December 7, 2012 - The Focus News

4 Bed 2 Bath • 1904 Sq. Ft.
only $ 69,900!!!
Visit Lincoln County’s #1 Manufactured
& Modular Home Center
803 Old Moscow Mills Rd. Troy, MO • 636-462-5345 • www.claytonhomesoftroy.com
The Focus News
WEEKLY dEcEmbEr 7, 2012
314-713-2400
Number 5 • Volume 9 • Serving St. Charles, Warren, lincoln, montgomery, and Franklin Counties • WWW.THeFoCuSNeWS.Com • 35¢
H & H Guns -- It's a Second Amendment Thing
Obituaries
The following obituary notices
are included on page 12-13
Bonnie Apple, 74,
Wentzville, manager
Elsie Brown, 101, Troy
Dr. Jeffrey Cramp, 56,
Montgomery City, veteran,
doctor
Margaret Crouch, 69,
Warrenton, bank teller
Stanley Daniels, 59,
Montgomery City
Kenneth Fakes, 81,
Ashland, veteran, sheet
metal worker
Robin French, 52, Old
Monroe, employee
Virginia Goodson, 77,
Troy, executive assistant
Julia Guss, 80,
Josh, Mark, Jane and Blake Hale
is to fill both our store front win- Today H & H Guns boasts a
Marthasville, homemaker
Penny Henebry, 60, Troy,
employee
dows,” says Jane. “Please help us growing volume of international Robert Henebry, 91,
H & H Guns in Warrenton is benefit the Special Olympics,” help our neighbors by dropping sales and large collection of rare Hawk Point, farmer
inviting everyone to join them adds Mark.
off canned goods, non-perishable and unusual firearms. Everything Bennie Litchfield, 46,
Saturday, December 15 to cel- H & H Guns donates the gun items, diapers, shampoo, soup and from old Colts—unfired & new in Foristell, manager
ebrate their Annual Christmas to the cause and 100% of the pro- etc.” The Hales are very thankful box, to a WW II Bren Gun! They Charles Raue, 86,
Open House. “It’s our 4th anceeds are donated to the local for the support they receive from have a little bit of everything. Foristell, sales
niversary at our new location at Warren County Special Olym-
we will PAy more the community thAn for the cause. H mArket &H Guns is well known Mary PriCe
Samsel, 58,
115-C E. Main Street in Old Town pics teams. The couple has been “We have recovered from our as AR-15 and AK-47 headquar- Wentzville
Warrenton,” says Mark and Jane blessed with tremendous success total loss from the fire four years ters. Any day you can find 15 to Harry Van Scoyk, 63,
Hale, owners of H & H Guns, the in their 12 years of business and
for your gives back generously with Gold ago and H &
in- This H Guns has con- Month 20 styles of AR-15s, AR-10s, AKs Only!
Elsberry, veteran, truck
premier gun shop in the region
tinued to grow,” says Mark. “We and AR variants in a number of driver
with the largest selection of milivolvement in charitable and be- have been blessed.” Not only have calibers, styles, and barrel lengths. Robin Yates, 55, Moscow
tary, collectible old and fine sterlinG firearms nevolent organizations silver
like the they continued to have the sup- Gold AK and AR accessories & abound PlAtinum
at Mills, employee
in East Central Missouri.
Warren County Handicapped port of loyal customers, but word H & H with several display cases
To celebrate the occasion, • .925 Jane & Sterling Services. Silver Jewelry
• Broken Jewelry • Scrap Gold & Platinum
has spread about their vast selec- dedicated to them.
• Mexico Each year, Silver the H & H Guns
• Old Mountings • Band & Class Sponsored Rings by:
says --there will be lots of food,
tion, unbelievably low pricing and “H & H Guns’ selection of tac-
fun, guns and raffles • throughout Sterling Flatware hosts an annual & Service food drive Pieces to help Mark’s uncompromising level of tical and • military Dental rifles Gold is second • Jewelers Sweeps
the day. “We are raffling off • Sorry, a one no Turning Silver Point Plated Women’s Items Shelter. service that goes above and be- • Old Charm Bracelets • Old Chains
of a kind Henry Cowboy rifle to “This is our 4th year and our goal
CONTINUED ON PAGE 7
yond the purchase.
Gold & silver
Coins
12 Days of Christmas Sale starts Dec. 7th
Christmas open house
saturday december 8th all day
Free photo with Santa
• Pre-1964 Dimes/Quarters/Half Dollars
• Silver Dollars • US Gold Coins
• .999 Pure Gold, Silver Bars & Coins
• Krugerrand/Maple Leafs/Liberties/Sovereigns
by Jana todd’s excellence in photography
Cookies & punch & Lots of FUn!
RE-SUMMER SPECIAL
Fun fact: When Mormon pioneers arrived in the Salt Lake Valley, they subsisted on the roots of the Sego Lily Plant.
All stAr FREE PAwn And Jewelry
STOP IN FOR AN A/C SYSTEM Missouri State
INSPECTION AND PERFORMANCE Safety Inspection
CHECK AND RECEIVE A
1005 S. Callahan Rd • Wentzville, MO
See service consultant for
$10 GAS CARD
details. Expires 6/22/12
P. 636-887-0075 F. 636-887-0361 • www.allstarpawn.net
Offer Expires 7/6/12
M
UTO
ODERN
A
CERTIFIED SERVICE
636-239-6777 | Washington, Mo.
www.modernautoco.com
We Service All Makes and Models
Hurry!
Offer Expires
$ 5 off
Tire Rotation,
4-Wheel Brake
Inspection &
Multipoint
Inspection
Antique & estAte sAle
Jewelry
diAmonds
• Large Diamonds • Old European Cut Diamonds
• Diamond Bracelets, Earrings, Pendants
• Unwanted Wedding & Engagement Rings
WE BUY GOLD JEWELrY - Scrap GOLD - cOinS
Up to $100 Rebate With Purchase of
We Service All
4 Select Tires.
Makes and Models
FREE Exterior Car Wash FREE Nitrogen ($59.99 Value)
Soon! Tire rebaTe
See service consultant Offer for expires 9/30/2012. See Serivce Department for details.
details. Expires 6/22/12
Funeral & Cremation Center
636-528-8244
• Platinum Diamond Rings • Antique Diamond Rings
Serving
• Cameos & Animal Pins • Old Gold & Platinum Watches LincoLn
• 1940’s Retro Jewelry • Art Deco Jewelry And Pike
• Gemstone 511 N. Hwy Jewelry 47, warreNtoN • Broken Antique JewelrycountieS
www.amogflorist.com
Family Owned
636-456-9334 or 888-321-4050
and Operated
Monday - Friday 9:00am to 5:30pm
Saturday 9:00am to 3:00pm www.mccoyblossomfh.com
PlUS
TiRE
PRiCE maTCh
gUaRaNTEE

News Page
The Focus News
Weekly Publication
Focus News, LLC
P.O. Box 32066
St. Louis, MO 63132
www.thefocusnews.com
focusnewsmo@gmail.com
Fax: 314-985-0612
Phone:
(314) 713-2400
Editor/Publisher: Tamara See
Advertising:
Mir, Jill, Brandon
Deadline:
Tuesday prior to noon.
Letters to the editor must be
signed with a phone number for
verification. Opinions expressed
by contributors are not necessarily
the views of the newspaper.
The Focus News is delivered to
homes & businesses in Warrenton,
Wentzville, Troy, Lake St.
Louis, O'Fallon & St. Peters.
It is available at
600 + businesses including:
Troy
Drewel Realty- Brickhouse Zumba
Troy Furniture & Carpet • Troy Tire
Scott’s Home Health Medical Supply
F&S Customs • Corilla's Resale
Apple Hearing Solutions • Shared Closet
Charlotte’s Flowers -The Country Cottage
Garden Gate Party Rental • Here’s 2 Eyes
Lincoln Co. Animal Hospital - Zaddocks
Buzzy’s Liquor - Troy Elks’ Lodge
Clayton Homes - 47 West Flea Market
The Mercantile Outlet - Halo & Wings
A Scrapbook & Craft Haven • Troy Trading
Tri-County Glass • Peoples Bank & Trust
Big Creek Archery • Landmark Restaurant
American Family Home Sales
Warrenton
Apple Hearing Solutions
AMOG Florist • Two Dudes Barbecue
American Legion • Kroger
El Jimador • Goin’ Postal
Radio Shack - Moser’s • Classic Nails
H & H Outfitters • Curves
Four Season Travel & Cruises
Assist-2-Sell • Lansford Treasure Chest
Brockfeld’s • Pamper Your Pets
Noah’s Bark • 4 Doors Down
Schraer Heating & Air Conditioning
Sunseekers- The Hiding Place -Raterman
CPA - Dr. Paz • Applebee’s
Chiropractic Center- FCF Church
Warrenton Elks’ Lodge- Library
Ultimate Hair & Spa • Brewskies
Gastorf-Schrumpf • The Hideout
Urban Tanz • Sharper Image
Wentzville
SS Nutrition - Crider - Bob Evans
Olive Garden - Charlie’s -QT
Cox & Cohea - Beauty Queen
Hometown Cleaners - Coin Laundry
Army Gear.net- Rural King - Dobb’s
Chuy’s Mexican Restaurant
Wentzville Eye Center - Pizza Pro
Jimmy Johns - Fireside Treasures - Sears
Scrap To It
Washington
Patients First - Mind, Body & Spirt
St. John’s Mercy Hospital - El Charro
Cartridge World - St. Louis Bread Co.
Vein Specialties - Aldo’s Pizza
Hardee’s - Joe’s Bakery & Deli
Manwell’s Coffee - The Art Center
Cowan’s Restaurant - Purcell Tire
Schroeder Drugs - Basket Case Rest.
St. John’s Medical Bldg. - BP
Gourmet Cafe - Los Cabos Mexican Rest.
Classic Comb Salon - Straatman Toyota
Urban Accents - Phillip 66 - Bubba Shrimp
Cecil Whittaker’s Pizza - Mommy & Me
Modern Auto - Auffenberg
Montgomery City
BP • Brad’s Kwik Store- Save-More •
Casey’s - Central Heating & Cooling
The Garage Sale Store • American Bank
Montgomery County Farm Bureau
Montgomery City Library • Senior Center
Winfield
Dr Haub • IGA • True Value • Quick Stop
Wellsville-
IGA • Fastlane
Wright City
American Bank • Citgo • Shell
Economy Supermarket - Branding Iron -
I-70 Subs - Revolving Door Resale
Bowling Green
Storch Ford - Shell - BP
Hawk Point
BP • Sinclair • Backroads Grill • Unique Treasures
Jonesburg
Shay’s Alley • Fast Lane • Road House
Frumpy Joe’s • Country Side
Middletown
Crossroads General • Country Store
American Bank • Country Club Bar
Moscow Mills
Conoco- Sunset Hair & Tan
New Florence- Abel’s Quick Shop • BP
O’Fallon- Culligan, Hwy. K Businesses
Silex/Auburn
Thoro Mart - JR Diamonds
WWW.THEFOCUSNEWS.COM
Washington man Killed
in Accident
Sean S. Paul, age 41, of Washington,
MO, died in an accident on
November 29, 2012 at 2:50 p.m. on
Rt. T 0.3 mile west of Davis Rd. in
Franklin County. He was driving a
2003 Lincoln LS when it drove off
the right side of the road, overcor-
rected, drove off the left side of the
road, down and embankment, and
overturned several times. He was
pronounced dead at the scene at
3:31 p.m. According to the highway
patrol, he was not wearing a
seat belt at the time of the accident.
$399,400 Settlement
reached With St.
Peters-based company
Attorney General Chris Koster
said his office has reached a
$399,400 settlement with NRRM,
LLC, a St. Peters-based seller of
vehicle breakdown coverage that
has been doing business under the
name “StopRepairBills” since late
2009, and is now advertising under
the name, “Vehicle Protection
Center.” The settlement requires
that the company reform its business
practices.
“This settlement is a strong
message to the service contract
industry that companies must
comply with Missouri law and
must make adequate disclosures
to consumers,” Koster said. “Our
office will prosecute businesses
that ignore their responsibilities of
honesty and fair dealing with consumers.”
According to Koster, NRRM
was formed in the merger of National
Dealers Warranty and Auto
Warranty Protection Services. The
settlement resolves allegations
that in operating a call center to
offer vehicle breakdown coverage,
NRRM: marketed the vehicle
breakdown coverage throughout
the United States, primarily
through television commercials
and radio advertisements designed
to induce consumers to call a tollfree
number by deceptively implying
that NRRM pays 100 percent
of consumers’ repair claims;
trained its salespeople to sell the
vehicle breakdown coverage with
a generalized and often misleading
description of the coverage; and
taught its staff to subject consumers
seeking a refund to delay tactics
and to give them only a partial
refund. Consumers were subjected
to these delay tactics when, after
realizing that the coverage they
received was less than what they
had been led to believe during the
sales process, the consumer called
NRRM to cancel and ask for a refund.
