-type strains display variable levels of inducible resistance<br />
to vancomycin only (Arthur et al., 1996).<br />
ARE are widespread in food. They have been found in meat<br />
products, dairy products, and ready-to-eat foods, and even<br />
within enterococcal strains used as probiotics (Franz et al.,<br />
2001; Giraffa, 2002). Franz et al. (2001) found acquired<br />
resistance traits for a number of antibiotics in enterococci from<br />
food origin throughout Europe. However, in general these<br />
strains did not show resistance to the clinically relevant<br />
antibiotics. Giraffa (2002) emphasizes the role played by<br />
ARE, and especially VRE, as possible natural food reservoirs<br />
in the dissemination of antibiotic-resistant traits in the environment.<br />
There could be a link between the use of some antibiotics<br />
in livestock and humans becoming colonised by ARE via the<br />
food chain. For safety reasons, a critical or important criterion to<br />
check is the absence of transferable antibiotic resistance in<br />
enterococci that could be used as co-cultures or starter cultures<br />
in foods, since it is strain-specific (Franz et al., 2001;<br />
Vancanneyt et al., 2002; De Vuyst et al., 2003).<br />
3.3. Virulence factors of enterococci<br />
A virulence factor is an effector molecule that enhances the<br />
ability of a microorganism to cause disease beyond that<br />
intrinsic to the species background (Mundy et al., 2000).<br />
Typical examples are aggregation substance, gelatinase, extracellular<br />
superoxide, and extracellular surface protein.
10<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
3.3.1. Aggregation substance<br />
Aggregation substance (Agg) is a pheromone-inducible<br />
surface protein of E. faecalis, which promotes aggregate<br />
formation during bacterial conjugation (Clewell, 1993). As an<br />
important component of the bacterial pheromone-responsive<br />
genetic exchange system, Agg mediates efficient enterococcal<br />
donor–recipient contact to facilitate plasmid transfer (Clewell,<br />
1993). This trait may contribute to the pathogenesis of<br />
enterococcal infection through different mechanisms. The<br />
cells that express this trait form large aggregates in vivo.<br />
However, it is unknown how this influences phagocytosis and<br />
subsequent damage of the vital functions of the organism.<br />
Also, Agg may bind on and present its cognate ligand to the<br />
surface of the organism, possibly resulting in superantigen<br />
activity. Finally, Agg increases the hydrophobicity of the<br />
enterococcal surface, which may induce localization of<br />
cholesterol to phagosomes, and prevent or delay fusion with<br />
lysosomal vesicles (Mundy et al., 2000). Studies on endocarditis<br />
showed synergism between cytolysin and Agg. Up to<br />
now, Agg is exclusively found in E. faecalis strains; however,<br />
its incidence among food isolates seems to be high (Eaton<br />
and Gasson, 2001; Franz et al., 2001).<br />
3.3.2. Gelatinase<br />
Gelatinase (Gel) is an extracellular metallo-endopeptidase<br />
involved in the hydrolysis of gelatin, collagen, haemoglobin,<br />
and other bioactive peptides (Su et al., 1991). The association<br />
between an enterococcal protease and virulence was first<br />
suggested in 1975 by Gold et al., who found that a gelatinliquefying,<br />
human, oral E. faecalis isolate induced caries<br />
formation in germ-free rats, while non-proteolytic strains did<br />
not. Su et al. (1991) sequenced the protease gene (gelE) inE.<br />
faecalis. Singh et al. (1998) demonstrated that Gel, which is<br />
commonly produced by nosocomial, fecal, and clinical<br />
enterococcal isolates, is a virulence factor of enterococci, at<br />
least for peritonitis in mice. The presence of Gel production<br />
among food E. faecalis strains is high (Eaton and Gasson,<br />
2001; Franz et al., 2001). However, Eaton and Gasson (2001)<br />
demonstrated that even when the gel gene is present, a<br />
negative phenotype can be found. None of the E. faecium<br />
strains involved in both studies produce Gel.<br />
3.3.3. Extracellular surface protein<br />
Extracellular surface protein (Esp) was first described in a<br />
clinical E. faecalis MMH594 isolate by Shankar et al. (1999).<br />
The esp gene is unusually large consisting of 5622 nucleotides<br />
capable of encoding a primary translation product of<br />
1873 amino acids, with a theoretical molecular mass of<br />
approximately 202 kDa. Studies on the distribution of this<br />
surface protein revealed a significant enrichment in infectionderived<br />
E. faecalis isolates (Shankar et al., 1999; Waar et al.,<br />
2002). Esp is thought to play a role in adhesion and evasion<br />
of the immune response of the host. The incidence of Esp in<br />
food isolates differs for E. faecium and E. faecalis. While it<br />
is hardly found in E. faecium, the incidence in E. faecalis is<br />
higher than expected. No explanation could be found up to<br />
now (Eaton and Gasson, 2001; Franz et al., 2001).<br />
3.4. Opsonophagocytic assay to assess the safety of potential<br />
enterococcal pathogens<br />
Opsonophagocytic killing is used as an in vitro test to detect a<br />
protective immune response against bacterial pathogens (Pier et<br />
al., 1994), as all the antibodies that provide antibacterial<br />
immunity are opsonic. E. faecalis and E. faecium can posses a<br />
capsular polysaccharide that is the target for opsonic antibodies<br />
(Huebner et al., 1999). Hufnagel et al. (2003) compared one<br />
probiotic E. faecalis strain with a collection of clinical isolates<br />
and found that 89% of the clinical strains were less susceptible to<br />
killing mediated by normal rabbit sera. The results showed a<br />
strain-dependent susceptibility to opsonic killing. Moreover,<br />
opsonophagocytic killing is considered to be an important test to<br />
assess the safety of enterococcal strains (Hufnagel et al., 2003).<br />
4. Enterococci in food<br />
Enterococci are widely distributed in the environment,<br />
principally inhabiting the human and animal gastrointestinal<br />
tract. E. faecalis is often the predominating Enterococcus<br />
species in the human bowel, although in some individuals and<br />
in some countries E. faecium outnumbers E. faecalis (Devriese<br />
and Pot, 1995). However, Mundt (1986) demonstrated that the<br />
common presence of E. faecalis in many food products is not<br />
always related to direct faecal contamination. In 1992, the EU<br />
established a maximum level for the presence of coliforms and<br />
Escherichia coli, both considered as indicators of hygiene,<br />
while no limit was set for the enterococci (Anonymous, 1992).<br />
Furthermore, it has been shown that enterococci had little value<br />
as hygiene indicators in the industrial processing of foods<br />
(Birollo et al., 2001).<br />
Moreover, although E. faecalis, E. faecium, and E. durans<br />
are frequently isolated from human faeces, they are much less<br />
prevalent in livestock, such as pigs, cattle, and sheep (Franz<br />
et al., 1999a). Enterococci are not only associated with warmblooded<br />
animals, but they also occur in soil, surface waters,<br />
and on plants, vegetables, and insects (Deibel and Silliker,<br />
1963; Mundt, 1986). The resistance of enterococci to<br />
pasteurization temperatures, and their adaptability to different<br />
substrates and growth conditions (low and high temperature,<br />
extreme pH, and salinity) implies that they can be found<br />
either in food products manufactured from raw materials<br />
(milk or meat) and in heat-treated food products. This means<br />
that these bacteria could withstand usual conditions of food<br />
production. In addition, they can contaminate finished<br />
products during food processing. Therefore, enterococci can<br />
become an important part of the fermented food microbiota,<br />
especially in fermented cheeses and meats.<br />
The contribution of enterococci to the organoleptic properties<br />
of fermented food products and their ability to produce<br />
bacteriocins (enterocins) are important characteristics for their<br />
application in food technology. In recent years, the reports<br />
about enterococci used as starter cultures or co-cultures<br />
(adjuncts) have increased considerably. The major part of this<br />
kind of research has focused on the applicability of Enterococcus<br />
strains, which harbor interesting biochemical and
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 11<br />
technological properties, in cheese products and, to less extent,<br />
in meat products. However, the selection of enterococci to be<br />
involved in food processes is a difficult task, due to their<br />
potential risk in human health (Vancanneyt et al., 2002; De<br />
Vuyst et al., 2003).<br />
4.1. Cheese products<br />
4.1.1. Presence of enterococci in cheese<br />
Enterococci are associated with traditional European<br />
cheeses manufactured in Mediterranean countries, such as<br />
Greece, Italy, Spain and Portugal, from raw or pasteurized<br />
goats’, ewes’, water-buffalos’ or bovine milk (Ordoñez et al.,<br />
1978; Trovatelli and Schliesser, 1987; Coppola et al., 1988; Del<br />
Pozo et al., 1988; Litopolou-Tzanetaki, 1990; Litopoulou-<br />
Tzanetaki and Tzanetakis, 1992; Poullet et al., 1993; Kalogridou-Vassiliadou<br />
et al., 1994; Torri Tarelli et al., 1994;<br />
Macedo et al., 1995; Centeno et al., 1996; Cuesta et al., 1996;<br />
Zárate et al., 1997; Aran, 1998; Bouton et al., 1998; Pérez<br />
Elortondo et al., 1999; Xanthopoulos et al., 2000; Sarantinopoulos<br />
et al., 2002a; Manolopoulou et al., 2003). The<br />
prevalence of enterococci in milk and cheese has long been<br />
considered a result of unhygienic conditions during the<br />
production and processing of milk, such as direct contamination<br />
by animal and human feaces. Their presence has been<br />
indirectly linked with contaminated water sources, the exterior<br />
of animals, the milking equipment, and bulk storage tanks<br />
(Gelsomino et al., 2001, 2002; Giraffa, 2002).<br />
Levels of enterococci in different cheese curds range from<br />
10 4 to 10 6 CFU g 1 and in the fully ripened cheeses from 10 5 to<br />
10 7 CFU g 1 (Del Pozo et al., 1988; Litopolou-Tzanetaki,<br />
1990; Litopoulou-Tzanetaki and Tzanetakis, 1992; Poullet et<br />
al., 1993; Kalogridou-Vassiliadou et al., 1994; Macedo et al.,<br />
1995; Centeno et al., 1996; Cuesta et al., 1996; Zárate et al.,<br />
1997; Franz et al., 1999a; Pérez Elortondo et al., 1999;<br />
Xanthopoulos et al., 2000; Sarantinopoulos et al., 2001a; Franz<br />
et al., 2003; Giraffa, 2002; Manolopoulou et al., 2003), with E.<br />
faecium and E. faecalis being the dominant species. More<br />
interestingly, in cheeses such as Manchego (Ordoñez et al.,<br />
1978), Mozzarella (Coppola et al., 1988), Kefalotyri (Litopolou-Tzanetaki,<br />
1990), Picante de Beira Baixa (Freitas et al.,<br />
1995), Serra (Macedo et al., 1995), Cebreiro (Centeno et al.,<br />
1996), Comté (Bouton et al., 1998), Domiati (Hemati et al.,<br />
1998), and Kashar (Aran, 1998), enterococci are the predominant<br />
microorganisms in the fully ripened product, while<br />
according to the results of a 15-year survey, enterococci ranged<br />
from 10 4 to 10 6 CFU g 1 in Emmental cheese and from 10 4 to<br />
10 7 CFU g 1 in Appenzeller cheese (Teuber et al., 1996). The<br />
European cheeses in which enterococci have been studied are<br />
compiled in Table 3.<br />
Varying levels in different cheeses result from the cheese<br />
type, the production season, the extent of milk contamination,<br />
Table 3<br />
European cheeses where enterococci have been studied<br />
Origin Cheese Type of milk Reference<br />
French Comté Cow Bouton et al., 1998<br />
French Roquefort Cow Devoyod, 1969<br />
French Venaco Ewe/goat Casalta and Zennaro, 1997<br />
Greek farmhouse cheese Ewe Gomez et al., 2000<br />
Greek Feta Ewe Litopolou-Tzanetaki et al., 1993<br />
Greek Feta and Teleme Ewe Tzanetakis and Litopoulou-Tzanetaki, 1992<br />
Greek Kefalotyri Ewe Litopolou-Tzanetaki, 1990<br />
Greek Orinotyri Ewe Prodromou et al., 2001<br />
Greek Pichtogalo Chanion Ewe/goat Papageorgiou et al., 1998<br />
Irish Cheddar Cow Gelsomino et al., 2001<br />
Italian Buffalo Mozzarella Buffalo Parente et al., 1989<br />
Italian Fiore Sardo Sheep Ledda et al., 1994<br />
Italian Fontina Cow Battistotti et al., 1977<br />
Italian Montasio Cow Basso et al., 1994<br />
Italian Monte Veronese Cow Torriani et al., 1998<br />
Italian Mozzarella Cow Morea et al., 1999<br />
Italian Pecorino Sardo Ewe Mannu et al., 1999; Mannu and Paba, 2002<br />
Italian Semicotto Caprino Goat Suzzi et al., 2000<br />
Portuguese Serra da Estrela Ewe Macedo et al., 1995<br />
Portuguese Serra da Estrela Ewe Tavaria and Malcata, 1998<br />
Spanish Armada Goat Tornadijo et al., 1995<br />
Spanish Arzúar Cow Centeno et al., 1995<br />
Spanish Cebreiro Cow Centeno et al., 1996, 1999<br />
Spanish Cebreiro Cow Menéndez et al., 1998<br />
Spanish Majorero Goat Fontecha et al., 1990<br />
Spanish La Serena Ewe Fernandez del Pozo et al., 1988<br />
Spanish Manchego Ewe Ramos et al., 1981<br />
Spanish Roncal-Idiazabal Ewe Arizcun et al., 1997<br />
Spanish San Simón Cow García et al., 2002<br />
Spanish Tenerife goat cheese Goat Zárate et al., 1997<br />
Spanish Tetilla Cow Menéndez et al., 2001
12<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
and survival in the dairy environment (dependent on seasonal<br />
temperature), as well as survival and growth under the<br />
particular conditions of cheese manufacture and ripening<br />
(Litopolou-Tzanetaki, 1990; Litopoulou-Tzanetaki and Tzanetakis,<br />
1992; Macedo et al., 1995; Sarantinopoulos et al.,<br />
2001a).<br />
Although some authors have claimed in the past that high<br />
levels of contaminating enterococci could lead to deterioration<br />
of sensory properties in some cheeses (Thompson and Marth,<br />
1986; López-Diaz et al., 1995), other literature reports discuss<br />
the beneficial role of the presence of enterococci in cheese.<br />
Enterococci contribute to the ripening and aroma development<br />
of these products due to their proteolytic and esterolytic<br />
activities, as well as the production of diacetyl and other<br />
important volatile compounds (Jensen et al., 1975a,b; Ordoñez<br />
et al., 1978; Trovatelli and Schliesser, 1987; Centeno et al.,<br />
1996, 1999; Casalta and Zennaro, 1997; Franz et al., 1999a,<br />
2003; Sarantinopoulos et al., 2001a,b). Furthermore, enterococci<br />
seem to play an important role in improving flavor<br />
development and quality, not only of cheese, but also of other<br />
traditional fermented foods, such as vegetables and sausages<br />
(Franz et al., 1999a; Giraffa, 2002).<br />
4.1.2. Applicability of enterococci as starter or adjunct cultures<br />
in cheese<br />
The presence of enterococci in high numbers in many<br />
different types of cheeses, their potential contribution to the<br />
organoleptic properties of fermented food products, and their<br />
ability to produce bacteriocins (enterocins) are important<br />
characteristics to be considered by food processors for their<br />
direct application in food manufacture. During the last few<br />
years, the reports about enterococci proposed to be used as<br />
starter cultures or co-cultures (adjuncts) have considerably<br />
increased. The aim of these studies was to elucidate the role that<br />
enterococci play in cheese ripening. However, as enterococci<br />
have been recognized in recent years as major nosocomial<br />
pathogens, one should carefully consider the potential virulence<br />
factors of this group of microorganisms before use.<br />
It has been proposed that enterococci can be included as part<br />
of defined starter cultures for different European cheeses. The<br />
effect of enterococci as starter cultures or co-cultures was<br />
studied in cheeses, such as Cheddar (Dahlberg and Kosikowsky,<br />
1948; Czulak and Hammond, 1956; Jensen et al.,<br />
1975a,b), Feta (Litopolou-Tzanetaki et al., 1993; Sarantinopoulos<br />
et al., 2002a), water-buffalo Mozzarella (Coppola et al.,<br />
1988; Parente et al., 1989; Villani and Coppola, 1994), Venaco<br />
(Casalta and Zennaro, 1997), Cebreiro (Centeno et al., 1996,<br />
1999), and Hispánico (Garde et al., 1997; Oumer et al., 2001).<br />
In most of these studies, E. faecalis strains have been used, and<br />
only in the case of Feta cheese, strains belonging to the species<br />
of E. faecium (Sarantinopoulos et al., 2002a) and E. durans<br />
(Litopolou-Tzanetaki et al., 1993) have been tested. Also, the<br />
British FAdvisory Committee on Novel Foods and Processes_<br />
(ACNFP) accepted the use of E. faecium strain K77D as a<br />
starter culture in fermented dairy products (ACNFP, 1996).<br />
In an early, comparative study, Jensen et al. (1975b) used<br />
two E. faecalis strains and two E. durans strains as adjunct<br />
starters for the production of Cheddar cheese. They concluded<br />
that the cheese batches manufactured with the addition of E.<br />
faecalis strains exhibited greater proteolytic degradation in<br />
comparison to the cheese batches manufactured without<br />
enterococci or with the addition of E. durans strains. More<br />
recently, when E. durans strains were used as co-cultures in the<br />
production of Feta cheese and a white-brined cheese, the<br />
proteolytic index was higher in the experimental cheese than in<br />
the control. That was justified by the fact that the degree and<br />
the formation rate of non-casein nitrogen (NCN, pH 4.6 soluble<br />
nitrogen) and of phosphotungistic acid (PTA)-soluble nitrogencontinuously<br />
increased with ripening time (Litopolou-Tzanetaki<br />
et al., 1993; Tzanetakis et al., 1995). An increased watersoluble<br />
nitrogen content and proteolytic index was also<br />
observed when E. faecalis strains were used as adjunct starters<br />
in cheeses such as Cebreiro (Centeno et al., 1999), Hispánico<br />
(Garde et al., 1997; Oumer et al., 2001) and Venaco (Casalta<br />
and Zennaro, 1997).<br />
More recently, Centeno et al. (1999) examined the effects of<br />
E. faecalis in Cebreiro cheese manufacture. It has been<br />
concluded that h-casein was broken down to a greater extent<br />
in the batches containing E. faecalis strains than in the control<br />
ones. Moreover, the highest level of a s1 -casein hydrolysis and<br />
the highest ratio of peptide a s1 -I/a s1 -casein was obtained when<br />
E. faecalis strains were used. In all batches made with<br />
enterococci, volatile free fatty acids, long-chain free fatty<br />
acids, and diacetyl and acetoin were higher than in the control<br />
batches. Increase of free fatty acids in cheese containing<br />
enterococci was seen in Cheddar (Jensen et al., 1975a) and Feta<br />
cheese (Sarantinopoulos et al., 2002a) too. However, Centeno<br />
et al. (1999) recommended the use of moderate proteolytic (and<br />
lipolytic) strains of E. faecalis to guarantee the quality of<br />
traditional Cebreiro cheese.<br />
Finally, Sarantinopoulos et al. (2002a) studied in detail the<br />
effect of two E. faecium strains, as adjunct starter cultures, on<br />
the microbial, physicochemical and sensory characteristics of<br />
Feta cheese. Both enterococcal strains positively affected taste,<br />
aroma, color, and structure of the full-ripened cheeses, as well<br />
as the overall sensory profile. These results supported those<br />
obtained by Litopolou-Tzanetaki et al. (1993) when E. durans<br />
strains were used for the production of Feta cheese.<br />
4.1.3. Applicability of bacteriocinogenic enterococci and/or<br />
their enterocins in cheese<br />
There are many studies concerning the isolation and<br />
characterization of bacteriocins (enterocins) produced by<br />
Enterococcus spp. Enterocins have been isolated from strains<br />
originating from different sources, including foods (cheese,<br />
meat, fish, and vegetables), animals, and humans. Table 4<br />
shows a compilation of bacteriocinogenic Enterococcus strains<br />
(Bac + ) from different origins that have been studied. The<br />
enterococcal bacteriocins are usually active towards foodborne<br />
pathogens such as Listeria spp. and Clostridium spp. (Ben<br />
Embarek et al., 1994; Farías et al., 1994; Vlaemynck et al.,<br />
1994; Giraffa et al., 1994, 1995a,b; Maisnier-Patin et al., 1996;<br />
Vlaemynck, 1996; Cintas et al., 1998a; Bennik et al., 1999;<br />
Mendoza et al., 1999). Activity towards Gram-negative
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 13<br />
Table 4<br />
Origin of bacteriocinogenic Enterococcus strains<br />
Source Strain(s) Reference<br />
Dairy products E. faecium DPC1146 Parente and Hill, 1992a<br />
E. faecium 7C5 Torri Tarelli et al., 1994<br />
E. faecium RZS C5 Vlaemynck et al., 1994<br />
E. faecalis INIA 4 Joosten et al., 1995<br />
E. faecium CRL 35 Farías et al., 1996<br />
E. faecium WHE 81 Ennahar et al., 1998<br />
Screening for Bac + strains Carnio et al., 1999<br />
Screening for enterocin Rodríguez et al., 2000<br />
AS-48 producer strains<br />
E. faecalis TAB 28 Rodríguez et al., 2000<br />
Screening for Bac + strains Elotmani et al., 2002<br />
E. faecalis FAIR-E 309 Franz et al., 2002<br />
E. faecium FAIR E-198 Sarantinopoulos et al., 2002b<br />
Screening for Bac + strains Saavedra et al., 2003<br />
Fermented<br />
sausages<br />
Other fermented<br />
foods<br />
E. faecium L1 Lyon et al., 1995<br />
E. faecium CTC492 Aymerich et al., 1996<br />
E. faecalis EFS2 Maisnier-Patin et al., 1996<br />
E. faecium T136 Casaus et al., 1997<br />
E. faecium P13 Cintas et al., 1997<br />
E. faecium L50 Cintas et al., 1995, 1998b<br />
E. faecium AA13 Herranz et al., 1999<br />
E. faecium G16 Herranz et al., 1999<br />
E. faecium P21 Herranz et al., 2001<br />
E. casseliflavus IM 416K1 Sabia et al., 2002<br />
E. faecium N15 Losteinkit et al., 2001<br />
E. faecium B1 Moreno et al., 2002<br />
E. faecium B2 Moreno et al., 2002<br />
Screening for Bac + strains Onda et al., 2002<br />
Screening for Bac + strains Yamamoto et al., 2003<br />
Fish Screening for Bac + strains Ben Embarek et al., 1994<br />
Vegetables E. faecalis 226 Villani et al., 1993<br />
E. faecium BFE 900 Franz et al., 1996<br />
E. mundtii ATO6 Bennik et al., 1998<br />
E. faecium 6T1a Floriano et al., 1998<br />
Silage Screening for Bac + Kato et al., 1994<br />
E. faecium strains<br />
E. faecium RZS C13 Vlaemynck et al., 1994<br />
E. faecium NIAI 157 Ohmomo et al., 2000<br />
E. faecalis K-4 Eguchi et al., 2001<br />
Veterinary E. faecium CCM 4231 Lauková et al., 1993<br />
E. faecium BC25 Morovský et al., 1998<br />
E. faecium J96 Audisio et al., 1999<br />
E. faecalis BFE 1071 Balla et al., 2000<br />
Screening for Bac + strains du Toit et al., 2000<br />
E. gallinarum 012 Jennes et al., 2000<br />
Water E. faecalis EJ97 Gálvez et al., 1998<br />
Human origin E. faecalis S-48 Gálvez et al., 1986<br />
E. faecium YI717 Tomita et al., 1996<br />
Screening for Bac + strains del Campo et al., 2001<br />
E. faecium RC714 del Campo et al., 2001<br />
bacteria such as E. coli (Gálvez et al., 1989; Tomita et al.,<br />
1997) and Vibrio cholerae (Simonetta et al., 1997) has been<br />
shown as well. Furthermore, Wachsman et al. (1999) reported<br />
on the antiviral activity of enterocin CRL35.<br />
For the above-mentioned reasons the use of bacteriocinproducing<br />
enterococci as starter cultures, co-cultures (adjunct<br />
cultures) or protective cultures, as well as the direct addition of<br />
the enterocins in food fermentation processes, is a point of<br />
great interest amongst fermentation technologists. As a<br />
consequence, the applicability of such enterococci cultures<br />
(Table 5) and/or the corresponding enterocins produced (Table<br />
6) has been studied in a wide variety of fermented food<br />
products (<strong>main</strong>ly in cheese products) at small, pilot-scale<br />
conditions. However, the functionality of such strains at largescale,<br />
industrial, food processing conditions is still unknown<br />
and certainly needs to be thoroughly examined in the near<br />
future.<br />
Reports on the optimization of enterocin production and<br />
growth of enterococci during batch fermentation are scarce.<br />
Nevertheless, kinetic studies of batch fermentations can be<br />
used to analyze the relation between bacteriocin production,<br />
growth of the producer organism, and the microbial environment.<br />
Such studies have indicated that the bacteriocin<br />
production by E. faecium RZS C5 follows a growthassociated<br />
process and is limited to the early growth phase<br />
because of a shut off mechanism (Leroy and De Vuyst, 2002;<br />
Leroy et al., 2003a). Moreover, they indicated that the<br />
kinetics of E. faecium RZS C5 are affected by the pH and<br />
the temperature, and the concentration of sugar, complex<br />
nutrients, and sodium chloride (Leroy and De Vuyst, 2002;<br />
Leroy et al., 2003b). Another very well studied bacteriocin is<br />
enterocin 1146 from E. faecium DPC 1146 (Parente and Hill,<br />
1992a,b,c; Parente and Ricciardi, 1994a,b; Parente et al.,<br />
1997; Foulquié Moreno et al., 2003b). Enterocin 1146 has a<br />
rapid bactericidal effect on L. monocytogenes in buffer<br />
systems, broth and milk, and it is stable during the ripening<br />
period of Cheddar cheese, as it is the case for E. faecium<br />
FAIR-E 171 (Foulquié Moreno et al., 2003b). As enterocin<br />
production by E. faecium FAIR-E 171 takes place from the<br />
beginning of the cheese production and is stable during the<br />
whole cheese-ripening phase, both early and late contamination<br />
of the milk or cheese by Listeria spp. can be combated<br />
with stable, in situ enterocin production.<br />
Some successful examples of in situ enterocin production<br />
during cheese making have been described and the stability<br />
of certain enterocins during cheese ripening has been<br />
reported in Taleggio, Manchego, and Cheddar cheese<br />
(Giraffa et al., 1994, 1995b; Giraffa and Carminati, 1997;<br />
Núñez et al., 1997; Foulquié Moreno et al., 2003b). Giraffa<br />
et al. (1994) showed that enterococci are suitable to produce<br />
bacteriocins in milk, in the presence of rennet, during an<br />
incubation that simulated the first 55 h of Taleggio cheese<br />
making. Núñez et al. (1997) concluded that E. faecalis INIA<br />
4 is able to produce its enterocin in competition with the<br />
milk native microbiota during the manufacture of Manchego<br />
cheese. Furthermore, an increase in enterocin activity was<br />
recorded in the cheese during the first week. During<br />
Taleggio cheese manufacture and ripening, Giraffa et al.<br />
(1995b) showed that bacteriocin production by E. faecium<br />
7C5 starts during whey drainage and generally reaches a<br />
maximum amount just after cheese salting. The stability of<br />
the enterocin during ripening is not affected, although the<br />
heterogeneous microbiota present in raw milk, as well as the<br />
enzymatic activity of rennet, are capable to inactivate the<br />
inhibitor. Furthermore, E. faecium 7C5 inhibits the growth of<br />
L. monocytogenes Ohio on the surface of Taleggio cheese<br />
(Giraffa and Carminati, 1997).
14<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Table 5<br />
Applications of enterocin producing strains<br />
Strain Enterocin produced Application Reference<br />
E. faecalis B114 Enterocin not known Camembert cheese Sulzer and Busse, 1991<br />
E. faecium 7C5 Enterocin 7C5 Taleggio cheese Giraffa et al., 1995b<br />
E. faecalis INIA 4 Enterocin 4 Manchego cheese Joosten et al., 1995<br />
E. faecalis INIA 4 Enterocin 4 Hispano cheese Garde et al., 1997<br />
E. faecalis INIA 4 Enterocin 4 Manchego cheese Núñez et al., 1997<br />
E. faecalis INIA 4 Enterocin 4 Hispano cheese Oumer et al., 2001<br />
E. faecium CCM 4231 Enterocin CCM 4231 Saint-Paulin cheese Lauková et al., 2001<br />
E. faecium CCM 4231 Enterocin CCM 4231 Spanish-style dry fermented sausages Callewaert et al., 2000<br />
E. faecium RZS C13 Enterocin RZS C13 Spanish-style dry fermented sausages Callewaert et al., 2000<br />
E. faecium CTC492 Enterocins A and B Dry fermented sausages Aymerich et al., 2000b<br />
E. faecium CTC492 Enterocins A and B Cooked pork Aymerich et al., 2002<br />
E. faecalis TAB 28 Enterocin AS-48 Raw milk cheese Rodríguez et al., 2001<br />
E. faecium RZS C5 Enterocin RZS C5 Cheddar cheese production Foulquié Moreno et al., 2003b<br />
E. faecium DPC 1146 Enterocin DPC 1146 Cheddar cheese production Foulquié Moreno et al., 2003b<br />
E. faecium FAIR-E 198 Enterocins A and/or P Feta cheese Sarantinopoulos et al., 2002b<br />
E. casseliflavus IM 416K1 Enterocin 416K1 Italian sausage (Cacciatore) Sabia et al., 2003<br />
Although E. faecium FAIR-E 198 was able to grow well<br />
under the conditions resembling Feta cheese manufacture,<br />
enterocin production was low or negligible. Moreover and<br />
in contrast with the enterocin 1146, no enterocin activity<br />
was detected when the same strain was used as an adjunct<br />
starter culture for Feta cheese production (Sarantinopoulos<br />
et al., 2002b). The latter phenomenon can be attributed to<br />
the fact that enterocin production in milk using enterococci<br />
as co-cultures can be lower than when enterococci are used<br />
as pure cultures (Giraffa et al., 1995a,b; Sarantinopoulos et<br />
al., 2002b; Foulquié Moreno et al., 2003b). Another<br />
explanation could be that the enterocin is not produced at<br />
all under the specific conditions of this technology or that it<br />
is produced but can not be detected due to adsorption on<br />
the cheese matrix. This phenomenon has been reported<br />
before (Sulzer and Busse, 1991). Farías et al. (1999)<br />
studied the effect of enterocin CRL35 used as additive<br />
during goat cheese making contaminated with Listeria.<br />
Although enterocin CRL35 could not be detected during<br />
ripening, suppression of Listeria took place during the<br />
whole period of ripening.<br />
Table 6<br />
Applications of enterocins as additives<br />
Enterocin Application Reference<br />
Enterocin 226 NWC Mozzarella cheese Villani et al., 1993<br />
Enterocin 4 A model dairy system Rodríguez et al., 1997<br />
Enterocin CCM 4231 Cattle slurry environment Lauková et al., 1998<br />
Enterocin CCM 4231 Soy milk Lauková and Czikkova,<br />
1999<br />
Enterocin CCM 4231 Dry fermented Hornád<br />
salami<br />
Lauková et al., 1999<br />
Enterocin CCM 4231<br />
Bryndza, a traditional<br />
Slovak dairy product<br />
from sheep milk<br />
Lauková and Czikková,<br />
2001<br />
Enterocin CRL 35 Goat cheese making Farías et al., 1999<br />
Enterocin CRL 35 Meat system Vignolo et al., 2000<br />
Enterocin CTC 492 Meat products Aymerich et al., 2000b<br />
Enterocin CTC 492 Cooked pork Aymerich et al., 2002<br />
4.2. Meat products<br />
4.2.1. Presence of enterococci in meat<br />
The presence of enterococci in the gastrointestinal tract of<br />
animals may lead to contamination of meat at the time of<br />
slaughtering. In a study of enterococci from raw meat products,<br />
E. faecalis was the predominant isolate from beef and pork cuts<br />
(Stiles et al., 1978). E. faecium was also frequently isolated<br />
from Bologna, a processed pack sausage (Stiles et al., 1978).<br />
Pig carcasses from three different slaughtering plants contained<br />
mean log counts of 10 4 –10 8 enterococci per 100 cm 2 of<br />
carcass surface. E. faecium and E. faecalis were the predominant<br />
species isolated (Knudtson and Hartman, 1993). E.<br />
faecalis predominated the Gram-positive cocci isolated from<br />
chicken samples collected at poultry abattoirs. Enterococci<br />
were consistently isolated from beef, poultry, and pig carcasses,<br />
or from fresh meat in studies of antibiotic ARE (Franz et al.,<br />
2003).<br />
Besides raw meats, enterococci are also associated with<br />
processed meats. Heating of processed meats during production<br />
may confer a selective advantage to enterococci because these<br />
bacteria are among the most thermotolerant of the nonsporulating<br />
bacteria. After surviving the heat-processing step,<br />
both E. faecalis and E. faecium have been implicated in<br />
spoilage of cured meat products, such as canned hams and<br />
chub-packed luncheon meats (Magnus et al., 1986, 1988). This<br />
is especially true where recontamination with competing<br />
bacteria is prevented, i.e. when products are heated after<br />
packaging in cans or in impermeable plastic films. The heat<br />
resistance of enterococci in these products is influenced by<br />
components, such as salt, nitrite, and meat tissue (Bell and<br />
DeLacey, 1984; Magnus et al., 1986, 1988; Franz et al.,<br />
1999a). To prevent spoilage of the processed meats by<br />
enterococci, it was suggested that initial contamination by<br />
these microorganisms should be kept to a minimum, and that<br />
adequate heat processing should be based on D-values of the<br />
most heat-resistant enterococci isolated from raw materials<br />
(Magnus et al., 1986).