Some consumers realized
they were receiving less coverage
when they read the contract; others
did not realize it until a repair
claim was denied.
The injunction entered today
by Jackson County Judge Edith
Messina requires the company to
reform its business practices in
the offer and sale of vehicle service
contracts. It also completely
prohibits the sale of “additive contracts,”
which were sold as though
they were vehicle service contracts
but were structured as “product
warranties” to try to avoid being
regulated under insurance and ser-
Want your business
featured in front of
our 20,000+ readers?
vice contract laws. NRRM sold this
contract by arranging for the delivery
of a bottle of ordinary oil additive;
the accompanying contract
provided very limited breakdown
protection and had no relationship
to the performance of the product
in the bottle.
The consent judgment establishes
a restitution fund of
$187,200 intended to provide a
full refund to Missouri consumers
who were sold this additive coverage.
The settlement also provides
the state $25,000 in costs that will
be used for consumer law enforcement.
The judgment imposes civil
penalties and forfeitures in the
amount of $187,200 and allows for
potential future recovery for other
complaints.
“Missouri law says consumers
have a right to see a written service
contract and agree to its terms,”
Koster added. “Customers who
purchase vehicle repair coverage
by telephone often later realize the
significant limits to coverage in the
written contract. It is important
for Missouri consumers to protect
themselves by carefully reviewing
vehicle service contracts to make
sure they contain the provisions
promised.”
Missouri law now requires that
both motor vehicle extended service
contract sellers and providers
of such contracts be registered
with the Department of Insurance.
Missouri law also requires that motor
vehicle service contracts made
with consumers clearly and conspicuously
describe the consumer’s
right to cancellation, among other
rights.
“Most sellers of these extended
service contracts must have a license
from the Missouri Department
of Insurance,” said Insurance
Director John M. Huff. “We
encourage consumers to contact
our department to make sure the
seller is licensed and authorized to
do business in Missouri.” Any Missouri
consumer who was defrauded
in his/her purchase of coverage
from Stoprepairbills should submit
a complaint to the Attorney General’s
Consumer Protection hotline
at 800-392-8222 or online at ago.
mo.gov. Koster and Huff encourage
consumers to verify that a business
is licensed by calling the Department
of Insurance at 800-726-
7390 or visiting insurance.mo.gov.
Consumers with complaints about
service contracts should also call
the Department at 800-726-7390
or visit insurance.mo.gov.
Call Now: 314-713-2400
focusnewsmo@gmail.com
THE FOCUS NEWS Friday, December 7, 2012
blanchette bridge
blasted
(Photos courtesy of Missouri Department of Transportation)
Interstate 70 at the Blanchette
Missouri River bridge was completely
closed for an hour on Tuesday,
December 4 as crews blasted
the last two sections of the steel
truss on the closed westbound I-70
Blanchette Bridge. At 10 a.m. after
the area was secured, the bridge
was blasted and dropped into the
river where it was removed in
pieces. The blast occurred at 10:15
a.m. Crews then began sweeping
the eastbound I-70 bridge to clear
debris before the highway was reopened
to traffic.
The blast was visible from the
St. Charles riverfront for public
viewing. The blast, lasting only
a moment, dropped over 1,000
feet of truss, including 4.5 million
2
pounds of steel into the Missouri
River.
The 54-year-old westbound
I-70 Blanchette Missouri River
Bridge is undergoing a $63 million
rehabilitation. Approximately
75 percent of the bridge is being
replaced or rehabilitated including
the removal and reconstruction of
the steel truss and the entire bridge
deck and barrier. The piers will remain
in place.
The bridge was closed on November
4 and will reopen by fall
2013. I-70 has been reduced from
five lanes in each direction to three
lanes in each direction, all using
the eastbound bridge. For more
information on the project, visit
www.modot.org/blanchettebridge.
TURN UP THE HEAT
ON YOUR MARKETING!
AN AWARD WINNING ADVERTISING,
GRAPHIC DESIGN & MARKETING FIRM
TONY MOONEY • (636) 528-7473
101 WEST COLLEGE, SUITE 7 • TROY, MO 63379

News Page
WWW.THEFOCUSNEWS.COM
mark Twain coin bill Signed Into Law
President Barack Obama this
week signed into law a bill sponsored
by U.S. Rep. Blaine Luetkemeyer
(MO-9) to mint a Mark
Twain commemorative coin that
will provide an economic boost
to Missouri by enhancing Twain’s
Boyhood Home and Museum in
Hannibal.
Under the new law, the U.S.
Mint will produce for a limited
time, $1 silver and $5 gold coins
in honor of the world famous
writer. The sale price of each coin
will be calculated at the combined
total of each coin’s respective face
value, production and design
costs, and a surcharge remitted
by the U.S. Treasury to the recipi-
money
raised for
"Supports
the
Troops"
Peoples Bank & Trust employees
were able to raise $466 for
Troy, MO, Supports the Troops.
This money will be used to purchase
items to send to local men
and women serving abroad in the
armed forces. If you'd like to donate
to this wonderful organization
or if you would like to add
a soldier to the list of recipients,
contact Kris Moesch at (636) 528-
7001.
ent organizations, thereby costing
taxpayers nothing.
“I want to thank the president
for signing this legislation into
law and I appreciate the efforts
of all the folks back home that
have worked so hard for so long
to make this day possible,” Luetkemeyer
said. “Twain’s Boyhood
home attracts people from all
over the world and brings muchneeded
jobs and economic development
to the state and this law
will certainly boost those efforts.”
The Mark Twain Boyhood
Home and Museum in Hannibal
commemorates the childhood of
a man who grew up to be one of
the most recognized names in lit-
erature. Twain would eventually
move to Hartford, Connecticut,
where he settled down, built a
house and began to work on what
would become his most famous
work, Adventures of Huckleberry
Finn.
Other sites benefiting from
the surcharge include the Mark
Twain House & Museum in Hartford,
Connecticut, the Center for
Mark Twain Studies at Elmira
College, New York and the Mark
Twain Project at the Bancroft Library
of the University of California,
Berkeley, California.
PRESENTS DONATION - Gary Leifert, PB&T Sr. Loan Officer and US
Air Force Viet Nam Veteran presenting the check to Kris Moesch of Troy,
MO, Supports the Troops.
mU Teams With Smithsonian to Save
Original Jefferson Tombstone marker
For more than a half-century, a
six-foot tall granite cube and obelisk
with a 150-200 pound marble
slab insert marked the grave of
Thomas Jefferson at Monticello.
Following damage to the original
monument by souvenir seekers
and a government campaign to
replace it with a larger copy, the
original tombstone, including the
marble slab, was presented to the
University of Missouri. MU was
the first public university in the
Louisiana Purchase Territory that
Jefferson had been instrumental
in acquiring, and MU officials
supported a curriculum and concept
of higher education similar
to those of Jefferson. In fact, the
University of Missouri was modeled
from the University of Virginia;
thus, it seemed fitting that
Jefferson’s original monument
would be placed on MU’s campus.
The tombstone was officially
dedicated at MU on July 4, 1885,
and the marble slab was stored
in the university’s Academic Hall
until the building burned in 1892.
The marble slab has been in the
current administrative building,
Jesse Hall, since it opened in 1895.
Now, nearly 130 years after the
university received the marker,
university officials are working
with officials at the Smithsonian
Institution to move the marble
slab, which contains the original
epitaph written by Jefferson himself,
to the Smithsonian for extensive
restoration.
Prior to his death, Jefferson
wrote a detailed description of
his grave marker as well as the inscription.
“It’s irresistible. Thomas Jefferson
himself wrote what he wanted
written on the stone. Scholars
find it interesting that he left out
the fact that he was president,
among other accomplishments,”
said Carol Grissom, senior objects
conservator at the Museum
Conservation Institute, which is a
conservation research laboratory
that serves the entire Smithsonian.
Grissom is leading the restoration
project
“Could the dead feel any interest
in Monuments (sic) or other
remembrances of them,” Jefferson
wrote. He continued, saying that
he would prefer a “plain die or
cube . . . surmounted by an Obelisk.
(sic)”
Jefferson also dictated the
words on the marble slab:
Here was buried
Thomas Jefferson
Author of the Declaration of
American Independence
Of the Statute of Virginia for
religious freedom
& Father of the University of
Virginia
“Jefferson was a major proponent
of public higher education,”
said Kee Groshong, vice chancellor
for administrative services
emeritus. “The university made a
case to his family that this would
be an ideal place to display his
original grave marker. The family
agreed and shipped it to us, so it
has been here ever since. It is significant
for us at the University
of Missouri because of our connection
to Jefferson and the landgrant
mission and public higher
education. We believe we should
take care of it and display it for
everyone to see and enjoy because
it is a very interesting piece of history.”
Once at the facility, Grissom
and her team will remove the
plaque from a wooden box that
it has been stored in since at least
the 1890s. The restoration team
will analyze the piece first to determine
exactly why the stone is
deteriorating. Grissom said that
the top 1/8 inch of the plaque is
separating in places and the corners
seem to be disintegrating.
“We will examine some samples
using the scanning electron
microscope and conduct other
analyses,” Grissom said. “We also
know that the stone was previously
broken, so we might try
to take it apart first to get a better
look at the internal damage.
We’re also interested to identify
where the stone came from — was
it something that was imported,
domestic or local? The information
is historically significant, but
it could also affect the treatment
of the stone.”
It is anticipated that the project
will take at least a year to complete.
Following the restoration,
the stone will be returned to MU,
where it will be displayed permanently.
THE FOCUS NEWS Friday, December 7, 2012
Who says that angels don’t exist
on earth? Certainly not the
staff at Crider Health Center! After
all, an angel has been helping
them provide coats for children
participating in Crider’s children’s
programs and services for the past
eight years.
Each year, a very generous donor
delivers a check for thousands
of dollars that allows the staff at
Crider Health Center to purchase
brand new coats for needy children
in St. Charles, Lincoln, Warren
and Franklin Counties who
would otherwise be forced to brave
winter without needed protection
from the cold, harsh elements.
“Each and every year, the Coats
for Crider program grows larger
and more successful,” said Laura
Heebner, president and CEO at
Crider Health Center. “Businesses
from across the four-county region
have partnered with us by generously
providing coupons for a free
kid’s meal to be tucked away into
the pocket of each coat. And this
year, a local St. Charles County
church donated 100 hand-knitted
scarves to accompany each coat.”
Crider Health Center is actively
reaching out to local establishments
in the hopes that they will
find more businesses who want to
become involved in the Coats for
Crider program by making a donation
so that more coats can be pur-
4
An Angel on Earth Helps
crider Health center
Keep Kids Warm All
Winter Long
Generous Donor Helps Crider Health
Center Provide Coats for Children in Need
Hunters checked 15,136 deer
during Missouri’s antlerless deer
season Nov. 21 through Dec. 2.
This year’s antlerless harvest
increased by 697 deer, a gain of
approximately 5 percent over last
year. Top harvest counties for the
12-day antlerless season were Camden
with 553 deer checked, Benton
with 518, and Callaway with 491.
Two portions of Missouri’s firearms
deer season remain. The alternative-methods
portion runs from
Dec. 15 through 25, and the late
youth portion is Dec. 29 and 30.
Besides increasing hunting opportunities,
the antlerless season
gives hunters and landowners a
way of regulating local deer numbers.
Those who want more deer
can choose not to participate in the
antlerless season, while those who
want fewer deer can use the season
to remove female deer from the
chased or by providing a coupon
or gift card to be tucked inside the
pocket of each coat.
“We are always thankful when
members of the community and
businesses help us bring a smile
to the face of a child. As one can
imagine, seeing the look on a
child’s face when they receive their
very own coat and scarf is a heartwarming
and touching moment.
However, watching their face light
up when they put their hand into
the pocket and discover a gift card
or coupon, that is just for them, is
priceless,” said Heebner.
To find out more about Crider
Health Center’s Coats for Crider
program or to make a donation,
please contact Christina Bogusky
at 636-332-2134.
Established in 1979, Crider
Health Center is a not-for-profit
organization that provides behavioral,
primary and dental health
services to individuals who are
uninsured, underinsured or have
an income level at or below poverty.
Crider Center has provided
hope to almost half a million children,
youth and adults in the St.
Charles, Lincoln, Franklin and
Warren Counties. Crider’s vision
is Full, Productive, Healthy Lives
for Everyone. To make a donation
or for more information on Crider
Health Center, please visit www.
cridercenter.org.
Hunters check 15,000
deer during
Antlerless Season
population.