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 15<br />
Enterococci have also been isolated from some types of<br />
fermented sausages. Salami and Landjäger were shown to<br />
contain enterococci at numbers ranging from 100 to 2.6 10 5<br />
CFU g 1 (Teuber et al., 1996). Enterococci were isolated from<br />
dry fermented sausages such as Chorizo (Casaus et al., 1997;<br />
Cintas et al., 1997) and Espetec (Aymerich et al., 1996), both<br />
produced in Spain. Moreover, in German and Italian fermented<br />
sausages, Marchesino et al. (1992) reported concentrations of<br />
enterococci from 10 3 to 10 5 CFU g 1 at the end of the ripening<br />
process in sausages manufactured both with and without starter<br />
cultures.<br />
In Mediterranean countries, many traditional and artisan<br />
fermented meat products are manufactured mostly by small<br />
companies, farms, or local butchers. Usually, they are low-acid<br />
products with a pH higher than standard sausages (pH>5.3). In<br />
these types of products, the fermentation is carried out without<br />
the use of starter cultures, relying on the endogenous flora to<br />
keep the traditional organoleptic qualities. As a consequence,<br />
the natural microbiota is constituted by a mixture of species of<br />
LAB including enterococci and lactobacilli, as well as<br />
coagulase-negative staphylococci and yeasts. These products<br />
have a long history of safe consumption by humans. In a<br />
survey of 31 naturally fermented sausages, purchased at several<br />
supermarkets in the northeast of Spain, the number of<br />
enterococci ranged from 1.3 to 4.48 log CFU g 1 , the<br />
population of total LAB being from 7.12 to 9.07 log CFU<br />
g 1 (Hugas et al., 2003).<br />
The biochemical activities of enterococci in a sausage<br />
matrix have not been studied as in the case of dairy products.<br />
They might contribute to sausage aromatisation by their<br />
glycolytic, proteolytic, and lipolytic activities. Furthermore,<br />
metmyoglobin reduction activity has been described for meat<br />
enterococci (Hugas et al., 2003).<br />
4.2.2. Applicability of bacteriocinogenic enterococci and/or<br />
their enterocins in meat products<br />
Even though there are many bacteriocin-producing enterococcal<br />
strains isolated from various fermented, meat products<br />
(Table 4), only a very limited number of studies has been<br />
conducted aimed at the direct application of such strains in the<br />
production of meat products (Tables 5 and 6). Very recently,<br />
some attempts have been made using E. faecium strains as<br />
adjunct starter cultures or their enterocins for the manufacture<br />
of fermented, meat products.<br />
E. faecium RZS C13 and E. faecium CCM 4231 were<br />
used as starter cultures for the production of Spanish-style<br />
dry, fermented sausages (Callewaert et al., 2000). The<br />
Enterococcus strains were partially competitive during meat<br />
fermentation and strongly inhibited the growth of Listeria<br />
spp. As no production of off-flavours was detected, the<br />
enterococci might be suitable for addition to meat as cocultures<br />
to improve food safety. Aymerich et al. (2000b)<br />
applied the enterocins A and B produced by E. faecium CTC<br />
492 as semi-purified food additives in different meat<br />
products. An inhibitory effect was observed on the growth<br />
of Listeria. However, the addition of the producer strain as<br />
the sole starter culture in dry fermented sausages had no<br />
effect on the inhibition of Listeria growth (Aymerich et al.,<br />
2000a). In contrast, the combination of both E. faecium CTC<br />
492 and its enterocins can prevent ropiness in sliced cooked<br />
ham (Aymerich et al., 2002).<br />
Furthermore, the antilisterial efficiency of enterocins<br />
CRL35 (produced by E. faecium CRL35) has been tested in<br />
broth and a meat system against L. monocytogenes and L.<br />
innocua (Vignolo et al., 2000). Both Listeria species initially<br />
decreased in viable counts followed by regrowth of the<br />
survivors after 1 h in the presence of the enterocins. The<br />
organoleptic properties of the meat model system were not<br />
affected. Finally, the effectiveness of enterocin CCM 4231 in<br />
controlling L. monocytogenes contamination of dry fermented<br />
Hornád salami has been examined (Lauková et al., 1999). The<br />
enterocin addition resulted in the reduction of L. monocytogenes<br />
by 1.67 logs when compared to the control immediately<br />
after the addition of bacteriocin. Although on the second day<br />
the growth of the pathogen in the experimental sample reached<br />
3.38 log CFU g 1 , a difference of 1.72 log was found, in<br />
comparison with the control. After one week of ripening the L.<br />
monocytogenes count in the control reached 10 7 CFU g 1 ,<br />
while in the experimental sample the count was 10 4 CFU g 1 ,<br />
a difference that was <strong>main</strong>tained after 2 and 3 weeks of<br />
ripening.<br />
As stated before and as found also in many other application<br />
studies, it has been shown that there are limitations to the<br />
usefulness of some enterocins as antilisterial agents, as full<br />
suppression of the pathogen is rarely achieved in fermented<br />
food systems (e.g. cheeses). The optimal use of bacteriocins for<br />
inhibiting the growth of Listeria and other foodborne pathogens<br />
or food spoilage microorganisms requires detailed<br />
knowledge of their activity against sensitive strains and the<br />
factors that may limit their effectiveness. These factors can be<br />
revealed through a thorough examination of the foods’<br />
structure and composition and their interaction with bacteriocins.<br />
As a consequence, there is a great need to maximize the<br />
amount of the bioavailable enterocin during the food fermentation<br />
process, by selecting enterococcal strains that are<br />
characterized by a naturally high bacteriocin production<br />
capacity, or, much more importantly, which are well adapted<br />
to the food environment in which they are to be used<br />
(Sarantinopoulos et al., 2002b).<br />
4.3. Vegetables and olives<br />
Enterococci commonly occur in large numbers in vegetables,<br />
olives, and plant material (Mundt, 1963; Fernández-Diaz,<br />
1983; Franz et al., 1999a; Giraffa, 2002; Ben Omar et al.,<br />
2004). However, literature data concerning the isolation and<br />
characterization of enterococci from such products is scarce.<br />
Enterococci have been isolated from Spanish-style green olive<br />
fermentations (Fernández-Diaz, 1983; Floriano et al., 1998; de<br />
Castro et al., 2002), in which E. faecalis and E. faecium are<br />
frequent contaminants. In a very recent study, Ben Omar et al.<br />
(2004) studied the functional properties, the virulence characteristics,<br />
and the antibiotic resistance of fifty enterococcal<br />
isolates from different Spanish food samples. Three of them
16<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
were isolated from olives and belonged to the species E.<br />
faecium. Moreover, it was found that the viable counts of<br />
enterococci from olives obtained on Slanetz and Bartley<br />
medium was 2.210 3 CFU g 1 .<br />
In another very recent study, Randazzo et al. (2004) isolated<br />
a total number of 52 LAB from naturally fermented green<br />
olives collected from different areas of Sicily. Even though the<br />
majority of these strains belonged to the genus of Lactobacillus,<br />
four of them were identified as Enterococcus spp. on the<br />
basis of phenotypic and biochemical traits. Characterization<br />
using restriction fragment length polymorphism (RFLP)<br />
analysis of 16S rDNA revealed that these four strains belonged<br />
to the species E. faecium, E. casseliflavus, and E. hirae. To our<br />
knowledge there is only one study dealing with the role of<br />
enterococci during the fermentation of table olives (de Castro et<br />
al., 2002). In this study, strain Enterococcus casseliflavus cc45,<br />
isolated from the fermentation brine, in combination with strain<br />
Lactobacillus pentosus CECT 5138 of the same origin, were<br />
used as starter cultures in Spanish-style green olive fermentation.<br />
The best results were attained when cultures were used<br />
sequentially, enterococci at day 1 and lactobacilli at day 2. This<br />
type of inoculation produced a quicker brine acidification, a<br />
greater consumption of carbohydrates, and a rapid pH decrease.<br />
The diversity of vegetable products available on the<br />
European market is increasing, and minimally processed,<br />
ready-to-eat type products are popular among consumers. As<br />
these products may pose a health risk, bacteriocinogenic LAB or<br />
purified bacteriocins may be employed to improve their safety.<br />
Nevertheless, the use of bacteriocins, produced by enterococcal<br />
strains, as biopreservatives in vegetables and olives has been<br />
studied to a very small extent (Villani et al., 1993; Franz et al.,<br />
1996; Bennik et al., 1998; Floriano et al., 1998).<br />
5. Conclusions<br />
Enterococci are widespread in nature and are present in dairy<br />
and other fermented food products. They directly contribute to<br />
the typical taste and flavor of traditional Mediterranean cheeses,<br />
as they can grow in a cheese environment. They also seem to<br />
play a role in other traditional fermented foods such as sausages,<br />
olives, and vegetables. Their capacity to produce bacteriocins<br />
active towards spoilage or pathogenic bacteria, in particular<br />
Listeria, might be a powerful tool for the protection of these<br />
products, for instance in the case of raw milk cheeses, for the<br />
production of traditional cheeses with an improved aroma, or<br />
for the production of medium-pH fermented sausages. Also,<br />
enterococci have been used as probiotics because of their<br />
possible health-promoting capacities. However, some enterococci<br />
carry potential virulence factors and can display pathogenic<br />
traits. Furthermore, the number of VRE has been<br />
increasing during the last decade. Fortunately, these important<br />
features are strain-dependent. For these reasons, the selection of<br />
Enterococcus strains of interest in the food industry should be<br />
based on the absence of any possible pathogenic properties, or<br />
transferable antibiotic resistance genes. Modern analysis techniques<br />
as well as up-to-date knowledge on these strains and<br />
their properties will help the food processor and the consumer to<br />
accept enterococci as other LAB as an important player in<br />
certain food products.<br />
Acknowledgments<br />
This work was carried out in the framework of the FAIR-<br />
CT97-3078 project ‘‘Enterococci in Food Fermentations:<br />
Functional and Safety Aspects’’. MRFM was recipient of a<br />
Marie Curie Fellowship (grant FAIR-CT97-5013). PS was<br />
supported by the State Scholarships Foundation of Greece<br />
(IKY-IDrima Kratikon Ypotrofion). LDV acknowledges the<br />
financial support from the Research Council of the VUB and<br />
the Fund for Scientific Research-Flanders.<br />
References<br />
ACNFP, 1996. Report on Enterococcus faecium, strain K77D. MAFF Advisory<br />
Committee on Novel Foods and Processes, Report, Ergon House c/o Nobel<br />
House, 17 Smith Square, London SW1 3JR, United Kingdom.<br />
Agerbaek, M., Gerdes, L.U., Richelsen, B., 1995. Hypocholesteroleamic effect<br />
of a new fermented milk product in healthy middle-aged men. European<br />
Journal of Clinical Nutrition 49, 346–352.<br />
Allen, W.D., Linggood, M.A., Porter, P., 1996. Enterococcus organisms and<br />
their use as probiotics in alleviating irritable bowel syndrome symptoms.<br />
European Patent 0508701 (B1).<br />
Andrighetto, C., Knijff, E., Lombardi, A., Torriani, S., Vancanneyt, M.,<br />
Kersters, K., Swings, J., Dellaglio, F., 2001. Phenotypic and genetic<br />
diversity of enterococci isolated from Italian cheeses. Journal of Dairy<br />
Research 68, 303–316.<br />
Anonymous, 1992. EEC council directive of 16 June 1992 on milk hygiene<br />
(92/46EEC). Official Journal of the European Community L268/1,<br />
14.9.1992.<br />
Aran, N., 1998. A microbiological study of Kashar cheese. Milchwissenschaft<br />
53, 565–568.<br />
Archimbaud, C., Shankar, N., Forestier, C., Baghdayan, A., Gilmore, M.S.,<br />
Charbonne, F., Joly, B., 2002. In vitro adhesive properties and virulence<br />
factors of Enterococcus faecalis strains. Research in Microbiology 153,<br />
75–80.<br />
Arizcun, C., Barcina, Y., Torre, P., 1997. Identification and characterization of<br />
proteolytic activity of Enterococcus spp. isolated from milk and Roncal and<br />
Idiazabal cheese. International Journal of Food Microbiology 38, 17–24.<br />
Arthur, M., Molinas, C., Depardieu, F., Courvalin, P., 1993. Characterization of<br />
Tn1546, aTn3-related transposon conferring glycopeptide resistance by<br />
synthesis of depsipeptide peptidoglycan precursors in Enterococcus<br />
faecium BM4147. Journal of Bacteriology 175, 117–127.<br />
Arthur, M., Reynolds, P.E., Courvalin, P., 1996. Glycopeptide resistance in<br />
enterococci. Trends in Microbiology 4, 401–407.<br />
Audisio, M.C., Oliver, G., Apella, M.C., 1999. Antagonistic effect of<br />
Enterococcus faecium J96 against human and poultry pathogenic Salmonella<br />
spp.. Journal of Food Protection 62, 751–755.<br />
Aymerich, T., Holo, H., Håvarstein, L.S., Hugas, M., Garriga, M., Nes, I.F.,<br />
1996. Biochemical and genetic characterization of enterocin A from<br />
Enterococcus faecium, a new antilisterial bacteriocin in the pediocin family<br />
of bacteriocins. Applied and Environmental Microbiology 62, 1676–1682.<br />
Aymerich, T., Artigas, M.G., Garriga, M., Monfort, J.M., Hugas, M., 2000a.<br />
Effect of sausage ingredients and additives on the production of enterocins<br />
A and B by Enterococcus faecium CTC492. Optimization of in vitro<br />
production and anti-listerial effect in dry fermented sausages. Journal of<br />
Applied Microbiology 88, 686–694.<br />
Aymerich, T., Garriga, M., Ylla, J., Vallier, J., Monfort, J.M., Hugas, M.,<br />
2000b. Application of enterocins as biopreservatives against Listeria<br />
innocua in meat products. Journal of Food Protection 63, 721–726.<br />
Aymerich, M.T., Garriga, M., Costa, S., Monfort, J.M., Hugas, M., 2002.<br />
Prevention of ropiness in cooked pork by bacteriocinogenic cultures.<br />
International Dairy Journal 12, 239–246.
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 17<br />
Balla, E., Dicks, L.M.T., du Toit, M., van der Merwe, M.J., Holzapfel,<br />
W.H., 2000. Characterization and cloning of the genes encoding<br />
enterocin 1071A and enterocin 1071B, two antimicrobial peptides<br />
produced by Enterococcus faecalis BFE1071. Applied and Environmental<br />
Microbiology 66, 1298–1304.<br />
Basso, A., Goffo, A., Rossi, G., Conterno, N., 1994. A preliminary<br />
characterization of the microflora of Montasio cheese—Occurrence of<br />
galactose fermenting strains in cheese and in natural starter cultures.<br />
Microbiologie, Aliments, Nutrition 12, 139–144.<br />
Battistotti, B., Bottazzi, V., Vola, G., 1977. Impiego di Str. faecium, Str.<br />
thermophilus e bacilli lattici nella caseificazione del formaggio Fontina.<br />
Scienza e Tecnica Lattiero-Casearia 28, 331.<br />
Bell, R.G., DeLacey, K.M., 1984. Heat injury and recovery of Streptococcus<br />
faecium associated with the souring of chub-packed luncheon meat. Journal<br />
of Applied Bacteriology 57, 229–236.<br />
Bellomo, G., Mangiagle, A., Nicastro, L., Frigerio, G., 1980. A controlled<br />
double-blind study of SF68 strain as a new biological preparation for the<br />
treatment of diarrhoea in pediatrics. Current Therapeutic Research 28,<br />
927–936.<br />
Ben Embarek, P.K., Jeppesen, V.F., Huss, H.H., 1994. Antibacterial potential of<br />
Enterococcus faecium strains isolated from sous-vide cooked fish fillets.<br />
Food Microbiology 11, 525–536.<br />
Ben Omar, N., Castro, A., Lucas, R., Abriouel, H., Yousif, N.M.K., Franz,<br />
C.M.A.P., Holzapfel, W.H., Pérez-Pulido, R., Martínez-Cañamero, M.,<br />
Gálvez, A., 2004. Functional and safety aspects of enterococci isolated<br />
from different Spanish foods. Systematic and Applied Microbiology 27,<br />
118–130.<br />
Bennik, M.H.J., Vanloo, B., Brasseur, R., Gorris, L.G.M., Smid, E.J., 1998. A<br />
novel bacteriocin with a YGNGV motif from vegetable-associated<br />
Enterococcus mundtii: full characterization and interaction with target<br />
organisms. Biochimica et Biophysica Acta 1373, 47–58.<br />
Bennik, M.H.J., van Overbeek, W., Smid, E.J., Gorris, L.G.M., 1999.<br />
Biopreservation in modified atmosphere stored mungbean sprouts: the use<br />
of vegetable-associated bacteriocinogenic lactic acid bacteria to control the<br />
growth of Listeria monocytogenes. Letters in Applied Microbiology 28,<br />
226–232.<br />
Benyacoub, J., Czarnecki-Maulden, G.L., Cavadini, C., Sauthier, T., Anderson,<br />
R.E., Schiffrin, E.J., von der Weid, T., 2003. Supplementation of food with<br />
Enterococcus faecium (SF68) stimulates immune functions in young dogs.<br />
Journal of Nutrition 133, 1158–1162.<br />
Birollo, G.A., Reinheimer, J.A., Vinderola, C.G., 2001. Enterococci vs. nonlactic<br />
acid microflora as hygiene indicators for sweetened yoghurt. Food<br />
Microbiology 18, 597–604.<br />
Booth, M.C., Bogie, C.P., Sahl, H.-G., Siezen, R.L., Hatter, K.L., Gilmore,<br />
M.S., 1996. Structural analysis and proteolytic activation of Enterococcus<br />
faecalis cytolysin, a novel lantibiotic. Molecular Microbiology 21,<br />
1175–1184.<br />
Bottone, E., Allerhand, J., Pisano, A., 1971. Characteristics of a bacteriocin<br />
derived from Streptococcus faecalis var. zymogenes antagonistic to<br />
Diplococcus pneumoniae. Applied Microbiology 22, 200–204.<br />
Bouton, Y., Guyot, P., Grappin, R., 1998. Preliminary characterization<br />
of microflora of Comté cheese. Journal of Applied Microbiology 85,<br />
123–131.<br />
Brock, T.D., Davies, J.M., 1963. Probable identity of a group D hemolysin with<br />
a bacteriocin. Journal of Bacteriology 134, 229–236.<br />
Buydens, P., Debeuckelaere, S., 1996. Efficacy of SF 68 in the treatment of<br />
acute diarrhea. A placebo-controlled trial. Scandinavian Journal of<br />
Gastroenterology 31, 887–891.<br />
Callewaert, R., Hugas, M., De Vuyst, L., 2000. Competitiveness and<br />
bacteriocin production of enterococci in the production of Spanish-style<br />
dry fermented sausages. International Journal of Food Microbiology 57,<br />
33–42.<br />
Campbell, J.J.R., Gunsalus, I.C., 1944. Citric acid fermentation by streptococci<br />
and lactobacilli. Journal of Bacteriology 48, 71–76.<br />
Carnio, M.C., Eppert, I., Scherer, S., 1999. Analysis of the bacterial surface<br />
ripening flora of German and French smeared cheeses with respect to<br />
their anti-listerial potential. International Journal of Food Microbiology 47,<br />
89–97.<br />
Carrasco de Mendoza, M., Meinardi, C.A., Meinardi, S.A., Arturo, C., 1989.<br />
Actividad caseinolitica exocelular de enterococos para starters lácticos.<br />
Revista Argentina de Lactología 2, 27–37.<br />
Carrasco de Mendoza, M.S., Scarinci, M.S., Huerto-Garat, H.E., Simonetta,<br />
A.C., 1992. Technological properties of enterococci in lactic starters:<br />
acidifying and lipolytic activities. Microbiologie, Aliments, Nutrition, 10,<br />
289–293.<br />
Casalta, E., Zennaro, R., 1997. Effect of specific starters on microbiological,<br />
biochemical and sensory characteristics of Venaco, a Corsican soft cheese.<br />
Sciences des Aliments 17, 79–94.<br />
Casaus, P., Nilsen, T., Cintas, L.M., Nes, I.F., Hernández, P.E., Holo, H., 1997.<br />
Enterocin B, a new bacteriocin from Enterococcus faecium T136 which can<br />
act synergistically with enterocin A. Microbiology 143, 2287–2294.<br />
Centeno, J.A., Cepeda, A., Rodríguez-Otero, J.L., Docampo, F., 1995. Estudio<br />
higienico-sanitario del queso de Arzúa. Alimentaria 33, 91–96.<br />
Centeno, J.A., Menéndez, S., Rodriguez-Otero, J.L., 1996. Main<br />
microbial flora present as natural starters in Cebreiro raw cow’s-milk<br />
cheese (Northwest Spain). International Journal of Food Microbiology 33,<br />
307–313.<br />
Centeno, J.A., Menendez, S., Hermida, M.A., Rodríguez-Otero, J.L., 1999.<br />
Effects of the addition of Enterococcus faecalis in Cebreiro cheese<br />
manufacture. International Journal of Food Microbiology 48, 97–111.<br />
Cetnikaya, Y., Falk, P., Mayhall, C.G., 2000. Vancomycin-resistant enterococci.<br />
Clinical Microbiology Reviews 13, 686–707.<br />
Chander, H., Ranganathan, B., Singh, J., 1979a. Role of some fatty acids on the<br />
growth and lipase production by the Streptococcus faecalis. Journal of Food<br />
Science 44, 1566–1567.<br />
Chander, H., Ranganathan, B., Singh, J., 1979b. Purification and some<br />
properties of lipase from Streptococcus faecalis. Journal of Food Science<br />
44, 1747–1751.<br />
Chow, J.W., Thal, L.A., Perri, M.B., Vazquez, J.A., Donabedian, S.M.,<br />
Clewell, D.B., Zervos, M.J., 1993. Plasmid-associated hemolysin and<br />
aggregation substance production contribute to virulence in experimental<br />
enterococcal endocarditis. Antimicrobial Agents and Chemotherapy 37,<br />
2474–2477.<br />
Cintas, L.M., Rodríguez, J.M., Fernandez, M.F., Sletten, K., Nes, I.F.,<br />
Hernández, P.E., Holo, H., 1995. Isolation and characterization of pediocin<br />
L50, a new bacteriocin from Pediococcus acidilactici with a broad inhibitory<br />
spectrum. Applied and Environmental Microbiology 61, 2643–2648.<br />
Cintas, L.M., Casaus, P., Håvarstein, L.S., Hernández, P.E., Nes, I.F., 1997.<br />
Biochemical and genetic characterization of enterocin P, a novel secdependent<br />
bacteriocin from Enterococcus faecium P13 with a broad<br />
antimicrobial spectrum. Applied and Environmental Microbiology 63,<br />
4321–4330.<br />
Cintas, L.M., Casaus, P., Fenández, M.F., Hernández, P.E., 1998a. Comparative<br />
antimicrobial activity of enterocin L50, pediocin PA-1, nisin A and lactocin<br />
S against spoilage and foodborne pathogenic bacteria. Food Microbiology<br />
15, 289–298.<br />
Cintas, L.M., Casaus, P., Holo, H., Hernández, P.E., Nes, I.F., Håvarstein, L.S.,<br />
1998b. Enterocins L50A and L50B, two novel bacteriocins from Enterococcus<br />
faecium L50, are related to staphylococcal hemolysins. Journal of<br />
Bacteriology 180, 1988–1994.<br />
Cintas, L.M., Casaus, P., Herranz, C., Håvarstein, L.S., Holo, H., Hernández, P.,<br />
Nes, I.F., 2000. Biochemical and genetic evidence that Enterococcus<br />
faecium L50 produces enterocins L50A and L50B, the sec-dependent<br />
enterocin P, and a novel bacteriocin secreted without an N-terminal<br />
extension termed enterocin Q. Journal of Bacteriology 182, 6806–6814.<br />
Cleveland, J., Montville, T.J., Nes, I.F., Chikindas, M.L., 2001. Bacteriocins:<br />
safe, natural antimicrobials for food preservation. International Journal of<br />
Food Microbiology 71, 1 – 20.<br />
Clewell, D.B., 1993. Bacterial sex pheromone-induced plasmid transfer. Cell<br />
73, 9 – 12.<br />
Cogan, T.M., 1987. Co-metabolism of citrate and glucose by Leuconostoc spp.:<br />
effects on growth, substrates and products. Journal of Applied Bacteriology<br />
63, 551–558.<br />
Collins, M.D., Jones, D., Farrow, J.A.E., Kilpper-Bälz, R., Schleifer, K.H.,<br />
1984. Enterococcus avium nom. rev., comb. nov.; E. casseliflavus nom.<br />
rev., comb. nov.; E. durans nom. rev., comb. nov.; E. gallinarum comb.
18<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
nov.; and E. malodoratus sp. nov. International Journal of Systematic<br />
Bacteriology 34, 220–223.<br />
Collins, Y.F., McSweeney, P.L.H., Wilkinson, M.G., 2003. Lipolysis and free<br />
fatty acid catabolism in cheese: a review of current knowledge. International<br />
Dairy Journal 13, 841–866.<br />
Coppola, T.M., Parente, J.E., Dumontet, S., La Peccerella, A., 1988. The<br />
microflora of natural whey cultures utilized as starters in the manufacture of<br />
Mozzarella cheese from water buffalo milk. Lait 68, 295–310.<br />
Coppola, S., Villani, F., Coppola, R., Parente, E., 1990. Comparison of different<br />
starter systems for water-buffalo Mozzarella cheese manufacture. Lait 70,<br />
411–423.<br />
Coventry, M.J., Hillier, A.J., Jago, G.R., 1978. The metabolism of pyruvate and<br />
citrate in the thermoduric cheese starter Streptococcus faecium (Streptococcus<br />
durans). Australian Journal of Dairy Technology 33, 148–154.<br />
Cuesta, P., Fernández-Garcia, E., González de Llano, D., Montilla, A.,<br />
Rodriguez, A., 1996. Evolution of the microbiological and biochemical<br />
characteristics of Afuega’l Pitu cheese during ripening. Journal of Dairy<br />
Science 79, 1693–1698.<br />
Czulak, J., Hammond, L.A., 1956. The use of Streptococcus durans as a cheese<br />
starter. 14th International Dairy Congress, vol. 2, pp. 158–165.<br />
Dahlberg, A.C., Kosikowsky, F.V., 1948. The development of flavor in<br />
American Cheddar cheese made from pasteurized milk with Streptococcus<br />
faecalis starter. Journal of Dairy Science 31, 275–284.<br />
de Castro, A., Montaño, A., Casado, F.-J., Sánchez, A.-H., Rejano, L., 2002.<br />
Utilization of Enterococcus casseliflavus and Lactobacillus pentosus as<br />
starter cultures for Spanish-style green olive fermentation. Food Microbiology<br />
19, 637–644.<br />
De Graef, E.M., Devriese, L.A., Vancanneyt, M., Baele, M., Collins, M.D.,<br />
Lefebvre, K., Swings, J., Haesebrouck, F., 2003. Description of Enterococcus<br />
canis sp. nov. from dogs and reclassification of Enterococcus porcinus<br />
Teixeira et al. 2001 as a junior synonym of Enterococcus villorum<br />
Vancanneyt et al. 2001. International Journal of Systematic and Evolutionary<br />
Microbiology 53, 1069–1074.<br />
Deibel, R.H., Silliker, J.H., 1963. Food poisoning potential of the enterococci.<br />
Journal of Bacteriology 85, 827–832.<br />
del Campo, R., Tenorio, C., Jiménez-Díaz, R., Rubio, C., Gómez-Lus, R.,<br />
Baquero, F., Torres, C., 2001. Bacteriocin production in vancomycinresistant<br />
and vancomycin-susceptible Enterococcus isolates of different<br />
origins. Antimicrobial Agents and Chemotherapy 45, 905–912.<br />
Del Pozo, B.F., Gaya, P., Medina, M., Rodriguez-Marin, M.A., Nuñez, M.,<br />
1988. Changes of microflora of La Serena ewe’s milk cheese during<br />
ripening. Journal of Dairy Research 55, 449–455.<br />
Descheemaeker, P., Lammens, C., Pot, B., Vandamme, P., Goossens, H., 1997.<br />
Evaluation of arbitrarily primed PCR analysis and pulsed-field gel<br />
electrophoresis of large genomic DNA fragments for identification of<br />
enterococci important in human medicine. International Journal of<br />
Systematic Bacteriology 47, 555–561.<br />
Devoyod, J.J., 1969. La flore microbienne du fromage de Roquefort. IV Les<br />
entérocoques. Lait 49, 637–650.<br />
Devriese, L.A., Pot, B., 1995. The genus Enterococcus. In: Wood, B.J.B.,<br />
Holzapfel, W.H. (Eds.), The Lactic Acid Bacteria. The Genera of Lactic<br />
Acid Bacteria, vol. 2. Blackie Academic & Professional, London, United<br />
Kingdom, pp. 327–367.<br />
Devriese, L.A., Ceyssens, K., Rodrigues, U.M., Collins, M.D., 1990.<br />
Enterococcus columbae, a species from pigeon intestines. FEMS Microbiology<br />
Letters 71, 247–252.<br />
Devriese, L.A., Pot, B., Collins, M.D., 1993. Phenotypic identification of the<br />
genus Enterococcus and differentiation of phylogenetically distinct enterococcal<br />
species and species groups. Journal of Applied Bacteriology 75,<br />
399–408.<br />
De Vuyst, L., Vandamme, E.J., 1994. Antimicrobial potential of lactic acid<br />
bacteria. In: De Vuyst, L., Vandamme, E.J. (Eds.), Bacteriocins of Lactic<br />
Acid Bacteria: Microbiology, Genetics and Applications. Blackie Academic<br />
& Professional, London, United Kingdom, pp. 91–142.<br />
De Vuyst, L., Foulquié Moreno, M.R., Revets, H., 2003. Screening for<br />
enterocins and detection of hemolysin and vancomycin resistance in<br />
enterococci of different origins. International Journal of Food Microbiology<br />
84, 299–318.<br />