Missouri’s annual harvest of approximately
300,000 deer by firearms
and archery hunters yields
more than 10 million pounds of
venison. Hunters consume most
of this meat. However, hunters
donate more than 300,000 pounds
of venison annually to local food
banks and other charities through
the Share the Harvest program.
Information about Share the Harvest
is available at mdc.mo.gov/
node/2544.
Missouri’s deer resource also
supports 11,000-plus jobs and generates
more than $1 billion in business
activity annually.
Economic value aside, deer
hunting is a cherished tradition
that draws thousands of Missouri
natives back home to share healthful
outdoor recreation with family
and friends.
why Does your aD
iN FoCus worK?
1. Your success is our business
2. Only multi-demographic 6 county distribution weekly
3. Greater Reach = More Customers
4. Extremely Loyal Readership
5. Only newspaper that features your business on the Front
Call Now!
314-713-2400
focusnewsmo@gmail.com

News Page
WWW.THEFOCUSNEWS.COM
cuivre river Electric community Trust
Awards $17,000 in Scholarships
Thirty-four students from Lincoln,
Pike, St. Charles and Warren
counties received a total of $17,000
in scholarship awards from the
Cuivre River Electric Community
Trust.
Students receiving scholarships
are Ashley Banze, Hannah Basse,
Alex Bencomo, Matthew Bencomo,
Tyra Bowman, Mikail Brown,
Benjamin Bruckerhoff, Stormy
Devlin, Hannah Diederich, Dylan
Donovan, Kayla Eisenbath, Tiffany
Elliott, Kyriana Foster, David
Fowler, Eric Fowler, Rachel Franck,
Julie Goeglein, Samantha Hamilton,
Emily Heidenreich, Jill Jarvis,
Abigail Maestas, Amber Mennemeyer,
Travis Mertens, Eric Miller,
Ashley Oberdieck, Megan Perotti,
Gina Pilla, Daniel Raterman, Austin
Smith, Douglas Steiert, Andrew
Struttmann, Christopher Struttmann,
Samantha Twellmann and
Kelsey Twiehaus.
Scholarship funds are donated
by Cuivre River Electric members
who participate in Operation
Round Up by rounding up their
electric bill payments each month
to the next highest dollar. Since the
program began in 1997, more than
$765,000 has been awarded to help
over 1,625 area students achieve
their academic goals.
Students are eligible to be considered
if they live in the Cuivre
River Electric Cooperative service
area and maintain a minimum
GPA of 2.5 while attending undergraduate
courses at an accredited
university or technical school. Applicants
are also asked to provide
an official transcript and two letters
of recommendation, write a narrative
to highlight their academic
achievements and state their career
goals, and demonstrate a financial
need. The scholarship may also be
used for adult continuing education
courses in their career fields.
In addition to scholarships,
Operation Round Up was founded
to help address unmet needs in the
areas of health, youth, education,
home weatherization, community
and emergency services. These
funds are available to help individuals,
families and organizations in
the CREC service area. Operation
Round Up applications are available
online at www.cuivre.com.
The next scholarship deadline is
May 1, 2013.
barnes-Jewish St. Peters Hospital
Starts major First Floor renovation
Ed Lowes, facilities manager; Pamela Duffy, president, Rhodey Construction; Karen Prideaux, community
relations/marketing manager; Robert MacDonald, MD; John Menius, MD; Ann Abad, VP operations; Jennifer
Etling, MD; John Antes, hospital president; Tim Cooper, MD; Brian Ullery, MD; Jason Gutting, MD; Rebecca
Fall, surgical services manager; Dan Barrow, foreman, and Jason Appel, project manager, Rhodey Construction.
The BJC HealthCare board approved
$9.2 million to complete
the first of a two phase multi-year
renovation project of the first floor
at Barnes-Jewish St. Peters Hospital
(BJSPH). Phase one includes
a new GI suite, new preoperative
and postoperative bays and two
new operating rooms. The project
includes a 4,869 square foot building
addition to the hospital.
Construction started in late
October 2012 and is anticipated
to be completed in second quarter
2014. Rhodey Construction, Inc. is
general contractor, Burns & Mc-
Donnell is the architectural firm
and CJL Engineering will complete
the engineering.
“This renovation is part of a
multi-year project to continually
improve our hospital for the pa-
tients we serve. We are committed
to providing excellent health care
and this is just another example.
Our physicians and staff have been
involved in the design of the space,
ensuring that this project will enhance
the patient and family experience,”
said John Antes, hospital
president.
BJSPH has completed several
major projects in the past decade
including a larger Emergency Department,
an Outpatient Surgery
and Endoscopy Center, the Siteman
Cancer Center at BJSPH with
an additional expansion in 2011
to add a second linear accelerator,
and a Bed Tower that included a
new Pharmacy.
Regular updates of the current
project can be found at Facebook.
com/BJSPH.
Barnes-Jewish St. Peters Hospital
provides comprehensive inpatient
and outpatient services including
the Siteman Cancer Center
at Barnes-Jewish St. Peters Hospital,
the Breast Health and Women's
Center, the Cardiology Center,
and the Outpatient Surgery and
Endoscopy Center. Known for its
community partnerships, Barnes-
Jewish St. Peters Hospital has been
a leader in St. Charles County for
more than 30 years. In 2012, Consumer
Reports magazine rated this
113-bed community hospital as
one of the safest in the St. Louis
metropolitan area and third in the
state of Missouri based on their
review of publicly available patient
safety and quality data. For more
information, visit www.bjsph.org
or call 636-928-WELL.
crider Health center Promotes
Crider Health Center Names
Pamela Imboden Marketing and
Development Associate
Crider Health Center, based
in St. Charles County, has named
Pamela Imboden as marketing and
development associate.
Imboden began her tenure at
Crider Health Center in January,
2009 as the administrative assistant
for marketing and development. In
November, 2010, already enrolled
at Lindenwood University to pursue
a bachelor’s degree in communication,
with an emphasis on mass
communication, Imboden was
promoted to marketing and media
specialist where she honed her
skills in graphic design and public
relations. In June 2012, Imboden
graduated Summa Cum Laude
from Lindenwood University and
has brought a wealth of knowledge
and expertise to her position. She
is currently using her talents to help
Crider Health Center grow and
move forward.
Imboden has been instrumental
in helping Crider Health Center rebrand
printed materials, increase
awareness of services through social
media outlets, and has been an
integral part of fundraising efforts.
In her new role, she will have primary
responsibility over marketing
efforts, as well as a lead role in the
Foundation Board fundraising.
Established in 1979, Crider
Health Center is a not-for-profit
organization that provides behavioral,
primary and dental health
services to individuals who are
uninsured, underinsured or have
an income level at or below poverty.
Crider Center has provided
hope to almost half a million children,
youth and adults in the St.
Charles, Lincoln, Franklin and
Warren Counties. Crider’s vision
is Full, Productive, Healthy Lives
for Everyone. To make a donation
or for more information on Crider
Health Center, please visit www.
cridercenter.org.
THE FOCUS NEWS Friday, December 7, 2012
David Smith, OD
David Smith, OD, has joined
Mercy Eye Care. He joins Dr. Susanne
Kindel at the Mercy Medical
Building North in Washington.
Dr. Smith specializes in adult
and pediatric eye care, contact lenses
and the treatment of ocular diseases
like dry eyes, glaucoma and
eye infections.
“I take great joy in helping my
patients, adults and children, see
the world more clearly,” said Dr.
Smith. “By getting to know them
and what they enjoy doing, I can
recommend the treatment, glasses
or contacts that will best fit their
lifestyle.
Dr. Smith received his optometric
degree from the University of
Missouri – St. Louis and completed
internships at St. Louis Children’s
Hospital, Indian Health Service in
Alaska and St. Louis Veterans Administration
Hospital. Dr. Smith
welcomes new patients of all ages
and offers same-day appointments
are available.
Dr. Kindel received her Bachelor
of Arts degree in biology from
Washington University in St. Louis.
She earned her optometry degree
Want your business
featured in front of
our 20,000+ readers?
5
mercy Welcomes
Additional Optometrist
dr. david Smith joins dr.
Susanne Kindel
Susanne Kindel, OD
from University of Missouri School
of Optometry. Dr. Kindel specializes
in the diagnosis and treatment
of ocular disease and contact lens
evaluations and fittings.
Mercy Eye Care is open 8:30-
5:30 p.m. during the week and from
9 to noon on Saturdays. The doctors
are available from 9 to 5 p.m. Tuesday,
Wednesday and Friday and 9-1
p.m. Saturday. Services include eye
exams, glasses and contacts and
most insurance plans are accepted.
Mercy Eye Care is located in
Suite 112 in the Mercy Medical
Building, 851 E. Fifth St. in Washington.
For more information or to
schedule an appointment, call 636-
239-8345.
Mercy Hospital Washington is
a member of Mercy. It is a 187-bed
hospital located just 50 miles southwest
of St. Louis, Mo., and serves
all or parts of Crawford, Franklin,
Gasconade, St. Charles and Warren
counties. The Hospital offers
comprehensive emergency, heart,
cancer, surgical, obstetric and pediatric
services and physicians who
are part of Mercy Clinic.
Call Now: 314-713-2400
focusnewsmo@gmail.com
2 0 1 3
There’s only 3
weeks lefT in 2012!
Don’t let your insurance or
spending account lapse.
schedule your
appointment and get
your eyewear today!
The end of the year is near and there will be
a lot of changes to insurance next year.
#31 Troy Square, Troy, MO
Monday-Friday 9am-6pm
Saturday 9am-2pm
ClOSed Sunday
636-528-4444

News Page
NIKODEM DENTAL
WARRENTON
New Patient Special
• Routine Cleaning
$ 49
• Routine
• 2 Bitewing
Cleaning
X-Rays $
49
& Exam
For FOR PatieNtS PATIENTS PayiNg PAYING with W/CASH caSh Reg $160
WWW.THEFOCUSNEWS.COM
commission Approves resurfacing
Projects in Lincoln & montgomery
A project to resurface a little
over 41 miles of roadway in Lincoln
and Montgomery Counties
has recently been awarded by the
Missouri Highways and Transportation
Commission.
The projects in Lincoln County
include resurfacing on Route
Y from Route W to MO 79 near
Foley, Route E from Route UU in
Silex to US 61 and Route H from
MO 47 to Route E; in Montgomery
County MO 161 will be resurfaced
from Route M to MO 19
north junction in Montgomery
City. Pace Construction Co. of St.
Louis, MO was the successful bidder
with a bid of $2,036,613.94.
Also in Lincoln County, a project
to chip seal MO 79 from the
Pike County line to MO 47 near
Winfield was awarded to Blevins
Asphalt Construction Co., Inc. of
Mt. Vernon, MO for $414,998.26.
"This process seals the existing
road surface protecting it from
weathering and water damage,
and lengthens the life of the road
New Patient Special
• Two Bitewing X-Rays & Exam Reg.
THE FOCUS NEWS Friday, December 7, 2012
INSURANCE ALERT!
Your 2010 Dental Insurance Benefi ts expire December 31st!
Your 2012 Dental Insurance Benefits expire December 31st!
USE IT OR LOSE IT! Call NOW before it is too LATE!
$ 99
Dentures in ONE DAY! Each, Cash Only
$ 168
depending on the previous condition
and the amount of traffic the
road receives," explains MoDOT
Area Engineer Erik Maninga.
The work has yet to be scheduled
by the contractors, but is expected
to take place between the
spring and fall of next year. For
information or comments, please
call MoDOT's toll-free customer
service number 1-888-ASK MO-
DOT (275-6636) during normal
business hours or visit our website
at www.modot.org/northeast.
New Suicide Prevention Training
Program made Possible Through
Program Headquartered at mizzou
By Jerett Rion
Suicide is the 10th leading
cause of death in Missouri; more
Missourians die by suicide than by
DWI or homicide. To help combat
this issue, officials from Partners
in Prevention, a statewide
coalition of Missouri universities
headquartered at the University of
Missouri, will make a suicide prevention
program, known as “Missouri
Ask Listen Refer,” available
to anyone throughout the state.
“The MU Wellness Resource
Center has been a partner of the
Missouri Suicide Prevention Project
since 2005, when we received
our first youth suicide prevention
grant,” said Scott Perkins, project
director of the Missouri Suicide
Prevention Project. “They’ve done
an impressive job of training staff,
faculty and students on campuses
across Missouri. We are very
happy to have this opportunity to
not only continue working with
the center on this important issue,
but to fund this new program and
help bring it to local communities
across Missouri.”
Missouri Ask Listen Refer is a
free online suicide prevention education
program, which focuses
on teaching Missourians how to
ask at-risk individuals if they are
contemplating suicide, listen to
their thoughts and feelings, and
refer them to professional counselors.