De Vuyst, L., Avonts, L., Makras, E., 2004. Probotics, prebiotics and gut health<br />
(Chap. 17). Remacle, C., Reusens, B. (Eds.), Functional Foods, Ageing and<br />
Degenerative Disease. Woodhead Publishing Ltd., Cambridge, United<br />
Kingdom, pp. 416–482.<br />
Dovat, A.M., Reinbold, G.W., Hammond, E.G., Vedamuthu, E.R., 1970.<br />
Lipolytic and proteolytic activity of enterococci and lactic group streptococci<br />
isolated from young Cheddar cheese. Journal of Milk and Food<br />
Technology 33, 365–372.<br />
Drinan, D.F., Tobin, S., Cogan, T.M., 1976. Citric acid metabolism in heteroand<br />
homofermentative lactic acid bacteria. Applied and Environmental<br />
Microbiology 31, 481–486.<br />
Durlu-Ozkaya, F., Xanthopoulos, V., Tunail, N., Litopoulou-Tzanetaki, E.,<br />
2001. Technologically important properties of lactic acid bacteria isolates<br />
from Beyaz cheese made from raw ewes’ milk. Journal of Applied<br />
Microbiology 91, 861–870.<br />
Dutka-Malen, S., Evers, S., Courvalin, P., 1995. Detection of glycopeptide<br />
resistance genotypes and identification to the species level of<br />
clinically relevant enterococci by PCR. Journal of Clinical Microbiology<br />
33, 24–27.<br />
du Toit, M., Franz, C.M.A.P., Dicks, L.M.T., Schillinger, U., Haberer, P.,<br />
Warlies, B., Ahrens, F., Holzapfel, W.H., 2000. Preliminary characterization<br />
of bacteriocins produced by Enterococcus faecium and Enterococcus<br />
faecalis isolated from pig faeces. Journal of Applied Microbiology 88,<br />
482–494.<br />
Eaton, T.J., Gasson, M.J., 2001. Molecular screening of Enterococcus virulence<br />
determinants and potential for genetic exchange between food and medical<br />
isolates. Applied and Environmental Microbiology 67, 1628–1635.<br />
Eguchi, T., Kaminaka, K., Shima, J., Kawamoto, S., Mori, K., Choi, S.-H., Doi,<br />
K., Ohmomo, S., Ogata, S., 2001. Isolation and characterization of<br />
enterocin SE-K4 produced by thermophilic enterococci, Enterococcus<br />
faecalis K-4. Bioscience, Biotechnology, And Biochemistry 65, 247–253.<br />
Elotmani, F., Revol-Junelles, A.M., Assobhei, O., Milliere, J.B., 2002.<br />
Characterization of anti-Listeria monocytogenes bacteriocins from Enterococcus<br />
faecalis, Enterococcus faecium, and Lactococcus lactis strains<br />
isolated from Raib, a Moroccan traditional fermented milk. Current<br />
Microbiology 44, 10–17.<br />
El Soda, M., Law, J., Tsakalidou, E., Kalantzopoulos, G., 1995. Lipolytic<br />
activity of cheese related microorganisms and its impact on cheese<br />
flavour. In: Charalambous, G. (Ed.), Food Flavours: Generation, Analysis<br />
and Process Influence. Elsevier Science, London, United Kingdom,<br />
pp. 1823–1847.<br />
Endtz, H.P., van den Braak, N., Verbrugh, H.A., van Belkum, A., 1999.<br />
Vancomycin resistance: status quo and quo vadis. European Journal of<br />
Clinical Microbiology and Infectious Diseases 18, 683–690.<br />
Ennahar, S., Deschamps, N., 2000. Anti-Listeria effect of enterocin A,<br />
produced by cheese-isolated Enterococcus faecium EFM01, relative to<br />
other bacteriocins from lactic acid bacteria. Journal of Applied Microbiology<br />
88, 449–457.<br />
Ennahar, S., Aoude-Weerner, D., Assobhei, O., Hasselmann, C., 1998.<br />
Antilisterial activity of enterocin 81, a bacteriocin produced by Enterococcus<br />
faecium WHE 81 isolated from cheese. Journal of Applied Microbiology<br />
85, 521–526.<br />
Ennahar, S., Sashihara, T., Sonomoto, K., Ishizaki, A., 2000. Class IIa<br />
bacteriocins: biosynthesis, structure and activity. FEMS Microbiology<br />
Reviews 24, 85–106.<br />
Ennahar, S., Asou, Y., Zendo, T., Sonomoto, K., Ishizaki, A., 2001.<br />
Biochemical and genetic evidence for production of enterocins A and B<br />
by Enterococcus faecium WHE 81. International Journal of Food<br />
Microbiology 70, 291–301.<br />
European Commission, 2004. List of the authorized additives in feedingstuffs<br />
published in application of Article 9t (b) of Council Directive 70/524/EEC<br />
concerning additives in feedingstuffs. Official Journal of the European<br />
Union of 25.2.2004, C50.<br />
Farías, M.E., de Ruiz Holgado, A.A.P., Sesma, F., 1994. Bacteriocin production<br />
by lactic acid bacteria isolated from regional cheeses: inhibition of<br />
foodborne pathogens. Journal of Food Protection 57, 1013–1015.<br />
Farías, M.E., Farías, R.N., de Ruiz Holgado, A.P., Sesma, F., 1996. Purification<br />
and N-terminal amino acid sequence of enterocin CRL 35, a Fpediocin-like_
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 19<br />
bacteriocin produced by Enterococcus faecium CRL 35. Letters in Applied<br />
Microbiology 22, 417–419.<br />
Farías, M.E., Nuñez de Kairuz, M., Sesma, F., Palacios, J., de Ruiz Holgado,<br />
A.P., Oliver, G., 1999. Inhibition of Listeria monocytogenes by the<br />
bacteriocin enterocin CRL35 during goat cheese making. Milchwissenschaft<br />
54, 30–32.<br />
Fernandez del Pozo, B., Gaya, P., Medina, M., Rodríguez-Marín, M.A., Nuñez,<br />
M., 1988. Changes in microflora of La Serena ewes’ milk cheese during<br />
ripening. Journal of Dairy Research 55, 440–455.<br />
Fernández-Diaz, M.J., 1983. Olives. In: Rehm, H.J., Reed, G. (Eds.),<br />
Biotechnology. Food and Feed Production by Microorganisms, vol. 5.<br />
Verlag Chemie, Weinheim, pp. 379–397.<br />
Fines, M., Perichon, B., Reynolds, P., Sahm, D.F., Courvalin, P., 1999. VanE, a<br />
new type of acquired glycopeptide resistance in Enterococcus faecalis<br />
BM4405. Antimicrobial Agents and Chemotherapy 43, 2161–2164.<br />
Floriano, B., Ruiz-Barba, J.L., Jiménez-Díaz, R., 1998. Purification and genetic<br />
characterization of enterocin I from Enterococcus faecium 6T1a, a novel<br />
antilisterial plasmid-encoded bacteriocin which does not belong to the<br />
pediocin family of bacteriocins. Applied and Environmental Microbiology<br />
64, 4883–4890.<br />
Folli, C., Ramazzina, I., Arcidiaco, P., Stoppini, M., Berni, R., 2003.<br />
Purification of bacteriocin AS-48 from an Enterococcus faecium strain<br />
and analysis of the gene cluster involved in its production. FEMS<br />
Microbiology Letters 221, 143–149.<br />
Fontecha, J., Pelaez, C., Juares, M., Requena, T., Gomez, C., 1990.<br />
Biochemical and microbiological characteristics of artisanal hard goat’s<br />
cheese. Journal of Dairy Science 73, 1150–1157.<br />
Foulquié Moreno, M.R., Callewaert, R., Devreese, B., Van Beeumen, J., De<br />
Vuyst, L., 2003a. Isolation and biochemical characterisation of enterocins<br />
produced by enterococci from different sources. Journal of Applied<br />
Microbiology 94, 214–229.<br />
Foulquié Moreno, M.R., Rea, M., Cogan, T., De Vuyst, L., 2003b.<br />
Applicability of a bacteriocin-producing Enterococcus faecium as a coculture<br />
in Cheddar cheese manufacture. International Journal of Food<br />
Microbiology 81, 73–84.<br />
Franz, C.M.A.P., Schillinger, U., Holzapfel, W.H., 1996. Production and<br />
characterization of enterocin 900, a bacteriocin produced by Enterococcus<br />
faecium BFE 900 from black olives. International Journal of Food<br />
Microbiology 29, 255–270.<br />
Franz, C.M.A.P., Holzapfel, W.H., Stiles, M.E., 1999a. Enterococci at the<br />
crossroads of food safety? International Journal of Food Microbiology 47,<br />
1 –24.<br />
Franz, C.M.A.P., Worobo, R.W., Quadri, L.E.N., Schillinger, U., Holzapfel,<br />
W.H., Vederas, J.C., Stiles, M.E., 1999b. Atypical genetic locus associated<br />
with constitutive production of enterocin B by Enterococcus faecium BFE<br />
900. Applied and Environmental Microbiology 65, 2170–2178.<br />
Franz, C.M.A.P., Muscholl-Silberhorn, A.B., Yousif, N.M.K., Vancanneyt, M.,<br />
Swings, J., Holzapfel, W., 2001. Incidence of virulence factors and<br />
antibiotic resistance among enterococci isolated from food. Applied and<br />
Environmental Microbiology 67, 4385–4389.<br />
Franz, C.M., Grube, A., Herrmann, A., Abriouel, H., Starke, J., Lombardi, A.,<br />
Tauscher, B., Holzapfel, W.H., 2002. Biochemical and genetic characterization<br />
of the two-peptide bacteriocin enterocin 1071 produced by<br />
Enterococcus faecalis FAIR-E 309. Applied and Environmental Microbiology<br />
68, 2550–2554.<br />
Franz, C.M.A.P., Stiles, M.E., Schleifer, K.H., Holzapfel, W.H., 2003.<br />
Enterococci in foods—a conundrum for food safety. International Journal<br />
of Food Microbiology 88, 105–122.<br />
Freitas, A.C., Pais, C., Malcata, F.X., Hogg, T.A., 1995. Microbiological<br />
characterization of Picante de Beira Baixa cheese. Journal of Food<br />
Protection 59, 155–160.<br />
Freitas, A.C., Pintado, A.E., Pintado, M.E., Malcata, F.X., 1999. Organic acids<br />
produced by lactobacilli, enterococci, and yeasts isolated from Picante<br />
cheese. European Food Research and Technology 209, 434–438.<br />
Fuller, R., 1989. Probiotics in man and animals. Journal of Applied<br />
Bacteriology 66, 365–378.<br />
Gálvez, A., Maqueda, M., Valdivia, E., Quesada, A., Montoya, E., 1986.<br />
Characterization and partial purification of broad spectrum antibiotic AS-48<br />
produced by Streptococcus faecalis. Canadian Journal of Microbiology 32,<br />
765–771.<br />
Gálvez, A., Giménez-Gallego, G., Maqueda, M., Valdivia, E., 1989. Purification<br />
and amino acid composition of peptide antibiotic AS-48 produced by<br />
Streptococcus (Enterococcus) faecalis subsp. liquefaciens S-48. Antimicrobial<br />
Agents and Chemotherapy 33, 437–441.<br />
Gálvez, A., Valdivia, E., Abriouel, H., Camafeita, E., Mendez, E., Martínez-<br />
Bueno, M., Maqueda, M., 1998. Isolation and characterization of enterocin<br />
EJ97, a bacteriocin produced by Enterococcus faecalis EJ97. Archives of<br />
Microbiology 171, 59–65.<br />
García, M.C., Rodríguez, M.J., Bernardo, A., Tornadijo, M.E., Carballo, J.,<br />
2002. Study of enterococci and micrococci isolated throughout manufacture<br />
and ripening of San Simón cheese. Food Microbiology 19, 23–33.<br />
Garcia de Fernando, G.D., Hernandez, P.E., Burgos, J., Sanz, B., Ordoñez, J.A.,<br />
1991a. Extracellular proteinase from Enterococcus faecalis subsp. liquefaciens:<br />
I. Growth and extracellular proteinase production under different<br />
culture conditions. Folia Microbiologica 36, 423–428.<br />
Garcia de Fernando, G.D., Hernandez, P.E., Burgos, J., Sanz, B., Ordoñez, J.A.,<br />
1991b. Extracellular proteinase from Enterococcus faecalis subsp. liquefaciens:<br />
II. Partial purification and some technologically important properties.<br />
Folia Microbiologica 36, 429–436.<br />
Garde, S., Gaya, P., Medina, M., Núñez, M., 1997. Acceleration of flavour<br />
formation in cheese by a bacteriocin-producing adjunct lactic culture.<br />
Biotechnology Letters 19, 1011–1014.<br />
Gardiner, G.E., Ross, R.P., Wallace, J.M., Scanlan, F.P., Jägers, P.P.J.M.,<br />
Fitzgerald, G.F., Collins, J.K., Stanton, C., 1999. Influence of a probiotic<br />
adjunct culture of Enterococcus faecium on the quality of Cheddar cheese.<br />
Journal of Agricultural and Food Chemistry 47, 4907–4916.<br />
Gelsomino, R., Vancanneyt, M., Condon, S., Swings, J., Cogan, T.M., 2001.<br />
Enterococcal diversity in the environment of an Irish Cheddar-type<br />
cheesemaking factory. International Journal of Food Microbiology 71,<br />
177–188.<br />
Gelsomino, R., Vancanneyt, M., Cogan, T.M., Condon, S., Swings, J., 2002.<br />
Source of enterococci in a farmhouse raw-milk cheese. Applied and<br />
Environmental Microbiology 68, 3560–3565.<br />
Gilmore, M.S., Segarra, R.A., Booth, M.C., 1990. An HlyB-type function is<br />
required for expression of the Enterococcus faecalis hemolysin/bacteriocin.<br />
Infection and Immunity 58, 3914–3923.<br />
Gilmore, M.S., Segarra, R.A., Booth, M.C., Bogie, Ch.P., Hall, L.R., Clewell,<br />
D.B., 1994. Genetic structure of Enterococcus faecalis plasmid pAD1-<br />
encoded cytolytic toxin system and its relationship to lantibiotic determinants.<br />
Journal of Bacteriology 176, 7335– 7344.<br />
Giraffa, G., 2002. Enterococci from foods. FEMS Microbiology Reviews 26,<br />
163–171.<br />
Giraffa, G., Carminati, D., 1997. Control of Listeria monocytogenes in the rind<br />
of Taleggio, a surface-smear cheese, by a bacteriocin from Enterococcus<br />
faecium 7C5. Sciences des Aliments 17, 383–391.<br />
Giraffa, G., Neviani, E., Torri Tarelli, G., 1994. Antilisterial activity by<br />
enterococci in a model predicting the temperature evolution of Taleggio, an<br />
Italian soft cheese. Journal of Dairy Science 77, 1176–1182.<br />
Giraffa, G., Carminati, D., Torri Tarelli, G., 1995a. Inhibition of Listeria<br />
innocua in milk by bacteriocin-producing Enterococcus faecium 7C5.<br />
Journal of Food Protection 58, 621–623.<br />
Giraffa, G., Picchioni, N., Neviani, E., Carminati, D., 1995b. Production and<br />
stability of an Enterococcus faecium bacteriocin during Taleggio cheesemaking<br />
and ripening. Food Microbiology 12, 301–307.<br />
Giraffa, G., Carminati, D., Neviani, E., 1997. Enterococci isolated from dairy<br />
products: a review of risks and potential technological use. Journal of Food<br />
Protection 60, 732–738.<br />
Gold, O., Jordan, H.V., van Houte, J., 1975. The prevalence of enterococci in<br />
the human mouth and their pathogenecity in animal models. Archives of<br />
Oral Biology 20, 473–477.<br />
Gomez, R., Vioque, M., Sanchez, E., Mata, C., Tejada, L., Fernandez-Salguero,<br />
J., 2000. Microbial study of farmhouse ewe cheese during storage in olive<br />
oil. Acta of Microbiology and Immunology Hungarian 47, 53–61.<br />
Goupry, S., Croguennec, T., Gentil, E., Robins, R.J., 2000. Metabolic flux in<br />
glucose/citrate co-fermentation by lactic acid bacteria as measured by<br />
isotopic ratio analysis. FEMS Microbiology Letters 182, 207–211.
20<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Granato, P.A., Jackson, R.W., 1969. Bicomponent nature of lysin from<br />
Streptococcus zymogenes. Journal of Bacteriology 100, 856–868.<br />
Granato, P.A., Jackson, R.W., 1971a. Characterization of the A component<br />
of Streptococcus zymogenes lysin. Journal of Bacteriology 107,<br />
551–556.<br />
Granato, P.A., Jackson, R.W., 1971b. Purification and characterization of the L<br />
component of Streptococcus zymogenes lysin. Journal of Bacteriology 108,<br />
804–808.<br />
Gunsalus, I.C., Campbell, J.J.R., 1944. Diversion of the lactic acid fermentation<br />
with oxidized substrate. Journal of Bacteriology 48, 455–561.<br />
Haas, W., Gilmore, M.S., 1999. Molecular nature of a novel bacterial toxin: the<br />
cytolysin of Enterococcus faecalis. Medical Microbiology and Immunology<br />
187, 183–190.<br />
Hagrass, A.E.A., Rayed, E.O., Aly, A.A., Samragy, Y.A., 1991. Growth<br />
characteristics of enterococci isolated from Laban Rayeb. Nahrung 35,<br />
209–213.<br />
Harasawa, R., Sozuki, K., Mitsuaoka, T., 1980. Streptococcus faecium-derived<br />
antibacterial substance antagonistic to bifidobacteria. Antimicrobial Agents<br />
and Chemotherapy 18, 58–62.<br />
Hardie, J.M., Whiley, R.A., 1997. Classification and overview of the genera<br />
Streptococcus and Enterococcus. Society for Applied Bacteriology Symposium<br />
Series 26, 1S–11S.<br />
Havenaar, R., Huis in’t Veld, J.H.J., 1992. Probiotics, general view. In: Wood,<br />
J.B.J. (Ed.), Lactic Acid Bacteria in Health and Disease. Elsevier, London,<br />
United Kingdom, pp. 151–170.<br />
Hegazi, F.Z., 1990a. Growth rate, proteolysis and acid production of<br />
Streptococcus faecalis subsp. liquefaciens in skim milk with some<br />
additives. Nahrung 34, 195–199.<br />
Hegazi, F.Z., 1990b. Extracellular proteinase of Enterococcus faecalis subsp.<br />
liquefaciens: production—milk clotting and proteolytic activities. Microbiologie,<br />
Aliments, Nutrition, 8, 341–348.<br />
Hemati, B., Süssmuth, R., Ezzat, N., El-Shafei, H., El-Soda, M., 1998. Isolation<br />
and characterization of an Enterococcus starter from Egyptian Domiati<br />
cheese. Milchwissenschaft 53, 198–202.<br />
Herranz, C., Mukhopadhyay, S., Casaus, P., Martínez, J.M., Rodríguez,<br />
J.M., Nes, I.F., Cintas, L.M., Hernandez, P.E., 1999. Biochemical and<br />
genetic evidence of enterocin P production by two Enterococcus<br />
faecium-like strains isolated from fermented sausages. Current Microbiology<br />
39, 282–290.<br />
Herranz, C., Casaus, P., Mukhopadhyay, S., Martínez, J.M., Rodríguez, J.M.,<br />
Nes, I.F., Hernández, P.E., Cintas, L.M., 2001. Enterococcus faecium<br />
P21: a strain occurring naturally in dry-fermented sausages producing the<br />
class II bacteriocins enterocin A and enterocin B. Food Microbiology 18,<br />
115–131.<br />
Holzapfel, W.H., Haberer, P., Snel, J., Schillinger, U., Huis in’t Veld, J.H.J.,<br />
1998. Overview of gut flora and probiotics. International Journal of Food<br />
Microbiology 41, 85–101.<br />
Huebner, J., Wang, Y., Krueger, W.A., Madoff, L.C., Martirosian, G., Boisot,<br />
S., Goldmann, D.A., Kasper, D.L., Tzianabos, A.O., Pier, G.B., 1999.<br />
Isolation and chemical characterization of a capsular polysaccharide antigen<br />
shared by clinical isolates of Enterococcus faecalis and vancomycinresistant<br />
Enterococcus faecium. Infection and Immunity 67, 1213–1219.<br />
Hufnagel, M., Koch, S., Kropec, A., Huebner, J., 2003. Opsonophagocytic<br />
assay as a potentially useful tool for assessing safety of enterococcal<br />
preparations. International Journal of Food Microbiology 88, 263–267.<br />
Hugas, M., Garriga, M., Aymerich, M.T., 2003. Functionality of enterococci in<br />
meat products. International Journal of Food Microbiology 88, 223–233.<br />
Hugenholtz, J., 1993. Citrate metabolism in lactic acid bacteria. FEMS<br />
Microbiology Reviews 12, 165–178.<br />
Hugenholtz, J., Perdon, L., Abee, T., 1993. Growth and energy generation by<br />
Lactococcus lactis subsp. lactis biovar diacetylactis during citrate<br />
metabolism. Applied and Environmental Microbiology 59, 4216–4222.<br />
Huycke, M.M., Spiegel, C.A., Gilmore, M.S., 1991. Bacteremia caused by<br />
hemolytic, high-level gentamicin-resistant Enterococcus faecalis. Antimicrobial<br />
Agents and Chemotherapy 35, 1626–1634.<br />
Ike, Y., Clewell, D.B., 1984. Genetic analysis of pAD1 pheromone response in<br />
Streptococcus faecalis using transposon Tn917 as an insertional mutagen.<br />
Journal of Bacteriology 158, 777–783.<br />
Ike, Y., Hashimoto, H., Clewell, D.B., 1984. Hemolysin of Streptococcus<br />
faecalis subspecies zymogenes contributes to virulence in mice. Infection<br />
and Immunity 45, 528–530.<br />
Ike, Y., Clewell, D.B., Segarra, R.A., Gilmore, M.S., 1990. Genetic analysis of<br />
the pAD1 hemolysin/bacteriocin determinant in Enterococcus faecalis:<br />
Tn917 insertional mutagenesis and cloning. Journal of Bacteriology 172,<br />
155–163.<br />
Jennes, W., Dicks, L.M., Verwoerd, D.J., 2000. Enterocin 012, a bacteriocin<br />
produced by Enterococcus gallinarum isolated from the intestinal tract of<br />
ostrich. Journal of Applied Microbiology 88, 349–357.<br />
Jensen, J.P., Reinbold, G.W., Washam, C.J., Vedamuthu, E.R., 1975a. Role of<br />
enterococci in Cheddar cheese: free fatty acid appearance and citric acid<br />
utilization. Journal of Milk and Food Technology 38, 78–83.<br />
Jensen, J.P., Reinbold, G.W., Washam, C.J., Vedamuthu, E.R., 1975b. Role of<br />
enterococci in Cheddar cheese: proteolytic activity and lactic acid<br />
development. Journal of Milk and Food Technology 38, 3 – 7.<br />
Jett, B.D., Jensen, H.G., Nordquist, R.E., Gilmore, M.S., 1992. Contribution of<br />
the pAD1-encoded cytolysin to the severity of experimental Enterococcus<br />
faecalis endophthalmitis. Infection and Immunity 60, 2445–2452.<br />
Jett, B.D., Huycke, M.M., Gilmore, M.S., 1994. Virulence of enterococci.<br />
Clinical Microbiology Reviews 7, 462–478.<br />
Joosten, H.M.L.J., Gaya, P., Núñez, M., 1995. Isolation of tyrosine<br />
decarboxylaseless mutants of a bacteriocin-producing Enterococcus<br />
faecalis strain and their application in cheese. Journal of Food Protection<br />
58, 1222–1226.<br />
Joosten, H.M.L.J., Núñez, M., Devreese, B., Van Beeumen, J., Marugg, J.D.,<br />
1996. Purification and characterization of enterocin 4, a bacteriocin<br />
produced by Enterococcus faecalis INIA 4. Applied and Environmental<br />
Microbiology 62, 4220–4223.<br />
Kalogridou-Vassiliadou, D., Tzanetakis, N., Litopoulou-Tzanetaki, E., 1994.<br />
Microbiological and physicochemical characteristics of FAnthotyro_, a<br />
Greek traditional whey cheese. Food Microbiology 11, 15–19.<br />
Kato, T., Matsuda, T., Yoneyama, Y., Kato, H., Nakamura, R., 1993. Isolation<br />
of Enterococcus faecium with antibacterial activity and characterization of<br />
its bacteriocin. Bioscience, Biotechnology and Biochemistry 57, 551–556.<br />
Kato, T., Matsuda, T., Yoneyama, Y., Kato, H., Nakamura, R., 1994.<br />
Antibacterial substances produced by Enterococcus faecium. Bioscience,<br />
Biotechnology and Biochemistry 58, 411–412.<br />
Kennes, C., Dubourguier, H.-C., Albagnac, G., Nyns, E.J., 1991. Citrate<br />
metabolism by Lactobacillus plantarum isolated from orange juice. Journal<br />
of Applied Bacteriology 70, 380–384.<br />
Kimoto, H., Nomura, M., Suzuki, I., 1999. Growth energetics of Lactococcus<br />
lactis subsp. lactis biovar diacetylactis in cometabolism of citrate and<br />
glucose. International Dairy Journal 9, 857–863.<br />
Kjems, E., 1955. Studies on streptococcal bacteriophages: I. Techniques for<br />
isolating phage producing strains. Pathology and Microbiology Scandinavia<br />
36, 433–440.<br />
Klaenhammer, T.R., 1993. Genetics of bacteriocins produced by lactic acid<br />
bacteria. FEMS Microbiology Reviews 12, 39–86.<br />
Klare, I., Werner, G., Witte, W., 2001. Enterococci. Habitats, infections,<br />
virulence factors, resistances to antibiotics, transfer of resistance determinants.<br />
Contributions to Microbiology 8, 108–122.<br />
Knudtson, L.M., Hartman, P.A., 1993. Enterococci in pork processing. Journal<br />
of Food Protection 56, 6–9.<br />
Krämer, J., Brandis, H., 1975. Mode of action of two Streptococcus faecium<br />
bacteriocins. Antimicrobial Agents and Chemotherapy 7, 117–120.<br />
Krämer, J., Keness, J., Brandis, H., 1983. Transfer of miniplasmid determining<br />
bacteriocin production and bacteriocin immunity in Streptococcus faecium.<br />
FEMS Microbiology Letters 20, 385–389.<br />
Kühnen, E., Sahl, H.-G., Brandis, H., 1985. Purification and properties of LIQ 4,<br />
an antibacterial substance produced by Streptococcus faecalis var. liquefaciens<br />
K 4. Journal of General and Applied Microbiology 131, 1925–1932.<br />
Landman, D., Quale, J.M., 1997. Management of infections due to resistant<br />
enterococci: a review of therapeutic options. Journal of Antimicrobial<br />
Chemotherapy 40, 161–170.<br />
Lauková, A., Czikkova, S., 1999. The use of enterocin CCM 4231 in soy milk<br />
to control the growth of Listeria monocytogenes and Staphylococcus<br />
aureus. Journal of Applied Microbiology 87, 182–186.
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 21<br />
Lauková, A., Czikková, S., 2001. Antagonistic effect of enterocin CCM 4231<br />
from Enterococcus faecium on ‘‘bryndza’’, a traditional Slovak dairy<br />
product from sheep milk. Microbiology Research 156, 31–34.<br />
Lauková, A., Mareková, M., Javorský, P., 1993. Detection and antimicrobial<br />
spectrum of a bacteriocin-like substance produced by Enterococcus faecium<br />
CCM4231. Letters in Applied Microbiology 16, 257–260.<br />
Lauková, A., Czikková, S., Vasilková, Z., Jurix, P., Krupicer, I., 1998.<br />
Antimicrobial effect of enterocin CCM 4231 in the cattle slurry environment.<br />
Cytobios 94, 73–79.<br />
Lauková, A., Czikková, S., Laczková, S., Turek, P., 1999. Use of enterocins<br />
CCM 4231 to control Listeria monocytogenes in experimentally contaminated<br />
dry fermented Hornád salami. International Journal of Food<br />
Microbiology 52, 115–119.<br />
Lauková, A., Vlaemynick, G., Czikková, S., 2001. Effect of enterocin CCM<br />
4231 on Listeria monocytogenes in Saint-Paulin cheese. Folia Microbiologica<br />
46, 157–160.<br />
Leclercq, R., Derlot, E., Duval, J., Courvalin, P., 1988. Plasmid-mediated<br />
resistance to vancomycin and teicoplanin in Enterococcus faecium. The<br />
New England Journal of Medicine 319, 157–161.<br />
Leclercq, R., Dutka-Malen, S., Duval, J., Courvalin, P., 1992. Vancomycin<br />
resistance gene vanC is specific to Enterococcus gallinarum. Antimicrobial<br />
Agents and Chemotherapy 36, 2005–2008.<br />
Ledda, A., Scintu, M.F., Pirisi, A., Sanna, S., Mannu, L., 1994. Technological<br />
characterization of lactococci and enterococci for the manufacture of Fiore<br />
Sardo sheep cheese. Scienza e Tecnica Lattiero-Casearia 45, 443–456.<br />
Leroy, F., De Vuyst, L., 2002. Bacteriocin production by Enterococcus faecium<br />
RZS C5 is cell density limited and occurs in the very early growth phase.<br />
International Journal of Food Microbiology 72, 155–164.<br />
Leroy, F., Foulquié Moreno, M.R., De Vuyst, L., 2003a. Enterococcus faecium<br />
RZS C5, an interesting bacteriocin producer to be used as a coculture in food<br />
fermentation. International Journal of Food Microbiology 88, 235–240.<br />
Leroy, F., Vankrunkelsven, S., De Greef, J., De Vuyst, L., 2003b. The<br />
stimulating effect of a harsh environment on the bacteriocin activity by<br />
Enterococcus faecium RZS C5 and dependency on the environmental stress<br />
factor used. International Journal of Food Microbiology 83, 27–38.<br />
Lilly, D.H., Stillwell, R.H., 1965. Probiotics: growth promoting factors<br />
produced by microorganisms. Science 147, 747–748.<br />
Litopolou-Tzanetaki, E., 1990. Changes in numbers and kinds of lactic acid<br />
bacteria during ripening of Kefalotyri cheese. Journal of Food Science 55,<br />
111–113.<br />
Litopolou-Tzanetaki, E., Tzanetakis, N., Vafopoulou-Mastrojiannaki, A., 1993.<br />
Effect of type of lactic starter on microbiological, chemical and sensory<br />
characteristics of Feta cheese. Food Microbiology 10, 31–41.<br />
Litopoulou-Tzanetaki, E., Tzanetakis, N., 1992. Microbiological study of whitebrined<br />
cheese made from raw goat milk. Food Microbiology 9, 13–19.<br />
López-Diaz, T.M., Santos, J.A., Gonzalez, C.J., Moreno, B., Garcia, M.L.,<br />
1995. Bacteriological quality of traditional Spanish blue cheese. Milchwissenschaft<br />
50, 503–505.<br />
Losteinkit, Ch., Uchiyama, K., Ochi, S., Takaoka, T., Nagahisa, K., Shioya, S.,<br />
2001. Characterization of bacteriocin N15 produced by Enterococcus<br />
faecium N15 and cloning of the related genes. Journal of Bioscience and<br />
Bioengineering 91, 390–395.<br />
Lund, B.M., 1965. A comparison by the use of gel electrophoresis of soluble<br />
protein components and esterase enzymes of some group D streptococci.<br />
Journal of General Microbiology 40, 413–419.<br />
Lund, B., Edlund, C., Barkholt, L., Nord, C.E., Tvede, M., Poulsen, R.L., 2000.<br />
Impact on human intestinal microflora of an Enterococcus faecium<br />
probiotic and vancomycin. Scandinavian Journal of Infectious Diseases<br />
32, 627–632.<br />
Lyon, W.J., Olson, D.G., Murano, E.A., 1995. Isolation and purification of<br />
enterocin EL1, a bacteriocin produced by a strain of Enterococcus faecium.<br />
Journal of Food Protection 58, 890–898.<br />
Macedo, A.C., Malcata, F.X., 1997. Role of adventitious microflora in<br />
proteolysis and lipolysis of Serra cheese: preliminary screening. Zeitschrift<br />
fur Lebensmittel-Untersuchung und -Forschung. A 205, 25–30.<br />
Macedo, C.A., Malcata, F.X., Hogg, T.A., 1995. Microbiological profile in<br />
Serra ewe’s cheese during ripening. Journal of Applied Bacteriology 79,<br />
1–11.<br />
Macedo, A.C., Vieira, M., Poças, R., Malcata, F.X., 2000. Peptidase hydrolase<br />
system of lactic acid bacteria isolated from Serra da Estrela cheese.<br />
International Dairy Journal 10, 769–774.<br />
Magnus, C.A., Ingledew, W.M., McCurdy, A.R., 1986. Thermal resistance of<br />
streptococci isolated from pasteurized ham. Canadian Institute of Food<br />
Science and Technology Journal 19, 62–67.<br />
Magnus, C.A., McCurdy, A.R., Ingledew, W.M., 1988. Further studies on the<br />
thermal resistance of Streptococcus faecium and Streptococcus faecalis in<br />
pasteurized ham. Canadian Institute of Food Science and Technology<br />
Journal 21, 209–212.<br />
Maisnier-Patin, S., Forni, E., Richard, J., 1996. Purification, partial characterisation<br />
and mode of action of enterococcin EFS2, an antilisterial bacteriocin<br />
produced by a strain of Enterococcus faecalis isolated from a cheese.<br />
International Journal of Food Microbiology 30, 255–270.<br />
Mannu, L., Paba, A., 2002. Genetic diversity of lactococci and enterococci<br />
isolated from home-made Pecorino Sardo ewes’ milk cheese. Journal of<br />
Applied Microbiology 92, 55–62.<br />
Mannu, L., Paba, A., Pes, M., Floris, R., Scintu, M.F., Morelli, L., 1999. Strain<br />
typing among enterococci isolated from home-made Pecorino Sardo cheese.<br />
FEMS Microbiology Letters 170, 25–30.<br />
Manolopoulou, E., Sarantinopoulos, P., Zoidou, E., Aktypis, A., Moschopoulou,<br />
E., Kandarakis, I.G., Anifantakis, E.M., 2003. Evolution of microbial<br />
populations during traditional Feta cheese manufacture and ripening.<br />
International Journal of Food Microbiology 82, 153–161.<br />
Marchesino, B., Bruttin, A., Romailler, N., Moreton, R.S., 1992. Microbiological<br />
events during commercial meat fermentations. Journal of Applied<br />
Bacteriology 73, 203–209.<br />
Martínez-Bueno, M., Maqueda, M., Gálvez, A., Samyn, B., van Beeumen, J.,<br />
Coyette, J., 1994. Determination of the gene sequence and the molecular<br />
structure of the enterococcal peptide antibiotic AS-48. Journal of<br />
Bacteriology 176, 6334–6339.<br />
Martínez-Moreno, J.L., 1976. Microbial flora of Manchego cheese: III.<br />
Streptococci. Anales del Instituto Nacional de Investigaciones Agrarias.<br />
Serie General 4, 41–56.<br />
Martínez-Murcia, A.J., Collins, M.D., 1991. Enterococcus sulfureus, a new<br />
yellow-pigmented Enterococcus species. FEMS Microbiology Letters 64,<br />
69–74.<br />
McAuliffe, O., Ross, R.P., Hill, C., 2001. Lantibiotics: structure, biosynthesis<br />
and mode of action. FEMS Microbiology Reviews 25, 285–308.<br />
McKessar, S.J., Berry, A.M., Bell, J.M., Turnidge, J.D., Paton, J.C., 2000.<br />
Genetic characterization of vanG, a novel vancomycin resistance locus of<br />
Enterococcus faecalis. Antimicrobial Agents and Chemotherapy 44,<br />
3224–3228.<br />
Mendoza, F., Maqueda, M., Gálvez, A., Martínez-Bueno, M., Valdivia, E.,<br />
1999. Antilisterial activity of peptide AS-48 and study of changes<br />
induced in the cell envelope properties of an AS-48-adapted strain of<br />
Listeria monocytogenes. Applied and Environmental Microbiology 65,<br />
618–625.<br />
Menéndez, S., Centeno, J.A., Godínez, M.R., Rodríguez-Otero, J.L., 1998.<br />
Algunas propiedades tecnológicas y actividades enzimáticas de cepas de<br />
Enterococcus faecalis aisladas del queso del Cebreiro. Alimentaria 296,<br />
71–76.<br />
Menéndez, S., Godínez, R., Centeno, J.A., Rodríguez-Otero, J.L., 2001.<br />
Microbiological, chemical and biochemical characteristics of ‘‘Tetilla’’ raw<br />
cows-milk cheese. Food Microbiology 18, 151–158.<br />
Moll, G.N., Konings, W.N., Driessen, J.M., 1999. Bacteriocins: mechanism of<br />
membrane insertion and pore formation. Antonie van Leeuwenhoek 76,<br />
185–198.<br />
Morea, M., Baruzzi, F., Cocconcelli, P.S., 1999. Molecular and physiological<br />
characterization of dominant bacterial populations in traditional Mozzarella<br />
cheese processing. Journal of Applied Microbiology 87, 574–582.<br />
Moreno, M.R.F., Leisner, J.J., Tee, L.K., Radu, S., Rusul, G., Vancanneyt, M.,<br />
De Vuyst, L., 2002. Microbial analysis of Malaysian tempeh, and<br />
characterization of two bacteriocins produced by isolates of Enterococcus<br />
faecium. Journal of Applied Microbiology 92, 147–157.<br />
Morovský, M., Pristax, P., Czikková, S., Javorský, P., 1998. A bacteriocinmediated<br />
antagonism by Enterococcus faecium BC25 against ruminal<br />
Streptococcus bovis. Microbiological Research 153, 277–281.