Additionally, participants
will be able to learn about warning
signs, practice sample conversations
and become aware of local
resources.
Missouri Ask Listen Refer
was first implemented on Missouri
college campuses; however,
the need for statewide education
has been recognized and the program
has been adapted in order
to educate all Missourians. The
program is available online, is
anonymous, accessible 24 hours
a day, takes 15-to-20 minutes to
complete, and can be accessed at
moasklistenrefer.org.
“Although we continue to offer
a variety of in-person suicide
prevention training programs, we
know that it can be very difficult
for many of those that would benefit
from the training to attend
a group training,” Perkins said.
“This new online program will
help fill that gap and assist local
schools, churches and agencies in
helping anyone that may be considering
suicide and refer them to
our local resources.”
The program is beneficial for
professionals looking for a refresher
or for those who want to
begin their suicide prevention
education.
Funding for Missouri Ask Listen
Refer was provided through
the Missouri Suicide Prevention
Project, a joint project between
the Missouri Department of
Mental Health and the Missouri
Institute of Mental Health at the
University of Missouri-St. Louis.
Partners in Prevention works to
promote healthy decision-making
and prevent high-risk behaviors
among college students.
Federal funding will cover
100 percent of cost for first three
years; Governor to include federal
funds for expanded health care in
his proposed FY2014 budget
Gov. Jay Nixon this week laid
out his plans to provide health
care coverage for an additional
estimated 300,000 Missourians.
The Governor said the step would
not only benefit the overall health
636-377-2120
EXPIRES 6/30/12
636-356-4200
1030 Industrial Court / Moscow Mills, MO 63362
1-800-4-denture 1-800-4-DENTURE • Visit our website at: at nikodemdental.com
6
Gov. Nixon Announces
Plans to Provide Health
care coverage for
Additional Estimated
300,000 missourians
of the state's residents, but would
also be a fiscally responsible move
for the state of Missouri and taxpayers
because federal funding
will cover 100 percent of the costs
for the first three years, and 90
percent or more in subsequent
years.
"My consistent position on
expanding Medicaid has been to
carefully study the options and
CONTINUED ON PAGE 10
Open 8am - 8pm On mOndays
Tuesday - Friday, 8am - 5pm
Closed Saturdays and Sundays
www.stLCarRepair.com
Ray G. Nikodem, DDS & Associates
Nikodem deNtal warreNtoN
NOW Raymond OPEN G. Nikodem, IN WARRENTON
DDS & Associates
517 Warren County Center Center • Warrenton, • Warrenton, MO 63383 MO
Convenient Hours Convenient Monday through Hours Friday • Monday (Closed Saturdays) through - Please Friday Call for Appointment

News Page
H&H Guns.................CONTINUED FROM FRONT
to none,” said a new AR-15 owner
who shops here often. “AR-15,
GLOCK or S&W, you never know
what treasure you may find.”
H &H’s specialty and custom
guns has gained the attention
of national media too. This year
Mark’s son, Blake had the opportunity
to work on the History
Channel’s reality series ‘SOLD’
which featured an auction house
in Osage Beach. Mark provided
some unusual guns and items for
the show as well as working behind
the scenes as their firearms
expert.
If you watched the show, you
often saw people in the crowd
proudly sporting the ever popular
and very collectible themed Tshirts
from H & H Guns. “These
T-shirts almost have a cult following,”
says Jane. There is often
carloads of students who stop in
to get their Zombie shirts that
read—‘Zombies Eat Brains---
You’re Safe!’ “Those are extremely
popular along with the new tiedye
‘This Is My Peace Sign’ displaying
a crosshair and ‘I’m A
Prepper’
H & H Guns warranty every
gun they sell—“No one else does
that,” states Mark. In addition to
all the different type and models
of guns, H &H carries a great selection
of gear and ammo, hard to
find magazines for many pistols,
custom holsters, scopes, scope
mounts, slings, spare barrels, actions,
bullets, bayonets, gun cases,
knives, swords, medieval weaponry,
cleaning kits, targets, reloading
supplies-- the list goes on.
Each Spring Mark attends all
the major trade shows to find the
latest offerings from the players in
the industry. “Before it ever hits
the magazines and becomes famous,
we have it in order and on
WWW.THEFOCUSNEWS.COM
our shelves,” he says. “People are
simply amazed by the selection we
have for the size we are; new guns
are coming in every day.”
Great service before and after
the sale – that is what the Hale
family and H &H Guns is all
about. “It is the best place to buy
guns,” says another repeat customer.
This Christmas, if you are
looking for that perfect gift for
the gun lover on your list, you
owe yourself a visit to what their
clients call, ‘the best gun shop in
the country.’ We will see you at the
Open House on December 15.
Visit H & H Guns at 115-C
Main Street in Warrenton. They
are open Tuesday- Friday 9am to
6pm and open late on Thursday
till 8pm and Saturday 10am-4pm.
You can contact H&H Guns at
636-456-6118 and also on Facebook
and their site www.hhguns.
com
THE FOCUS NEWS Friday, December 7, 2012
7

Health Page
Residents living in and around
the Saint Charles, Missouri community
can be screened to reduce
their risk of having a stroke
or bone fracture. American Legion
Post #312 will host Life Line
Screening on 12/17/2012. The
site is located at 2500 Raymond
Dr. in Saint Charles. Richard Tiller
of Clarksdale, MO, attended a
Life Line Screening and said, "If I
would not have had the screening
done I probably would not have
known I had an aneurysm".
Four key points every person
needs to know:
• Stroke is the third leading
cause of death and a leading cause
of permanent disability
• 80% of stroke victims had no
apparent warning signs prior to
their stroke
• Preventive ultrasound screenings
can help you avoid a stroke
• Screenings are fast, noninvasive,
painless, affordable and convenient
Screenings identify potential
cardiovascular conditions such
as blocked arteries and irregular
heart rhythm, abdominal aortic
aneurysms, and hardening of
WWW.THEFOCUSNEWS.COM
Stroke and Osteoporosis
Screenings coming to Saint charles
Mice with a condition that
serves as a laboratory model for
Down syndrome perform better
on memory and learning tasks as
adults if they were treated before
birth with neuroprotective peptides,
according to researchers at
the National Institutes of Health.
Down syndrome results when
an individual receives an extra
copy of chromosome 21. According
to the Centers for Disease
Control and Prevention, Down
syndrome occurs in 1 of every
691 births. Features of Down syndrome
include delays in mental
and physical development and
poor muscle tone. These features
may vary greatly, ranging from
mild to severe.
The researchers studied growth
factors that are important at certain
key stages of brain development
in the womb. Named for the
first three amino acids making
up their chemical sequence, NAP
and SAL, are small peptides (small
protein sub units) of two proteins.
These two proteins enhance the
ability of brain cells to receive and
transmit signals, and enable them
to survive. (NAP is an abbreviation
for NAPVSIPQ and SALfor
SALLRSIPA.)
The mice in the study had an
extra copy of mouse chromosome
16, which has mouse counterparts
to 55 percent of the genes
on human chromosome 21.The
researchers treated pregnant mice
with NAP and SAL for five days,
then tested the mouse offspring at
8 to 12 months of age, comparing
them to mice treated with a saline
solution (placebo). Mice with the
extra chromosomal material that
were treated with NAP and SAL in
the womb learned as well as mice
that did not have the extra chromosome,
and significantly faster
than mice with the extra chromosome
that were treated with saline
solution.
"Our study has provided important
information that may help
in the understanding of Down
syndrome," said senior author
Catherine Y. Spong, M.D., chief of
the unit on perinatal and developmental
neurobiology at the Eunice
the arteries in the legs, which is a
strong predictor of heart disease.
A bone density screening to assess
osteoporosis risk is also offered
and is appropriate for both men
and women.
Packages start at $149. All five
screenings take 60-90 minutes
to complete. For more information
regarding the screenings or
to schedule an appointment, call
1-877-237-1287 or visit our website
at www.lifelinescreening.com.
Pre-registration is required.
Prenatal Intervention reduces
Learning deficit in mice
An estimated 1.5 million individuals
with Autism Spectrum
Disorders (ASD) live in the United
States, according to the Autism
Society of America. Despite extensive
research on children with
autism, little is known about what
happens to these individuals when
they grow up, particularly with
regard to their employment situations.
Scott Standifer, a University
of Missouri researcher, studies
employment issues affecting
adults with autism. In the following
Q&As, Standifer discusses obstacles
individuals with ASD confront
as they begin jobs and offers
suggestions for helping those with
autism become successful members
of the workforce.
Q: What types of jobs work
well for individuals with autism?
A: There is no best type of job
for people with autism—that is like
asking what type of job is best for
people who are very tall—it depends
on the person. It isn’t the
type of business that matters; it is
the nature of the workplace and
the job responsibilities. Individuals
with autism usually will have
difficulty in jobs involving a lot of
unstructured social contact with
the general public or jobs with
little routine. Work environments
with a lot of noise and hectic activity
probably will not work well.
Individuals with autism usually do
best in workplaces with clear rules,
consistent procedures, and limited,
structured social contacts. That
leaves many employment possibilities
for those with ASD.
Q: What obstacles do adults
with autism face when they apply
for employment and, later, when
they enter the workforce? How can
they overcome these challenges?
A: Difficulty reading social
cues is probably the biggest employment
challenge for adults with
ASD. This difficulty shows up most
prominently in job interviews,
which rely heavily on applicants’
abilities to communicate during
short, high-stakes meetings.
Since individuals with autism have
trouble reading social cues and
responding as expected, standard
interviews are unlikely to go well.
The dynamics of interview situations
for people with autism need
to change. A few companies, such
as Walgreens, AMC Theatres and
3M, are starting to address this.
In addition to the challenges
with reading social cues, people
with autism tend to speak bluntly
Kennedy Shriver National Institute
of Child Health and Human
Development (NICHD), the NIH
institute where the research was
conducted.
Dr. Spong collaborated with
first author Maddalena Incerti,
M.D., Kari Horowitz MD, Robin
Roberson, Daniel Abebe, Laura
Toso, M.D., and Madeline Caballero,
all of the NICHD Unit on Perinatal
and Developmental Neurobiology.
Dr. Incerti also is affiliated
with the University of Milano-Bicocca,
Italy, and Dr. Horowitz now
is affiliated with the University of
Connecticut, Farmington.
Their findings appear online in
PLOS ONE.
In an earlier study, Dr. Spong
and her colleagues found that, if
treated with NAP and SAL in the
womb, mice with the extra copy of
chromosome 16, achieved developmental
milestones earlier than
did mice with an extra copy of
chromosome 16 that had not been
treated. In that study, the researchers
examined developmental mile-
CONTINUED ON PAGE 15
Expert discusses Employment
challenges Facing Adults With
Autism Spectrum disorders
and don’t cushion criticism the
way most of us do. They might
say, “That’s a really ugly shirt,” or,
“This is a stupid way to sort files.” It
doesn’t take long for that behavior
to get them into trouble. Socialskills
training and specific explanations
of workplace culture can
help those with autism respond
more appropriately in work situations.
In addition, co-workers or
workplace mentors should try to
understand the nature of the persons’
challenges so they can meet
them halfway and help them navigate
office politics.
Q: What can family members
and friends of adults with autism
do to help their loved-ones transition
successfully into the workforce?
A: People with autism often
need more time to make transitions
and changes, either on small
scales (from one task to another)
or large life-stage scales (graduating
from school and beginning a
job). Ideally, young adults with autism
should have structured work
or volunteer experiences a couple
of years before high school or college
graduation. Parents and families
should contact vocational re-
CONTINUED ON PAGE 14
THE FOCUS NEWS Friday, December 7, 2012
Stanford University School
of Medicine researchers have devised
a two-part approach to identify
developing human embryos
most likely to result in successful
pregnancies. The technique could
transform the lives of infertile
couples seeking to use in vitro fertilization,
or IVF, to start a family.
The research suggests that
fragmentation — a common but
not well-understood occurrence in
the early stages of human development
in which some of the cells in
an embryo appear to break down
into smaller particles — is often associated
with a lethal loss or gain
of genetic material in an embryo’s
cells. Coupling a dynamic analysis
of fragmentation with an analysis
of the timing of the major steps of
embryonic development can significantly
increase the chances of
selecting an embryo with the correct
number of chromosomes, the
researchers found.
The findings extend beyond
IVF and offer a glimpse into how
human reproduction differs from
that of many other animals. They
also suggest that sperm selection
could be much more important
than previously believed.
“It is amazing to me that 70
to 80 percent of all human embryos
have the wrong number of
chromosomes,” said Renee Reijo
Pera, PhD, professor of obstetrics
and gynecology. “But less than 1
percent of all mouse embryos are
similarly affected. We’re trying to
figure out what causes all these abnormalities.”
Reijo Pera, who is the director
of the Center for Human Embryonic
Stem Cell Research and
Education at Stanford’s Institute
for Stem Cell Biology and Regenerative
Medicine, is the senior
author of the work, which will be
published online Dec. 4 in Nature
Communications. Research associate
Shawn Chavez, PhD, is the
study’s first author.
Regardless of the source of the
chromosomal errors, nearly all
result in miscarriage. For natural
conceptions, this often happens
8
Embryo-Analysis
may boost In Vitro
Fertilization Success
before the woman realizes she is
pregnant. Each embryo transfer in
IVF, however, is eagerly anticipated
and costs thousands of dollars.
To improve the odds of a successful
pregnancy, clinicians and parents
frequently decide to transfer
more than one embryo at a time
— a decision that has its own risks
for mother and any fetuses that
may result. For example, instances
in which there are multiple fetuses
are more likely to result in miscarriages
or to threaten the health of
the mother.
Recently, Reijo Pera and her
colleagues began to investigate
ways to better predict embryonic
developmental success within one
or two days of fertilization. Not
only would such an advance decrease
the likelihood of miscarriage
or the possible need for a
selective reduction, it would also
reduce the amount of time the
embryo would have to be cultured
in the laboratory before transfer.
(Although it has not been conclusively
shown, some researchers are
concerned that epigenetic changes
may accumulate in a cultured embryo
and cause subtle, long-lasting
effects in the fetus.)
The study extends previous
findings in Reijo Pera’s lab indicating
that the timing of cell division
and other developmental milestones
as the embryo progresses
from one to four cells can be used
to predict with 90 percent accuracy
whether the embryo is likely
to go on to develop into a 70- to
100-celled embryonic structure
called a blastocyst. Achieving
blastocyst status, which occurs
about five days after fertilization,
is a good, but not fail-safe, indication
that an embryo might result
in a successful pregnancy. That
research was published in Nature
Biotechnology in October 2010,
and is currently the subject of
clinical trials in several IVF clinics
across California.
In the new study, the researchers
decided to look more closely at
CONTINUED ON PAGE 19
december 2012 Offer:
$500 off Invisalign
plus Free Whitening
(over a $1000 saving)

Health Page
Fifteen new genetic regions
associated with coronary artery
disease have been identified by a
large, international consortium of
scientists — including researchers
at the Stanford University School
of Medicine — taking a significant
step forward in understanding the
root causes of this deadly disease.
The new research brings the total
number of validated genetic links
with heart disease discovered
through genome-wide association
studies to 46.
Coronary artery disease is the
process by which plaque builds up
in the wall of heart vessels, eventually
leading to chest pain and potentially
lethal heart attacks. It is
the leading cause of death worldwide.
The study, which will be published
online Dec. 2 in Nature Genetics,
provides insights into the
molecular pathways causing coronary
artery disease, which is also
known as coronary atherosclerosis.
“Perhaps the most interesting
results of this study show that some
people may be born with a predisposition
to the development of
coronary atherosclerosis because
they have inherited mutations in
some key genes related to inflammation,”
said Themistocles (Tim)
Assimes, MD, PhD, a Stanford assistant
professor of medicine and
one of the study’s lead authors.
“There has been much debate as
to whether inflammation seen in
plaque buildup in heart vessels is
a cause or a consequence of the
plaques themselves. Our network
analysis of the top approximately
240 genetic signals in this study
seems to provide evidence that genetic
defects in some pathways related
to inflammation are a cause.”
More than 170 researchers
were involved in this massive meta-analysis
combining genetic data
from more than 190,000 research
participants. Interestingly, about a
quarter of the genetic regions associated
with coronary disease or
heart attack were also found to be
strongly associated with cholesterol,
especially high levels of the
so-called bad cholesterol known
as LDL. Another 10 percent were
associated with high blood pressure.
Both of these conditions are
known risk factors for coronary
WWW.THEFOCUSNEWS.COM
International Study Points to
Inflammation as a cause of Plaque
buildup in Heart Vessels
The U.S. Preventive Services
Task Force today issued a draft recommendation
that encourages everyone
between the ages of 15 and
65 in the United States, regardless
of risk, to be tested at least once
during their lifetimes for HIV, the
virus that causes AIDS.
Task force member Douglas
K. Owens, MD, a professor of
medicine at the Stanford University
School of Medicine, said he
believes the recommendation, if
implemented, could have a substantial
impact on the course of
the epidemic in the United States.
Currently, there are an estimated
1.2 million people in the nation
infected with HIV, and some 20-25
percent of them aren’t aware they
carry the deadly virus. If they were
diagnosed, they could get into
treatment programs, which would
benefit them as well as helping to
prevent the spread of the disease.
“We think it’s important for
everyone to be screened once be-
cause treatment helps people live
longer, healthier lives and also prevents
transmission to others,” said
Owens, who directs the Stanford
Center for Primary Care and Outcomes
Research/Center for Health
Policy and is a senior investigator
at the Veterans Affairs Palo Alto
Health Care System.
Those at very high risk, including
gay men and injection drug
users, should be tested every year,
while others considered at increased
risk also should undergo
repeat testing with the frequency
depending on risk, the task force
recommends. In addition, the panel
said practitioners should screen
all pregnant women for the virus;
the practice, now common in this
country, has helped virtually eliminate
the incidence of mother-tochild
transmission, Owens noted.
In 2005, the task force strongly
recommended HIV screening in
adolescents and adults considered
at increased risk for HIV, but it
artery disease.
“The signals that do not point
to known risk factors may be
pointing to novel mechanisms of
disease,” Assimes said. “It is imperative
that we quickly gain a
better understanding of how these
regions are linked to heart disease,
as such understanding will greatly
facilitate the development of new
drugs to prevent heart disease.”
Genome-wide association
studies, or GWAS, were first introduced
in 2005 as a way of quickly
scanning the entire genome to
identify differences in the DNA
code, or “polymporphisms,” that
predispose people to various
common but genetically complex
diseases. Results of these studies
have shown that conditions such
as heart disease involve the combined,
subtle effects of far more
polymorphisms than initially expected,
requiring multiple massive
meta-analyses such as this one to
reliably uncover all of these genetic
signals. The hope of scientists is
that by working together in ongoing
worldwide collaborations, the
entire genetic contribution to the
CONTINUED ON PAGE 14
Proposal to Screen All Adults for HIV
could curb Spread of AIdS
A study by researchers at
the George Washington University
School of Public Health and
Health Services (SPHHS) indicates
that full implementation of
the Affordable Care Act would
expand health insurance coverage
for more low-income women, enabling
more than a million women
to obtain potentially life-saving
screening for breast and cervical
cancer. The study, "Health Care
Reform and Women's Insurance
Coverage for Breast and Cervical
Cancer Screening," was published
in a recent issue of the journal
Preventing Chronic Disease.
In the past, many low income
women without insurance could
not afford screening tests for
breast and cervical cancer such
as mammograms or Pap tests.
Such tests often identify cancer
at an early, more treatable stage—
before a tumor has spread and
turned deadly. Right now, about
40,000 women per year die of
breast cancer and another 4,000
die of cervical cancer.
The researchers created a
model, based on results from
Massachusetts' successful health
reform initiative, to estimate the
number of low-income women
in every state who would gain insurance
coverage if federal health
reform is fully implemented. They
estimated that 6.8 million lowincome
women 18-64 would gain
health insurance under health
reform. Based on findings from
a recent experiment of expanded
stopped short of recommending
a universal testing program.
The new recommendation for
widespread screening reflects the
changing world of AIDS science,
Owens said.
For instance, studies have
shown that an early diagnosis —
even before symptoms begin to
emerge — followed by effective
antiretroviral treatment, can help
prevent individuals from developing
life-threatening complications.
Moreover, HIV-infected individuals
who are treated with antiretroviral
drugs are much less likely
to pass on the virus to others. A
landmark study published in August
2011 and involving 1,763 heterosexual
couples (in which one
was HIV-positive and the other
was not) found that treating the
infected partner reduced his or her
chance of transmitting the virus by
96 percent.
In addition, once people are
more Than a million Women could
Gain Access to Potentially Life
Saving Tests for cancer
CONTINUED ON PAGE 14
Medicaid coverage for low-income
adults, they estimated that
about 500,000 more women a
year would be able to get mammograms
to check for breast cancer
and 1.3 million more women
could get Pap tests to check for
cervical cancer.
"The Affordable Care Act
could lead to major gains in
screening and early detection of
breast and cervical cancer," said
Leighton Ku, PhD, MPH, a professor
of health policy and Director
of the Center for Health Policy
Research at SPHHS who led the
study. "Those gains could result
in faster treatment and better outcomes
for women across the na-
CONTINUED ON PAGE 19
THE FOCUS NEWS Friday, December 7, 2012
Wandering minds
Associated With Aging
Scientific studies have suggested
that a wandering mind indicates
unhappiness, whereas a mind that
is present in the moment indicates
well-being. Now, a preliminary
UCSF study suggests a possible
link between mind wandering and
aging, by looking at a biological
measure of longevity.
In the study, telomere length,
an emerging biomarker for cellular
and general bodily aging, was
assessed in association with the
tendency to be present in the moment
versus the tendency to mind
wander, in research on 239 healthy,
midlife women ranging in age
from 50 to 65 years.
Being present in the moment
was defined as an inclination to
be focused on current tasks, while
mind wandering was defined as the
inclination to have thoughts about
things other than the present or being
elsewhere.
According to the findings, published
online on Nov. 15 in the new
Association for Psychological Science
journal Clinical Psychological
Science, those who reported more
mind wandering had shorter telomeres,
while those who reported
more presence in the moment, or
having a greater focus and engagement
with their current activities,
had longer telomeres, even after
adjusting for current stress.
Telomeres are the DNA-caps
that protect the ends of chromosomes,
preventing them from deteriorating
or fusing with neighboring
chromosomes. Telomeres
typically shorten with age and
in response to psychological and
physiological stressors. In research
pioneered at UCSF, scientists have
discovered that telomere shortness
predicts early disease and mortality.
As the study assessed mind
wandering and telomeres at the
same time, the researchers don't
yet know whether mind wandering
leads to shorter telomeres, whether
the reverse occurs, or some common
third factor is contributing to
both. Mindful meditation interventions,
which promote attention on
the present with a compassionate
attitude of acceptance, lead to increases
in some aspects of health.
Previous studies have found that
they are associated with increased
activity of an enzyme known as
telomerase, which is responsible
for protecting and in some cases,
replenishing telomeres.
"Our attentional state—where
our thoughts rest at any moment
– turns out to be a fascinating window
into our well-being. It may
be affected by our emotional state
as well as shape our emotional
state," said Elissa Epel, PhD, associate
professor of psychiatry and
9
lead author on the study. "In our
healthy sample, people who report
being more engaged in their current
activities tend to have longer
telomeres. We don't yet know how
generalizable or important this relationship
is."
Moving forward, Epel, along
with Eli Puterman, PhD, a psychologist
in the UCSF Department
of Psychiatry, and colleagues are
developing a series of classes to
promote more mindful presence,
to see if this intervention protects
telomere maintenance or even
lengthens telomeres.
In the current study, participants
self-reported a tendency to
mind wander, and were measured
for aspects of psychological distress
and well-being. The sample
was highly educated and had a narrow
range of both chronological
age and psychological stress (most
were low stress), all of which might
have contributed to the ability to
detect this relationship, Epel said.
The study is the first to link attentional
state to telomere length
and to control for stress and depression,
Epel said. Previous studies
have shown links between telomere
length and particular types
of stress and depression. Since
this study relied on self-reported
attentional state, she said, further
studies directly measuring presence
and mind wandering will be
needed.
"A number of emotion theories
suggest that greater attentional
control leads to less suppression of
negative emotions, and thus less of
the rebound effect of unsuccessful
suppression," said Wendy Berry
Mendes, PhD, associate professor
and Sarlo/Ekman Endowed Chair
of Emotion at UCSF and co-author
on this study. "Alternatively,
attentional control may help us
interpret emotions in a more constructive
way, what we call 'positive
reappraisals.' Such styles of
thinking have been associated with
healthy physiological states."
In addition to Epel, Mendes
and Puterman, co-authors on
this study include Jue Lin, UCSF
research biochemist in the Department
of Biochemistry and
Biophysics; Elizabeth Blackburn,
PhD, UCSF molecular biologist
and Alanie Lazaro, UCSF laboratory
manager in the Department of
Psychiatry.
Research on telomeres, and the
enzyme that makes them, was pioneered
by three Americans, including
Blackburn, who co-discovered
the telomerase enzyme in 1985.