22<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
Morovský, M., Pristax, P., Javorský, P., Nes, I.F., Holo, H., 2001. Isolation and<br />
characterization of enterocin BC25 and occurrence of the entA gene among<br />
ruminal Gram-positive cocci. Microbiological Research 156, 133–138.<br />
Mundt, O.J., 1963. Occurrence of enterococci on plants in a wild environment.<br />
Applied Microbiology 11, 141–144.<br />
Mundt, O.J., 1986. Enterococci. In: Sneath, P.H.A., Mair, N.S., Sharpe, M.E.,<br />
Holt, J.G. (Eds.), Bergey’s Manual of Systematic Bacteriology, vol. 2.<br />
Williams and Wilkins, Baltimore, pp. 1063–1065.<br />
Mundy, L.M., Sahm, D.F., Gilmore, M., 2000. Relationships between<br />
enterococcal virulence and antimicrobial resistance. Clinical Microbiology<br />
Reviews 13, 513–522.<br />
Murray, B.E., 1997. Vancomycin-resistant enterococci. American Journal of<br />
Medicine 102, 284–293.<br />
Murray, B.E., 1998. Diversity among multidrug-resistant enterococci. Emerging<br />
Infectious Diseases 4, 37–47.<br />
Nakagawa, S., 1979. Studies on bacteriocins produced by group D streptococci:<br />
I. Characterization of several bacteriocins. Hiroshima Journal of Medical<br />
Sciences 27, 809–825.<br />
Nakagawa, S., Matsuo, Y., 1981. Bacteriocin and hemolysin from Streptococcus<br />
faecium. Antimicrobial Agents and Chemotherapy 20, 542–544.<br />
Nes, I.F., Diep, D.B., Havarstein, L.S., Brurberg, M.B., Eijsink, V., Holo, H.,<br />
1996. Biosynthesis of bacteriocins in lactic acid bacteria. Antonie van<br />
Leeuwenhoek 70, 113–128.<br />
Nilsen, T., Nes, I.F., Holo, H., 2003. Enterolysin A, a cell wall-degrading<br />
bacteriocin from Enterococcus faecalis LMG 2333. Applied and Environmental<br />
Microbiology 69, 2975–2984.<br />
Nissen-Meyer, J., Nes, I.F., 1997. Ribosomally synthesized antimicrobial<br />
peptides: their function, structure, biogenesis, and mechanism of action.<br />
Archives of Microbiology 167, 67–77.<br />
Núñez, M., Rodríguez, J.L., García, E., Gaya, P., Medina, M., 1997.<br />
Inhibition of Listeria monocytogenes by enterocin 4 during the manufacture<br />
and ripening of Manchego cheese. Journal of Applied Microbiology<br />
83, 671–677.<br />
Ohmomo, S., Murata, S., Katayama, N., Nitisinprasart, S., Kobayashi, M.,<br />
Nakajima, T., Yajima, M., Nakanishi, K., 2000. Purification and some<br />
characteristics of enterocin ON-157, a bacteriocin produced by Enterococcus<br />
faecium NIAI 157. Journal of Applied Microbiology 88, 81–89.<br />
O’Keeffe, T., Hill, C., Ross, R.P., 1999. Characterization and heterologous<br />
expression of the genes encoding enterocin A production, immunity, and<br />
regulation in Enterococcus faecium DPC1146. Applied and Environmental<br />
Microbiology 65, 1506–1515.<br />
Olasupo, N.A., Schillinger, U., Franz, C.M.A.P., Holzapfel, W.H., 1994.<br />
Bacteriocin production by Enterococcus faecium NA01 from Fwara_—a<br />
fermented skimmed cow milk product from West Africa. Letters in Applied<br />
Microbiology 19, 438–441.<br />
Onda, T., Yanagida, F., Uchimura, T., Tsuji, M., Ogino, S., Shinohara, T.,<br />
Yokotsuka, K., 2002. Widespread distribution of the bacteriocin-producing<br />
lactic acid cocci in Miso-paste products. Journal of Applied Microbiology<br />
92, 695–705.<br />
Ordoñez, J.A., Barneto, R., Ramos, M., 1978. Studies on Manchego cheese<br />
ripened in olive oil. Milchwissenschaft 33, 609–612.<br />
O’Sullivan, M.G., Thornton, G., O’Sullivan, G.C., Collins, J.K., 1992.<br />
Probiotic bacteria: myth or reality? Trends in Food Science and Technology<br />
3, 309–314.<br />
Oumer, B.A., Gaya, P., Fernandez-Garcia, E., Marciaca, R., Garde, S., Medina,<br />
M., Núñez, M., 2001. Proteolysis and formation of volatile compounds in<br />
cheese manufactured with a bacteriocin-producing adjunct culture. Journal<br />
of Dairy Research 68, 117–129.<br />
Palles, T., Beresford, T., Condon, S., Cogan, T.M., 1998. Citrate metabolism in<br />
Lactobacillus casei and Lactobacillus plantarum. Journal of Applied<br />
Microbiology 85, 147–154.<br />
Papageorgiou, D.K., Abrahim, A., Bori, M., Doundounakis, S., 1998. Chemical<br />
and bacteriological characteristics of Pichtogalo Chanion cheese and<br />
mesophilic starter cultures for its production. Journal of Food Protection<br />
61, 688–692.<br />
Parente, E., Hill, C., 1992a. A comparison of factors affecting the production of<br />
two bacteriocins from lactic acid bacteria. Journal of Applied Bacteriology<br />
73, 290–298.<br />
Parente, E., Hill, C., 1992b. Characterization of enterocin 1146, a bacteriocin<br />
from Enterococcus faecium inhibitory to Listeria monocytogenes. Journal<br />
of Food Protection 55, 497–502.<br />
Parente, E., Hill, C., 1992c. Inhibition of Listeria in buffer, broth, and milk by<br />
enterocin 1146, a bacteriocin produced by Enterococcus faecium. Journal of<br />
Food Protection 55, 503–508.<br />
Parente, E., Ricciardi, A., 1994a. Influence of pH on the production of<br />
enterocin 1146 during batch fermentation. Letters in Applied Microbiology<br />
19, 12–15.<br />
Parente, E., Ricciardi, A., 1994b. Optimization of the production of<br />
enterocin 1146, a bacteriocin produced by Enterococcus faecium.<br />
Proceedings of the 6th European Congress on Biotechnology, Florence,<br />
Italy, pp. 229–232.<br />
Parente, E., Villani, F., Coppola, R., Coppola, S., 1989. A multiple<br />
strain starter for water-buffalo Mozzarella cheese manufacture. Lait 69,<br />
271–279.<br />
Parente, E., Brienza, C., Ricciardi, A., Addario, G., 1997. Growth and<br />
bacteriocin production by Enterococcus faecium DPC1146 in batch and<br />
continuous culture. Journal of Industrial Microbiology and Biotechnology<br />
18, 62–67.<br />
Pérez Elortondo, F.J., Albisu, M., Barcina, Y., 1999. Physicochemical<br />
properties and secondary microflora variability in the manufacture and<br />
ripening of Idiazabal cheese. Lait 79, 281–290.<br />
Perichon, B., Reynolds, P.E., Courvalin, P., 1997. VanD-type glycopeptideresistant<br />
Enterococcus faecium BM4339. Antimicrobial Agents and<br />
Chemotherapy 41, 2016–2018.<br />
Pier, G.B., Koles, N.L., Meluleni, G., Hatano, K., Pollack, M., 1994.<br />
Specificity and function of murine monoclonal antibodies and immunization-induced<br />
human polyclonal antibodies to lipopolysaccharide subtypes<br />
of Pseudomonas aeruginosa serogroup 06. Infection and Immunity 62,<br />
1137–1143.<br />
Poullet, B., Huertas, M., Sánchez, A., Cáceres, P., Larriba, G., 1993. Main<br />
lactic acid bacteria isolated during ripening of Casar de Cáceres cheese.<br />
Journal of Dairy Research 60, 123–127.<br />
Pritchard, G.G., Coolbear, T., 1993. The physiology and biochemistry of the<br />
proteolytic system in lactic acid bacteria. FEMS Microbiology Reviews 12,<br />
179–206.<br />
Prodromou, K., Thasitou, P., Haritonidou, E., Tzanetakis, N., Litopoulou-<br />
Tzanetaki, E., 2001. Microbiology of ‘‘Orinotyri’’, a ewe’s milk cheese<br />
from the Greek mountains. Food Microbiology 18, 319–328.<br />
Quintiliani Jr., R., Evers, S., Courvalin, P., 1993. The vanB gene confers<br />
various levels of self-transferable resistance to vancomycin in enterococci.<br />
Journal of Infectious Diseases 167, 1220–1223.<br />
Raffe, D., 1994. Analisis cromatográfico del perfil de ácidos orgánicos de<br />
cadena corta en quesos tipo Palmita elaborados con leche pasteurizada.<br />
Tesis de Grado, Universidad del Zulia, Facultad Exp. de Ciencias,<br />
Maracaibo, Venezuela.<br />
Ramos, M., Barneto, R., Ordoñez, J.A., 1981. Evaluation of a specific starter<br />
for Manchego cheese production. Milchwissenschaft 36, 528–531.<br />
Randazzo, C.L., Restuccia, C., Romano, A.D., Caggia, C., 2004. Lactobacillus<br />
casei, dominant species in naturally fermented Sicilian green olives.<br />
International Journal of Food Microbiology 90, 9 –14.<br />
Rea, M.C., Cogan, T.M., 2003a. Glucose prevents citrate metabolism by<br />
enterococci. International Journal of Food Microbiology 88, 201–206.<br />
Rea, M.C., Cogan, T.M., 2003b. Catabolite repression in Enterococcus faecalis.<br />
Systematic and Applied Microbiology 26, 159–164.<br />
Reichelt, T., Kennes, J., Krämer, J., 1984. Co-transfer of two plasmids<br />
determining bacteriocin production and sucrose utilization in Streptococcus<br />
faecium. FEMS Microbiology Letters 23, 147–150.<br />
Richelsen, B., Kristensen, K., Pedersen, S.B., 1996. Long-term (6 months)<br />
effect of a new fermented milk product on the level of plasma lipoproteins:<br />
a placebo-controlled and double blind study. European Journal of Clinical<br />
Nutrition 50, 811–815.<br />
Riley, M.A., Wertz, J.E., 2002. Bacteriocin diversity: ecological and evolutionary<br />
perspectives. Biochimie 84, 357–364.<br />
Rodríguez, J.L., Gaya, P., Medina, M., Nùñez, M., 1997. Bactericidal effect of<br />
enterocin 4 on Listeria monocytogenes in a model dairy system. Journal of<br />
Food Protection 60, 28–32.