The scientists received the Nobel
Prize in Physiology or Medicine in
2009 for this work.
Epel, Blackburn and Lin are cofounders
of Telome Health Inc, a
telomere measurement company.

Nixon's Plan
......CONTINUED FROM PAGE 6
then determine what is the best
fit for Missouri," Gov. Nixon said.
"That is why the budget I plan to
submit to the Legislature for Fiscal
Year 2014 will include federal
funding to provide health care for
an estimated 300,000 Missourians
- men, women and children - who
currently have no health insurance.
It's the smart thing to do,
and it's the right thing to do."
The Affordable Care Act allows
for an expansion of Medicaid
to cover low-income Americans
who can't afford health insurance
by raising the eligibility level to
138 percent of the Federal Poverty
Level. A family of four living at
138 percent of the Federal Poverty
Level in 2012 makes $31,809
a year.
Because federal funding will
cover 100 percent of the costs for
calendar years 2014, 2015 and
2016, expanding health care coverage
to those 300,000 uninsured
Missourians would involve no
state tax dollars for those years.
Beginning in 2017, the state share
would be five percent of the cost,
and then increase to six percent
for 2018 and seven percent for
2019. Beginning in 2020, the state
would pay 10 percent of the cost.
"More Missourians will be
able to receive timely preventive
services like immunizations, prenatal
checkups and cancer screenings,
in addition to other highquality
health care in hospitals,
clinics, FQHCs, clinics and rural
health care centers all across our
state," Gov. Nixon said. "This will
improve the health and the quality
of life for hundreds of thousands
of Missourians, and transform
the expensive, scattershot way we
now provide care for people with
no health insurance."
Currently, hospitals are reimbursed
for treating people who
have no health insurance. Under
the Affordable Care Act, payments
to hospitals that serve the uninsured
will be reduced. If those
payments are not offset by an increase
in federal funds to cover
the cost of that care, hospitals will
have to bear those costs. That results
in the high cost of caring for
the uninsured being passed along
to employers and individuals who
must pay higher premiums for
their health insurance.
In addition, a report came out
on Wednesday showing the clear
economic benefit to Missouri of
providing expanded health care
coverage, using the available federal
funds. The University of Missouri
report showed that the additional
funding for health care will
create 24,000 new jobs in Missouri
in 2014 alone.
You don’t
have to be
a farmer
to save on
insurance.
Sandy Glass
Lincoln County
Farm Bureau Agent
sandy.turner@mofb.com
Let me give you
a FRee quote
11 Sydnorville Rd., Suite 1, Troy
636-528-8443
Fax: 573-893-1655 • Cell: 636-751-8169
mofbinsurance.com
Healing Hands Massage
Not just a luxury anymore...
Buy 2
Gift Certificates,
Get 1 FREE
Residential Roofing
new chicken
bacon ranch
wrap $ 5
all purpose
room
seats 16, wi-fi,
flatscreen,
dvd
Ad #2
$ 45
1 hoUr
inTro
raTE!!
Specializing in NMT & Reflexology
Healing Hands Massage
Jennifer Dudding, LMT
431 S. Main, Troy - Union Street Entrance
(573)213-9016
MoArkkennels.CoM
Home of Gun-Dog Training/retreiving
Justin Crook
Trainer/Handler
28010 Hwy A
Fairview, MO 64842
Cell: 417-455-3824
www.moarkkennels.com
E-mail: crooks@leru.net
Hunting dogs also available for purchase.
Hours:
Monday-Friday 11-8
Saturday 11-5
Sunday 11-5
FARM BUREAU
INSURANCE
mofbinsurance.com
You don’t
have to be
a farmer to
call Marcia.
Guitars / Amps / Lessons
& Accessories
Gift Certificates available
25% OFF
any Gift Certifi cates
purchased in Nov. & Dec. at
Relax-U for Massage & Reiki
636-359-0225
1 East allEn • WEntzvillE, MO 63385
ChiropraCtor
injury &
Wellness
treatments
dr. jon oWens, d.C.
Missouri Injury & Wellness
Chiropractic Centers
Relaxing, Therapeutic Massage
www.relaxu.sitesvp.com • Hermann & Warrenton locations
Denise K. Albritton,
NCBLMT, EFT-ADV
Full Service Guitar Shop
Marcia Cox
636-887-2300
������������������
Go BIG or Go Home!
����������� ������������������������������������������
����������� ���������
MONTGOMERY
���� ������������� �����������
WENTZVILLE
�������� WARRENTON
����������������
�������������
CITY
707 �����������������
W. Pearce ����������������������
1319 Green
Next to Papa John’s Pizza
200 Sturgeon �����������������������������������������
St.
Acres Center
• We get great results even for folks
who have tried other forms of therapy.
• Soft tissue release to relieve symptoms
such as pain, numbness & tingling.
MIssourI Injury & Wellness
ChIropraCtIC Centers
100 West second street n, suite D
Wright City, Mo 63390
636-698-5521
www.missouriinjuryandwellness.com
We are the musCle & joint experts of Warren County!
massage therapy
monday by appointment!
FREE Reiki Share
Treat Event on Nov. Yourself 17th to Better Health
Relax- U,
OldfriEndsvintaGEGuitars.COM
(660) 748-3340
marcia@mofb.com
OpEratiOn Back pack.
Bring in an item for operation Backpackand you will be entered
into a drawing for a $35 Grooming Gift Certificate
LLC
... makes a dog feel loved!
Us On
TuESday - Friday: 7:30 a.m. - 5:00 pm
SaTurday: 10:00 a.m. To ?
Professional Pet stylist
Ezra SchnEidEr 636-456-5930
812 East Hwy M, truEsdalE
FREE
Tired of Spending All Day
doing Laundry at Home?
��������
�������
KNOCK IT
OUT TRIPLE
����� FAST LOAD
at Crossroads Laundry
�������������������������������
WASH
�����������������������������������
Super Fast High-Extract
Washing Machines
Saturday ��������������
4pm - 6pm Warrenton location
Sunday The Biggest 4pm - 6pm & Wentzville the Best location in
����������������
Must the present Tri-County coupon. One coupon Area! per customer.
�������������������������
Coupon expires 12/31/12
Do Your Laundry in an Hour in Our State-of-the-Art Facilities
Next to Domino’s Pizza
New Client Special $ 39
1 Hour Massage
WrigHt City: Mondays & tuesdays
WaSHiNgtoN: Wednesday - Friday
Massage therapy
Your Mercer County
Farm Bureau Agent Call today to sChedule your appointment
636-359-0225 • Visit us online www.relaxu.massagetherapy.com

News Page
“Dr. Eckman makEs gEtting
arounD much EasiEr!”
Doug’s pain level was at an 8 out of 10
when he walked into Troy Chiropractic
this afternoon - 45 minutes later he lieft
the office feling a pain level of 1.
Doug said: “For 10-years, Dr. Eckman
has kept me off of pain meds with little
more than his treatments and his vast
knowledge in the field of chiropractic
healing.” Doug was merely picking up
his fallen motorcycle without help when
a sharp shooting pain in his lower back
dropped him to the ground. Doug added:
“Dr. Eckman is up front with you. He
gives you all of the information of what
he is doing and why. This let’s you help in
your own healing.”
You don’t
have to be
a farmer
to save on
insurance.
Doug o. / Lower back pain
Marcia Cox
Mercer County
Farm Bureau Agent
(660) 748-3340
FARM BUREAU
INSURANCE
WWW.THEFOCUSNEWS.COM
mercy Hospital Washington Earns
Accreditation for Heart Attack care
Mercy Hospital Washington strict criteria aimed at:
cy’s, is to reduce mortality rates
meets or exceeds the standards of · Reducing the time from on- by teaching the public how to
care to treat heart attacks and save set of symptoms to diagnosis and recognize and react to early heart
lives. The hospital received full treatment.
attack symptoms, reduce the time
accreditation with percutaneous · Treating patients as quickly as that it takes to receive treatment
coronary intervention (PCI) from possible to preserve heart muscle. and increase the effectiveness of
the Society of Cardiovascular Pa- · Monitoring patients with treatment.
tient Care (SCPC). Hospitals that chest pain that’s unclear to be a The Society of Cardiovas-
receive SCPC accreditation have heart attack so they are not sent cular Patient Care (SCPC) is an
achieved a higher level of exper- home too quickly or needlessly international not-for-profit ortise
in treating patients with heart admitted to the hospital.
ganization that focuses on trans-
attack symptoms.
Mercy met these criteria by forming cardiovascular care by
“This is added confidence that proving a consistency of care assisting facilities in their effort
if Mercy Washington is your clos- from diagnostic and treatment to create communities of excelet
hospital, we have the resources, programs to rapid response partlence that bring together quality,
staff and programs in place to save nerships with area emergency cost and patient satisfaction. As
your life or the life of someone you medical services. In addition, the the only cross-specialty organiza-
love,” said Mercy Clinic interven- hospital provides a chest pain tion, SCPC provides the support
tional cardiologist Joseph Moore, observation unit and promotes needed for individual hospitals
MD, chief of cardiology and direc- healthier lifestyles to help reduce and hospital systems to effectively
tor of the cardiac cath lab. risk factors for heart disease. bridge existing gaps in treatment
To become an Accredited Heart attacks are the lead- by providing the tools, education
Chest Pain Center with PCI, Mering cause of death in the United and support necessary to successcy
Hospital Washington engaged States, with 600,000 people dying fully navigate the changing face of
in rigorous evaluation by SCPC annually of heart disease. More
for its ability to assess, diagnose Ad #1than five million Americans visit
and treat patients with heart at- hospitals each year with chest
healthcare. For more information
about SCPC, visit www.scpcp.org.
Ad #2
tack symptoms. The hospital met pain. SCPC’s goal, as well as Mer-
You don’t
have to be
a farmer
to save on
insurance.
Sandy Turner
Lincoln County
Farm Bureau Agent
sandy.turner@mofb.com
Let me give you
a FRee quote
11 Sydnorville Rd., Suite 1, Troy
636-528-8443
Fax: 573-893-1655 • Cell: 636-262-5864
mofbinsurance.com
Marcia Cox
Christmas Mercer Decorations,
County
Farm Bureau Agent
Home Decor, Tools, Toys & More!
(660) 748-3340
marcia@mofb.comSomething
marcia@mofb.com for Everyone!!
FARM BUREAU
THE INSURANCE
MERCANTILE
mofbinsurance.com mofbinsurance.com
OUTLET
800 East Cherry St. • Troy
636-528-9033
Hours: Mon-Fri 9am-7pm
Sat 9am-5pm • Sun 11am-4pm
THE FOCUS NEWS Friday, December 7, 2012
Large Selection of Hard To Get
Colt 1911s
IN STOCK NOW!!!
Something for all the gun lovers
on your Christmas list.
4th Annual Food Drive benefiting
Turning Point Women’s Shelter
Bring in non perishable items.
TRADES
NEEDED
H&H
11
“Your Hometown
Gun Shop!”
GUNS
FARM BUREAU
INSURANCE
mofbinsurance.com
You don’t
have to be
115 E. Main St. - Warrenton, MO • 636-456-6118
Family Owned a & farmer Operated - to Weekly Gun Raffle
Tuesday - Saturday 9:00-6:00 • Open late on Thursdays
call Marcia.
Like your cash register to ring more often?
Focus News caN DeLiver!
our six county distribution is the key.
caLL Now!
314-713-2400
focusnewsmo@gmail.com
YOUR ONE-STOP CHRISTMAS SHOP!
Marcia Cox
Your Mercer County
Farm Bureau Agen
(660) 748-334
marcia@mofb.com

Obituaries Page
bennie L. Litchfield
Bennie L. Litchfield, age 46, of
Foristell, MO, died on November
30, 2012 at his home. He was born
on April 28, 1966 in Bushnell, IL.
He was a manager at HP Products
in Earth City. His hobbies were
hunting, motorcycles and horses.
He is survived by his wife, Kim
Campbell of Foristell, MO; three
sons, Corey Litchfield of San Bernardino,
CA; Cameron Litchfield
of San Bernardino; Kyle Litchfield
of San Bernardino; one daughter,
Shelby Litchfield of Foristell, MO;
one brother, David Litchfield of
Idaho; four sisters, Lisa Gilmore of
Idaho; Laura Litchfield; Robin Litchfield;
and Vickie Davis.
He was preceded in death by his
parents, Windell and Barbara J. Litchfield
(nee Hall).
Funeral services will be held on
Saturday, December 8 at 10 a.m. at
Pitman Funeral Home in Wentzville.
Visitation will be held on Friday
from 4 to 8 p.m. at the funeral
home. Burial was in Eternal Peace
Cemetery in Wentzville, MO.
Memorial contributions may be
made to the family for final expenses
in care of Pitman Funeral Home,
1545 Wentzville Pkwy., Wentzville,
MO 63385.
margaret ruth
crouch
Margaret Ruth Crouch, age 69,
of Warrenton, MO, died on November
28, 2012 at St. Joseph Hospital
West in Lake St. Louis, MO.
She was born on December 6, 1942
in Philadelphia, PA. She was a bank
teller at Bank of America in St. Peters,
MO.
She is survived by her mother,
Agnes Cook (nee Graham) of
Warrenton, MO; her husband, Joseph
Crouch of Warrenton, MO;
two sons, Joseph and wife Jennifer
Crouch of O'Fallon, MO; and Michael
and wife Stephanie Crouch of
Wentzville, MO; one brother, Gene
Cooke of Hudson, FL; and four
grandchildren.
She was preceded in death by
her father, Elmer Cooke.
Funeral services were held on
Monday, December 3 at 2 p.m. at
Pitman Funeral Home in Wentzville,
MO. Visitation was held on
Monday from 1 to 2 p.m. at the funeral
home.
Memorial contributions may
be made to the St. Louis Botanical
Garden of Children's Hospital in
care of Pitman Funeral Home, 1545
Wentzville Pkwy., Wentzville, MO
63385.
robert "bob"
Henebry
Robert “Bob” Henebry, 91, of
Hawk Point, MO, passed away on
Sunday, December 2, 2012. He was
born on August 3, 1921 in Troy,
MO, a son of the Thomas and Mary
Ella (Norton) Henebry. He was
married on October 11, 1947 to
Geneva Ethington. To this union
seven children were born.
Robert attended school in
Hawk Point, MO. He was a farmer
his whole life and still found the
Family Owned and Operated.
Serving LincoLn And Pike countieS
Funeral Home & Cremation Center
time to raise six children, take care
of the cattle, harvest crops and work
in construction. He was a very busy
man, who his hands were never at
an idle and always found time to attend
family functions. While being
a laborer he helped build the GM
plant, several bridges and highways.
Robert loved to take his family
to the Queen Arena and enjoy
the night dancing. He was a dedicated
husband, father, grandfather
and great-grandfather. Robert was
a member of St. Mary’s Catholic
Church, Missouri Cattleman’s Association,
Hawk Point Lions Club,
Local 660 Laborers Union, he was
initiated on December 16, 1959 and
retired on January 1, 1991 as a gold
member of 53 years.
He is survived by his loving
wife of 65 years, Geneva Henebry
of Troy; children: Richard Henebry
and wife Penny of Troy; Kenny
Henebry and wife Sissy of Hawk
Point, MO; Betty Anne Smith and
husband Gene of Winfield, MO;
Alice Amann and husband Craig
of Hawk Point; Donna Reale and
husband Jim of Defiance, MO; and
Roberta Trost and husband Mike
of Defiance; sixteen grandchildren:
Michael, Robert and Michelle
Henebry, Jill Brian and Kenny Dunard,
Dawn Seeger, Heather Gray,
Heidi Owenby, Heath Amann,
Keith Henebry and Joseph and
Andrew Trost; step-grandchildren:
Vanessa Guyot, Natalie Mennemeyer
and Phyllis Tuepker; thirteen
great-grandchildren: Kaleb
and Ashleigh Henebry, Layne, Jaxon
and Mason Henebry, Brenden
Cockrell, Preston and Luke Seeger,
Lilly, Brianna and Cooper Owenby,
Arianna and Alysan Amann; nieces,
nephews and many friends.
He was preceded in death by his
parents; one infant daughter, Mary
Jane Henebry; one infant granddaughter,
Cynthia Amann; and two
brothers, Bernard and Richard N.
Henebry.
Friends were received from 4:00
p.m. to 8:00 p.m. on Tuesday, December
4, 2012 at Kemper-Marsh-
Millard Family Funeral Home /
Hawk Point Chapel. Prayer service
was held at 7:30 p.m. Mass was
held at 11:00 a.m. Wednesday at
St. Mary’s Catholic Church. Interment
was held at St. Mary’s Catholic
Church.
Expressions of sympathy may
be made to Macular Degeneration
Associations in care of Kemper-
Marsh-Millard Family Funeral
Chapel, 41 Farm Lane, Hawk Point,
MO 63349. Online condolences
may be made at www.kempermarshmillardfamilychapels.com.
robin French
Robin French, 52, of Old Monroe,
MO, passed away on Saturday,
December 1, 2012 in Old Monroe.
She was born on February 22, 1960
in St. Louis, MO, a daughter of Joseph
T. and Barbara (Emge) Franklin.
She was united in marriage to
Pat French on March 24, 1979. To
this union one son was born. Robin
graduated from Fort Zumwalt
High School in 1978. She was employed
by the Elevator Construc-
FunerAL & cremAtion center
(636) 528-8244
www.mccoyblossomfh.com
tors Union. Robin had a love for all
animals.
She is survived by her one son,
James French and girlfriend, Mandy
Fix of Old Monroe; mother,
Barbara Franklin of Troy, MO; her
companion, Tim Wimsatt of Old
Monroe; one brother, Rusty Franklin
and wife, Diane of St. Paul, Mzo;
nieces and nephews, Nicole Franklin,
Nathan Franklin, Nicholas
Franklin, Sarah Koester and Kayla
Koester.
She was preceded in death by
her father, Joseph “Whitey” Franklin
in February 2011.
Family and Friends were received
from 4:00 p.m. to 7:00 p.m.
on Wednesday, December 5, 2012
at Kemper-Marsh-Millard Family
Funeral Home / Troy Chapel. Funeral
services were held at 7:00 p.m.
on Wednesday at the chapel.
Expressions of sympathy may
be made to American Diabetes Association
in care of Kemper-Marsh-
Millard Family Funeral Chapel, P.O.
Box 222, Troy, MO 63379. Online
condolences may be made at www.
kempermarshmillardfamilychapels.com.
dr. I. Jeffrey
cramp
Dr. I. Jeffrey
Cramp, 56, of
Montgomery City,
MO, died on Tuesday,
November 27,
2012, at his home in
Montgomery City,
MO.
Jeff was born
March 13, 1956, in Reading, PA
to Irvin Barry Cramp and Phyllis
High Cramp. In 1974 Jeff graduated
from Schuylkill Valley High School
in Leesport, PA. Then he attended
Kutztown University in Kutztown,
PA. In 1978 he went to Kirksville,
MO to attend Northeast Missouri
State University (now Truman
State) and graduated in 1979 with
a BS in Biology. He then worked at
the Kirksville Osteopathic Health
Center until entering KCOM in the
fall of 1980. In March of 1980 Jeff
joined the United States Naval Reserves
and he served for 12 years,
including four years as an Aviation
Medical Officer at NAS Whiting in
Milton, FL, and received an Honorable
Discharge April of 1992.
He moved to Milan, MO and went
into the Milan Family Practice and
was there until August of 1995 and
then moved to Montgomery City
and has lived here 17 years. Jeff
and Cheryl were married on December
27, 1980 in Kirksville, MO.
Dr. Cramp was active in family
medical practice for many years in
Montgomery City, MO, and later in
Vandalia, MO. Jeff was a member
of the First United Methodist-Presbyterian
Church in Montgomery
City, MO and enjoyed photography,
boating, anything to do with the
Civil War, antiques, enjoyed watching
the History Channel, especially
the TV show, “Pawn Stars,” brown
bear hunting in PA, skiing, hiking,
and any new technology. He loved
spending time with his family and
his many friends.
Dr. Cramp is survived by his
wife, Cheryl Moore Cramp of
Montgomery City, MO; three children:
Jerad Cramp of Austin, TX;
Nathan Cramp of O’Fallon, MO;
and Allison Cramp of Montgomery
City, MO; his brother, James Cramp
and wife, Carol, of San Antonio,
TX; sister, Amy Cramp of Pensacola,
FL; sisters-in-law: Carol Barrickman
of Montgomery City, MO;
and Debby Groeper and husband,
Jon, of Warrenton, MO; special
Aunt, Barbara Saulter of Macon,
THE FOCUS NEWS Friday, December 7, 2012
MO; Uncle and Aunt, James H.
High and wife, Jean Ruth; cousin,
Linda Clement; and many nieces,
nephews and friends.
Dr. Cramp was preceded in
death by his parents, Irvin Barry
and Phyllis Cramp and brotherin-law,
Tim Barrickman; Aunt and
Uncle, Helen and Ralph Hustor;
cousin, Sue Lakin, and Father-inlaw,
Pearl Moore.
Visitation was held on Monday,
December 3, 2012, from 3:00 p.m.
until 7:00 p.m. at the First United
Methodist-Presbyterian Church in
Montgomery City, MO. Private
memorial services were held.
In lieu of flowers, memorial
contributions are suggested to a
trust that is being established for
Allison Cramp’s college education,
in c/o Schlanker Funeral Home,
207 Danville Road, Montgomery
City, MO 63361. Condolences may
be made to www.schlankerfuneralhome.com.
Stanley George
daniels
Stanley George Daniels, 59, of
Montgomery City, MO, died on
Saturday, November 24, 2012, at
the Golden Living Center/Gamma
Road Lodge in Wellsville, MO.
Stanley George Daniels was
born May 23, 1953 in Mexico, MO,
to Warren Bus Daniels and Mary J.
Gloe Daniels. Stan graduated from
the Montgomery County R-II High
School in 1971. He married Marla
Odem on October 19, 1974 at St.
Patrick’s Church in Jonesburg, MO.
Stan was a plant operator at MFA
in Montgomery City, MO, until his
health started to decline. He was
a member of the Hey Boys of the
Montgomery County Fair and also
a member of the Sportsman’s Lake
and enjoyed fishing, hunting (especially
deer), football, baseball, and
weight lifting. His biggest joy was
spending time with his family, especially
his grandchildren.
Stanley is survived by his wife,
Marla Odem Daniels of Montgomery
City, MO; one daughter, Becky
Gilbert and husband, Donnie, of
New Florence, MO; two grandchildren:
Jacob and Josh Gilbert of New
Florence, MO; two brothers: James
Daniels and wife, Lorre, of St. Louis,
MO; and Rich Daniels and wife,
Paula, of Wellsville, MO; two nieces:
Amanda and Alyssa Daniels of
Wellsville, MO; and many friends.
Stanley was preceded in death
by his parents, Warren Bus Daniels
and Mary J. Gloe Daniels; an infant
brother; and his father-in-law and
mother-in-law, Marvin and Punkie
Odem.
Funeral services were held at
7:00 p.m. on Wednesday, November
28, 2012, at the Schlanker Funeral
Home in Montgomery City, MO.
The Reverend Gary Bailey officiated.
Visitation was held from 3:00
p.m. until 7:00 p.m. on Wednesday
at the Schlanker Funeral Home in
Montgomery City, MO.
Memorial contributions are
suggested to the Juvenile Diabetes
Foundation or to the Siteman Center,
c/o Schlanker Funeral Home,
207 Danville Road, Montgomery
City, MO 63361. Condolences may
be made to www.schlankerfuneralhome.com.
robin Sue Yates
Robin Sue Yates, 55, of Moscow
Mills, MO, passed away on November
30, 2012 at her residence. She
was born November 29, 1957 in St.
Louis, MO, a daughter of the late
Bobby Dalton and Evalena (Tucker)
Frey. She was united in marriage
to Donnie Yates, Sr. on December
3, 1975 in Clayton, MO.
12
Robin attended school in Pattonville,
MO. She was employed at
Wal-Mart in Troy, MO, and True
Manufacturing in O’Fallon, MO.
Robin had an immense love for her
children and grandchildren and
was always entertaining her friends
and family.
She is survived by her loving
husband of 36 years, Donnie L.
Yates, Sr. of Moscow Mills; children,
Angie Summerton and husband,
William of Winfield, MO;
Travis Yates of Moscow Mills; and
Donnie Yates, Jr. of Moscow Mills;
one sister, Timi Pollard and husband,
Brent of Troy, MO; seven
grandchildren, Chelsea Summerton,
Shannon Summerton, Coren
Bradshaw, Haley Summerton, Peyton
Yates, Cain Frey and Jayden
Yates; and one great-grandchild,
Jordyn Dallas.
She was preceded in death by
her parents and one son, Lucas W.
Frey, on June 27, 2012.
Friends were received from 5:00
p.m. to 7:00 p.m. on Thursday, December
6, 2012 at Kemper-Marsh-
Millard Family Funeral Home /
Troy Chapel. Funeral services were
held at 7:00 p.m. on Thursday at the
Chapel.
Expressions of sympathy may
be made to the Family Of Robin
Yates. Online condolences may be
made at www.kempermarshmillardfamilychapels.com.
mary J. Samsel
Mary J. Samsel (nee Mroczkowski),
age 58, of Wentzville, MO,
died on Sunday, December 2, 2012.