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1–24 23<br />
Rodríguez, E., González, B., Gaya, P., Nùñez, M., Medina, M., 2000. Diversity<br />
of bacteriocins produced by lactic acid bacteria isolated from raw milk.<br />
International Dairy Journal 10, 7 – 15.<br />
Rodríguez, E., Arques, J.L., Gaya, P., Nùñez, M., Medina, M., 2001. Control of<br />
Listeria monocytogenes by bacteriocins and monitoring of bacteriocinproducing<br />
lactic acid bacteria by colony hybridization in semi-hard raw<br />
milk cheese. Journal of Dairy Research 68, 131–137.<br />
Rodríguez, J.M., Martínez, M.I., Horn, N., Dodd, H.M., 2003. Heterologous<br />
production of bacteriocins by lactic acid bacteria. International Journal of<br />
Food Microbiology 80, 101–116.<br />
Rossi, E.A., Vendramini, R.C., Carlos, I.Z., Pei, Y.C., de Valdez, G.F., 1999.<br />
Development of a novel fermented soymilk product with potential<br />
probiotic properties. European Food Research and Technology 209,<br />
305–307.<br />
Saavedra, L., 2001. Clinical applications of probiotic agents. American Journal<br />
of Clinical Nutrition 73, 1147S–1151S.<br />
Saavedra, L., Taranto, M.P., Sesma, F., de Valdez, G.F., 2003. Homemade<br />
traditional cheeses for the isolation of probiotic Enterococcus faecium<br />
strains. International Journal of Food Microbiology 88, 241–245.<br />
Sabia, C., Manicardi, G., Messi, P., de Niederhausern, S., Bondi, M., 2002.<br />
Enterocin 416K1, an antilisterial bacteriocin produced by Enterococcus<br />
casseliflavus IM 416K1 isolated from Italian sausages. International Journal<br />
of Food Microbiology 75, 163–170.<br />
Sabia, C., de Niederhausern, S., Messi, P., Manicardi, G., Bondi, M.,<br />
2003. Bacteriocin-producing Enterococcus casseliflavus IM 416K1, a<br />
natural antagonist for control of Listeria monocytogenes in Italian<br />
sausages (‘‘cacciatore’’). International Journal of Food Microbiology 87,<br />
173–179.<br />
Salminen, S., Isolauri, E., Salminen, E., 1996. Clinical uses of probiotics for<br />
stabilising gut mucosal barrier: successful strains and future challenges.<br />
Antonie van Leeuwenhoek 70, 347–358.<br />
Sánchez-Hidalgo, M., Maqueda, M., Gálvez, A., Abriouel, H., Valdivia, E.,<br />
Martínez-Bueno, M., 2003. The genes coding for enterocin EJ97 are located<br />
on a conjugative plasmid. Applied and Environmental Microbiology 69,<br />
1633–1641.<br />
Sarantinopoulos, P., Andrighetto, C., Georgalaki, M.D., Rea, M.C., Lombardi,<br />
A., Cogan, T.M., Kalantzopoulos, G., Tsakalidou, E., 2001a. Biochemical<br />
properties of enterococci relevant to their technological performance.<br />
International Dairy Journal 11, 621–647.<br />
Sarantinopoulos, P., Kalantzopoulos, G., Tsakalidou, E., 2001b. Citrate<br />
metabolism by Enterococcus faecalis FAIR-E 229. Applied and Environmental<br />
Microbiology 67, 5482–5487.<br />
Sarantinopoulos, P., Kalantzopoulos, G., Tsakalidou, E., 2002a. Effect of<br />
Enterococcus faecium on microbiological, physicochemical and sensory<br />
characteristics of Greek Feta cheese. International Journal of Food<br />
Microbiology 76, 93–105.<br />
Sarantinopoulos, P., Leroy, F., Leontopoulou, E., Georgalaki, M.D., Kalantzopoulos,<br />
G., Tsakalidou, E., De Vuyst, L., 2002b. Bacteriocin production by<br />
Enterococcus faecium FAIR-E 198 in view of its application as adjunct<br />
starter in Greek Feta cheese making. International Journal of Food<br />
Microbiology 72, 125–136.<br />
Sarantinopoulos, P., Makras, L., Vaningelgem, F., Kalantzopoulos, G., De<br />
Vuyst, L., Tsakalidou, E., 2003. Growth and energy generation by<br />
Enterococcus faecium FAIR-E 198 during citrate metabolism. International<br />
Journal of Food Microbiology 84, 197–206.<br />
Saris, P.E.J., Immonen, T., Reis, M., Sahl, H.G., 1996. Immunity to lantibiotics.<br />
Antonie van Leeuwenhoek 69, 151–159.<br />
Schleifer, K.H., Kilpper-Bälz, R., 1984. Transfer of Streptococcus faecalis and<br />
Streptococcus faecium to the genus Enterococcus nom. rev. as Enterococcus<br />
faecalis comb. nov. and Enterococcus faecium comb. nov. International<br />
Journal of Systematic Bacteriology 34, 31–34.<br />
Schleifer, K.H., Kilpper-Bälz, R., 1987. Molecular and chemotaxonomic<br />
approaches to the classification of streptococci, enterococci and lactococci:<br />
a review. Systematic and Applied Microbiology 10, 1 –19.<br />
Sessions, V.A., Lovegrove, J.A., Taylor, G.R.J., 1997. The effect of a new<br />
fermented milk product on total plasma cholesterol, LDL-cholesterol and<br />
apolipoprotein B concentrations in middle-aged men and women. In:<br />
Sadler, M.J., Saltmarch, M. (Eds.), Functional Foods: The Consumer, The<br />
Product, and The Evidence. The Royal Society of Chemistry, London,<br />
United Kingdom, pp. 15–19.<br />
Shankar, V., Baghdayan, A.S., Huycke, M.M., Lindahl, G., Gilmore, M.S.,<br />
1999. Infection-derived Enterococcus faecalis strains are enriched in<br />
esp, a gene encoding a novel surface protein. Infection and Immunity 67,<br />
193–200.<br />
Sherwood, N.P., Russell, B.E., Jay, A.R., Bowman, K., 1949. Studies on<br />
streptococci: III. New antibiotic substances produced by beta hemolytic<br />
streptococci. Journal of Infectious Diseases 84, 88–91.<br />
Simonetta, A.C., Moragues de Velasco, L.G., Frisón, L.N., 1997. Antibacterial<br />
activity of enterococci strains against Vibrio cholerae. Letters in Applied<br />
Microbiology 24, 139–143.<br />
Singh, K.V., Qin, X., Weinstock, G.M., Murray, B.E., 1998. Generation and<br />
testing of mutants of Enterococcus faecalis in a mouse peritonitis model.<br />
Journal of Infectious Diseases 178, 1416–1420.<br />
Somkuti, G.A., Babel, F.J., 1969. Hydrolytic breakdown of casein by a<br />
proteinase of Streptococcus faecalis var. liquefaciens. Journal of Dairy<br />
Science 52, 1186–1191.<br />
Sousa, M.J., Ardö, Y., McSweeney, P.L.H., 2001. Advances in the study<br />
of proteolysis during cheese ripening. International Dairy Journal 11,<br />
327–345.<br />
Stackebrandt, E., Teuber, M., 1988. Molecular taxonomy and phylogenetic<br />
position of lactic acid bacteria. Biochimie 70, 317–324.<br />
Starrenburg, M.J., Hugenholtz, J., 1991. Citrate fermentation by Lactococcus<br />
and Leuconostoc spp. Applied and Environmental Microbiology 57,<br />
3535–3540.<br />
Stiles, M.E., Ramji, N.W., Paradis, D.C., 1978. Incidence and relationship of<br />
group D streptococci with other indicator organisms in meats. Canadian<br />
Journal of Microbiology 24, 1502–1508.<br />
Su, Y.A., Sulavik, M.C., He, P., Mäkinen, K.K., Mäkinen, P., Fiedler, S., Wirth,<br />
R., Clewell, D.B., 1991. Nucleotide sequence of the gelatinase gene (gelE)<br />
from Enterococcus faecalis subsp. liquefaciens. Infection and Immunity 59,<br />
415–420.<br />
Sulzer, G., Busse, M., 1991. Growth inhibition of Listeria spp. on Camembert<br />
cheese by bacteria producing inhibitory substances. International Journal of<br />
Food Microbiology 14, 287–296.<br />
Suzzi, G., Caruso, M., Gardini, F., Lombardi, A., Vannini, L., Guerzoni, M.E.,<br />
Andrighetto, C., Lanorte, M.T., 2000. A survey of the enterococci isolated<br />
from an artisanal Italian goat’s cheese (Semicotto Caprino). Journal of<br />
Applied Microbiology 89, 267–274.<br />
Svec, P., Devriese, L.A., Sedlacek, I., Baele, M., Vancanneyt, M., Haesebrouck,<br />
F., Swings, J., Doskar, J., 2001. Enterococcus haemoperoxidus sp.<br />
nov. and Enterococcus moraviensis sp. nov., isolated from water.<br />
International Journal of Systematic and Evolutionary Microbiology 51,<br />
1567–1574.<br />
Tavaria, F.K., Malcata, F.X., 1998. Microbiological characterization of Serra da<br />
Estrela cheese throughout its Appelation d’Origine Protegée region. Journal<br />
of Food Protection 61, 601–607.<br />
Teuber, M., Perreten, V., Wirsching, F., 1996. Antibiotikumresistente Bakterien:<br />
Eine neue Dimension in der Lebensmittelmikrobiologie. Lebensmitteltechnologie<br />
29, 182–199.<br />
Thompson, T.L., Marth, E.H., 1986. Changes in Parmesan cheese during<br />
ripening: microflora-coliforms, enterococci, anaerobs, propionibacteria and<br />
staphylococci. Milchwissenschaft 41, 201–204.<br />
Tomita, H., Fujimoto, S., Tanimoto, K., Ike, Y., 1996. Cloning and genetic<br />
organization of the bacteriocin 31 determinant encoded on the Enterococcus<br />
faecalis pheromone-responsive conjugative element pYI17. Journal of<br />
Bacteriology 178, 3585–3593.<br />
Tomita, H., Fujimoto, S., Tanimoto, K., Ike, Y., 1997. Cloning and genetic<br />
organization of the bacteriocin 21 determinant encoded on the Enterococcus<br />
faecalis pheromone-responsive conjugative plasmid pPD1. Journal of<br />
Bacteriology 179, 7843–7855.<br />
Tornadijo, M.E., Fresno, J.M., Bernardo, A., Marin Sarmiento, R., Carballo,<br />
J., 1995. Microbiological changes throughout the manufacturing and<br />
ripening of Spanish goat’s raw milk cheese (Armada variety). Lait 75,<br />
551–570.<br />
Torriani, S., Dellaglio, F., Lombardi, A., 1998. Micorbiological contribution to<br />
the study of Monte Veronese cheese. Proceedings of the Symposium
24<br />
M.R. Foulquié Moreno et al. / International Journal of Food Microbiology 106 (2006) 1 – 24<br />
‘‘Quality and Microbiology of Traditional and Raw Milk Cheeses’’, Dijon,<br />
France, pp. 239–250.<br />
Torri Tarelli, G., Carminati, D., Giraffa, G., 1994. Production of bacteriocins<br />
active against Listeria monocytogenes and Listeria innocua from dairy<br />
enterococci. Food Microbiology 11, 243–252.<br />
Trovatelli, L.D., Schliesser, A., 1987. Identification and significance of<br />
enterococci in hard cheese made from raw cow and sheep milk.<br />
Milchwissenschaft 42, 717–719.<br />
Tsakalidou, E., Manolopoulou, E., Tsilibari, V., Georgalaki, M., Kalantzopoulos,<br />
G., 1993. Esterolytic activities of Enterococcus durans and Enterococcus<br />
faecium strains isolated from Greek cheese. Netherlands Milk and<br />
Dairy Journal 47, 145–150.<br />
Tsakalidou, E., Dalezios, I., Kalantzopoulos, G., 1994a. Isolation and partial<br />
characterization of an intracellular esterase from Enterococcus faecium<br />
ACA-DC 237. Journal of Biotechnology 37, 201–208.<br />
Tsakalidou, E., Manolopoulou, E., Kabaraki, E., Zoidou, E., Pot, B., Kersters,<br />
K., Kalantzopoulos, G., 1994b. The combined use of whole cell protein<br />
extracts for the identification (SDS-PAGE) and enzyme activity screening<br />
of lactic acid bacteria isolated from traditional Greek dairy products.<br />
Systematic and Applied Microbiology 17, 444–458.<br />
Tzanetakis, N., Litopoulou-Tzanetaki, E., 1992. Changes in numbers and kinds<br />
of lactic acid bacteria in Feta and Teleme, two Greek cheeses from ewe’s<br />
milk. Journal of Dairy Science 75, 1389–1393.<br />
Tzanetakis, N., Vafopoulou-Mastrojiannaki, A., Litopoulou-Tzanetaki, E.,<br />
1995. The quality of white brined cheese from goat’s milk made with<br />
different starters. Food Microbiology 12, 55–63.<br />
Urdaneta, D., Raffe, D., Ferrer, A., Sulbarán de Ferrer, B., Cabrera, L., Pérez,<br />
M., 1995. Short-chain organic acids produced on glucose, lactose, and<br />
citrate media by Enterococcus faecalis, Lactobacillus casei, and Enterobacter<br />
aerogenes strains. Bioresource Technology 54, 99–103.<br />
Vancanneyt, M., Lombardi, A., Andrighetto, C., Knijff, E., Torriani, S.,<br />
Bjorkroth, K.J., Franz, C.M., Foulquie Moreno, M.R., Revets, H., De<br />
Vuyst, L., Swings, J., Kersters, K., Dellaglio, F., Holzapfel, W.H., 2002.<br />
Intraspecies genomic groups in Enterococcus faecium and their correlation<br />
with origin and pathogenicity. Applied and Environmental Microbiology<br />
68, 1381–1391.<br />
Vancanneyt, M., Zamfir, M., Devriese, L.A., Lefebvre, K., Engelbeen, K.,<br />
Vandemeulebroecke, K., Amar, M., De Vuyst, L., Haesebrouck, F., Swings,<br />
J., 2004. Enterococcus saccharominimus sp. nov., from dairy products.<br />
International Journal of Systematic and Evolutionary Microbiology 54,<br />
2175–2179.<br />
Vignolo, G., Palacios, J., Farias, M.E., Sesma, F., Schillinger, U., Holzapfel,<br />
W., Oliver, G., 2000. Combined effect of bacteriocins on the survival of<br />
various Listeria species in broth and meat system. Current Microbiology<br />
41, 410–416.<br />
Villani, F., Coppola, S., 1994. Selection of enterococcal strains for waterbuffalo<br />
Mozzarella cheese manufacture. Annali di Microbiologia ed<br />
Enzimologia 44, 97–105.<br />
Villani, F., Salzano, G., Sorrentino, E., Pepe, O., Marino, P., Coppola, S., 1993.<br />
Enterocin 226NWC, a bacteriocin produced by Enterococcus faecalis 226,<br />
active against Listeria monocytogenes. Journal of Applied Bacteriology 74,<br />
380–387.<br />
Vlaemynck, G., 1996. Inhibition of Listeria monocytogenes by the application<br />
of bacteriocins: study of some parameters effecting production of enterocin<br />
RZS C5 and pediocin RZS C8. Mededelingen-Faculteit Landbouwkundige<br />
en Toegepaste Biologische Wetenschappen, vol. 61/4a. Universiteit Gentr,<br />
pp. 1605–1611.<br />
Vlaemynck, G., Herman, L., Coudijzer, K., 1994. Isolation and characterization<br />
of two bacteriocins produced by Enterococcus faecium strains inhibitory to<br />
Listeria monocytogenes. International Journal of Food Microbiology 24,<br />
211 – 225.<br />
Waar, K., Muscholl-Silberhorn, A.B., Willems, R.J., Slooff, M.J., Harmsen,<br />
H.J., Degener, J.E., 2002. Genogrouping and incidence of virulence factors<br />
of Enterococcus faecalis in liver transplant patients differ from blood<br />
culture and fecal isolates. Journal of Infectious Diseases 185, 1121–1127.<br />
Wachsman, M.B., Farias, M.E., Takeda, E., Sesma, F., de Ruiz Holgado, A.P.,<br />
de Torres, R.A., Coto, C.E., 1999. Antiviral activity of enterocin CRL35<br />
against herpes viruses. International Journal of Antimicrobial Agents 12,<br />
293–299.<br />
Wallace, D.L., Harmon, L.G., 1970. Intracellular protease from Streptococcus<br />
durans. Journal of Dairy Science 53, 394–402.<br />
Wessels, D., Jooste, P.J., Mostert, J.F., 1990. Technologically important<br />
characteristics of Enterococcus isolates from milk and dairy products.<br />
International Journal of Food Microbiology 10, 349–352.<br />
Wilkinson, M.G., Guinee, T.P., O’Callaghan, D.M., Fox, P.F., 1994. Autolysis<br />
and proteolysis in different strains of starter bacteria during Cheddar cheese<br />
ripening. Journal of Dairy Research 61, 249–262.<br />
Wunderlich, P.F., Braun, L., Fumagalli, I., D’Apuzzo, V., Heim, F., Karly, M.,<br />
Lodi, R., Politta, G., Vonbank, F., Ja Zeltner, L., 1989. Double-blind report<br />
on the efficacy of lactic acid-producing Enterococcus SF68 in the<br />
prevention of antibiotic-associated diarrhoea and in the treatment of acute<br />
diarrhoea. Journal of International Medical Research 17, 333–338.<br />
Xanthopoulos, V., Polychroniadou, A., Litopoulou-Tzanetaki, E., Tzanetakis,<br />
N., 2000. Characteristics of Anevato cheese made from raw or heat-treated<br />
goat milk inoculated with a lactic starter. Lebensmittel-Wissenschaft und-<br />
Technologie 33, 483–488.<br />
Yamamoto, Y., Togawa, Y., Shimosaka, M., Okazaki, M., 2003. Purification<br />
and characterization of a novel bacteriocin produced by Enterococcus<br />
faecalis strain RJ-11. Applied and Environmental Microbiology<br />
69, 5746–5753.<br />
Zárate, V., Belda, F., Pérez, C., Cardell, E., 1997. Changes in the microbial flora<br />
of Tenerife goat’s milk cheese during ripening. International Dairy Journal<br />
7, 635–641.