She was born on July 12, 1954.
She was the loving daughter of
Leo J. Mroczkowski and the late
Fannie Marie Mroczkowski; devoted
mother of Debbie Manning,
Robert Manning, and Anthony
Samsel; beloved sister of Pat (Marty)
Daffron, Janet Simon, Donald
Mroczkowski, John (Sandy) Mroczkowski,
Carol Mroczkowski, and
Michael (Nina) Mroczkowski.
She is preceded in death by her
sister, Linda Marie Mroczkowski,
and many nieces, nephews, cousins,
and friends.
Mary enjoyed spending time
with her family and friends. She
had a love for animals, especially
her Yorkie, "Baby". Mary also loved
the outdoors and loved gardening.
A memorial service was held
on Wednesday, December 5 at 7
p.m. at Baue Funeral and Memorial
Center in St. Charles, MO. Visitation
was held on Wednesday from
4 to 7 p.m. at the funeral home.
Memorials may be made to St.
Charles County Humane Society.
Julia m. Guss
Julia M. Guss, of Marthasville,
MO, passed away on Friday, November
30, 2012 at Southpoint Assisted
Living in Washington, MO,
at the age of 80 years. She formerly
resided in Warrenton and Ferguson,
MO.
Julia was born to Victor and
Julia Marie (nee Kersting) Camenzind
on December 28, 1931 in St.
Louis, MO.
She was united in marriage to
John James Guss on October 14,
1950 in Jennings, MO. He preceded
her in death on September 21,
2005. They celebrated 54 years of
marriage.
She was a homemaker and coowner
of Johnnie's Ice Company in
Ferguson, MO.
Survivors include one son, Dale
James Guss and wife, Chris, of Dutzow,
MO; two brothers; Bob Camenzind
and Jerry Camenzind and
wife, Donna, both of St. Charles,
MO; one sister, Jeanette Camen

Obituaries Page
zind of O'Fallon, MO; sister-inlaw,
Joy Camenzind of Columbia,
MO; seven grandchildren, David
Guss (Marissa), Adam Guss (Melanie),
Mary Beth (Cory) Eye, Katie,
Robbie, Theresa and Andy Guss;
six great-grandchildren, Cooper,
Kensley, Quinn, Lucas, Rosalind
and Whelen; other relatives and
friends.
She was preceded in death by
her parents; her husband; and one
brother, Victor.
Visitation was held on Tuesday,
December 4, 2012 from 4:00
- 8:00 p.m., at Lichtenberg-Martin
Funeral Home, 16137 S. Hwy. 47,
Marthasville, MO. A prayer service
was held on Wednesday, December
5, 2012 at 10:00 a.m., at the funeral
home followed by a graveside service
at St. Vincent DePaul Catholic
Cemetery in Dutzow, MO.
Memorials may be made to St.
Vincent DePaul Catholic Church
or to Masses in c/o Martin Funeral
Home, 510 E. Main, Warrenton,
Mo. 63383. Online condolences
may be given at www.martinfuneral.net.
charles P. raue
Charles P. Raue, age 86, of
Foristell, MO, died on November
30, 2012 at his home. He was born
on September 29, 1926 in Bonneterre,
MO. He worked in sales at
an auto business. He was involved
for 20 years in Country & Western
Music and was a singer in Rainbow
Trio Band.
He is survived by his wife,
Juanita Raue; one son, Charles
Dennis Raue of St. Louis, MO; two
daughters, Sherry Joy and husband
Bruce Melchior of Cottleville, MO;
Deborah Karen and husband Ray
Higgins of Wildwood, MO; five
grandchildren; and three greatgrandchildren.
He was preceded in death by his
parents, Charles and Helen Raue.
Funeral services were held on
Thursday, December 6 at Pitman
Funeral Home in Wentzville. Visitation
was held on Wednesday from
4 to 8 p.m. at the funeral home.
Memorial contributions may
be made to SSM Hospice in care
of Pitman Funeral Home, 1545
Wentzville Pkwy., Wentzville, MO
63385.
Virginia
ruth
"Ginny"
Goodson
Virginia Ruth
“Ginny” Goodson
passed away on December
5, 2012 at
her residence in Troy, MO. She was
born to Pastor Clarence Hampton
and Eileen Lillian (Merrymann)
Hampton in Clinton, Arkansas on
July 31, 1935. On July 3,1953 she
met Roy Eugene “Gene” Goodson
and they were later married on November
20 , 1953 in St.Louis, MO.
Virginia Ruth was a wonderful
wife, mother and friend to many.
She was always active in her church
First Assembly of God in Troy and
throughout the years was involved
in Calvary Temple Assembly of
God, O’Fallon Assembly of God,
and Versailles Assembly of God.
Ruth and Gene helped build many
of these churches from the ground
up. “Ginny,” as she was known
to her co-workers at McDonnell
Douglas, worked for twenty-six
years as a Executive Assistant and
was always a joy to be around. Her
family was very important to her
and she enjoyed gardening, quilting,
fishing and spending time at
the lake.
Surviving are her loving husband,
Roy Eugene “Gene” Goodson;
her three children, Dan and
wife Torey Goodson of Freeport,
IL; Dave and wife Tammy Goodson
of St.Charles, MO; and Theresia
and husband Wayne Wohldmann
of St.Charles, MO; three brothers,
Paul and wife Marlys Hampton of
Ballwin, MO; Ronald and wife Dedra
Hampton of Lincoln, Nebraska;
and Michael (Linda) Hampton of
Grand Rapids, Michigan; one sister,
Charlotte and husband Steve Bays-
Myers; 12 grandchildren and seven
great-grandchildren and many other
relatives and friends.
Virginia was preceded in death
by her parents, Pastor Clarence and
Eileen Hampton; and two brothers,
Royce Hampton and Keith Hampton.
Visitation will be held on Friday,
December 7 from 4-8 p.m. and
also on Saturday December 8 from
10-11 a.m. at First Assembly of God
Church in Troy, MO. Funeral services
will be held on Saturday at the
church. Burial will be in St. Charles
Memorial Gardens in St. Charles,
MO.
Memorials are suggested to
First Assembly of God Church Troy
in c/o McCoy and Blossom Funeral
Home, 1304 Boone Street, Troy,
MO.
Harry Samuel
Van Scoyk
Mr. Harry Samuel
"Sam" Van Scoyk, 63, passed away
Friday morning, November 30,
2012 at his home in Elsberry, MO.
Born August 8, 1949 in Louisiana,
MO, he was the son of Henry Hoagland
and Margaret Alvina Ray
Van Scoyk. Sam was a graduate of
Elsberry High School. He went on
to serve his country in the United
States Air Force. He worked for
many years as an over the road
truck driver for Dynamic Transit
Company based out of Granite
City, IL, retiring in 2003. Sam was
a member of the New Hope Lodge
#199 AF&AM of Elsberry.
He was preceded in death by his
parents, Hoagland and Margaret
Van Scoyk; and one daughter, Samantha
Jo Tucker.
Survivors include four sons:
John Van Scoyk and his wife, Patty,
of Winfield, MO, RandallVan
Scoyk of O'Fallon, MO, Charles
Van Scoyk and his wife, Jocelyn, of
Kailua, HI and Robert Calvin and
his wife, Rosetta, of Elsberry; one
daughter, Tammy Bishop of MS;
"Thanks so much. Norm's monument really reflects the man he was.
It looks wonderful!" - Patti
and nine grandchildren. Sam also
leaves brother Henry "Hank" Van
Scoyk and his wife, Kathy, of Tampa,
FL; other relatives and friends.
Per Sam's request, there will
be no services. Memorials may be
made to the Family of Sam Van
Scoyk in care of Carter-Ricks Funeral
Home, 107 S. 5th Street; Elsberry,
MO 63343.
Kenneth Lee
Fakes
Mr. Kenneth Lee
Fakes, 81, of Ashland, MO, formerly
of Elsberry, MO, passed away
Tuesday morning, December 4,
2012 at Ashland Villas in Ashland.
Born February 6, 1931 in Hanston,
KS, he was the son of Chester Ben
and Alice Jeanette Mead Fakes. After
graduating high school in Kansas,
he went on to serve his country
in the United States Marines
during the Korean Conflict from
April 1, 1952 until being honorable
discharged as a Cpl on March
4, 1954. He was united in marriage
on July 13, 1952 in Elsberry, MO
to Elizabeth Charlene Hines. This
union was blessed with four children:
Cathy, Karen, Ben and Joe. He
worked for 13 years as a sheet metal
worker for McDonnell Douglas.
Mr. Fakes was also a self employed
carpenter. He then worked for 15
years as a stocker and door greater
for Wal-Mart. . He was a member
of the American Legion Post #226
and was past Commander. He was
also a member of the former Odd
Fellows Lodge.
He was preceded in death by his
parents, Chester and Alice Fakes;
two brothers: Edward Max Fakes
and Chester Ben Fakes and his wife,
Mildred; one sister, Jessie Hausgen
and her husband, Richard; and his
beloved wife of nearly 55 years,
Elizabeth Fakes on July 12, 2007.
Survivors include two daughters:
Cathy Cooper and her husband,
Harry, of Elsberry and Karen
Wolf and her husband, Terry, of
Hayes, KS; and two sons: Ben Fakes
and his wife, Claudia, of New Llano,
LA and Joe Fakes of Elsberry.
He also leaves six grandchildren,
four step-grandchildren, six greatgrandchildren,
eleven step-greatgrandchildren,
nine step-greatgreat-grandchildren;
other relatives
and many friends.
Visitation was held from 4:00-
8:00 p.m. on Friday, December 7,
2012 at Carter-Ricks Funeral Home
in Elsberry. Inurnment and Military
Honors will be held at a later
date.
Memorials may be made to the
Family of Kenneth Fakes or to Hospice
Compassus in care of Carter-
Ricks Funeral Home, 107 S. 5th
Street; Elsberry, MO 63343.
Penny Lyn Henebry
Penny Lyn Henebry, 60, of Troy,
passed away on December 4, 2012
at her residence, surrounded by her
family. She was born on August 17,
1952 in St. Louis, MO, a daughter of
the late Earl J. and Jean B. (Oppeau)
Amann. She was united in marriage
to Richard Henebry on June 25,
1971 at St. Mary’s Catholic Church
in Hawk Point, MO. To this union
three children were born.
Penny attended grade school in
Hawk Point, MO, and graduated
from Buchanan High in 1970. She
was employed for General Motors
with 28 years, prior to her illness.
She loved to watch Yadier Molina,
play for the St. Louis Cardinals
Baseball Team, Kurt Warner, for
the Arizona Cardinals Football
Team and the St. Louis Rams Football
Team. Penny enjoyed reading,
cooking, working puzzles with a
minimum of 1,000 pieces and tak-
THE FOCUS NEWS Friday, December 7, 2012
ing care of her seven cows, which
she personally named. She was
a member of St. Mary’s Catholic
Church in Hawk Point, Missouri.
Penny was a loving wife, mother,
grandmother and will be deeply
missed by those who knew and
loved her.
She is survived by her loving
husband of 41 years, Richard
Henebry of Troy, MO; children,
Michael Henebry and wife, Terrilyn
of Moscow Mills, MO; Robert
Henebry and wife, Cassie of Hawk
Point, MO; and Michelle Henebry
of Troy, MO; siblings, Craig Amann
and wife, Alice of Hawk Point, MO;
Kurt Amann and wife, Peggy of
Hawk Point, MO; and Kris Watt
and husband, Bob of Troy, MO;
six grandchildren, Kaleb Henebry,
Ashleigh Henebry, Layne Henebry,
Jaxon Henebry, Mason Henebry
and Brenden Cockrell; one uncle,
nieces, nephews and many friends.
She was preceded in death by
her parents; grandparents; one
sister, Sue Molle; and one brother,
Mark Amann.
Family and Friends will be received
from 10:00 a.m. to 1:00 p.m.
on Saturday, December 8, 2012 at
Kemper-Marsh-Millard Family
Funeral Home / Hawk Point Chapel.
Funeral services will be held at
1:00 p.m. on Saturday, December
8, 2012 at the chapel. Father Tom
Wissler will officiate.
Expressions of sympathy may
be made to Disabled Veterans of
Foreign Wars, in care of Kemper-
Marsh-Millard Family Funeral
Chapel, 41 Farm Lane Hawk Point,
MO 63349. Online condolences
may be made at www.kempermarshmillardfamilychapels.com.
Elsie brown
Elsie Emily Bueneman Brown,
daughter of Robert and Elizabeth
Bueneman, was born September 3,
1911 near Troy, MO. She went to be
with the Lord on Thursday, December
6, 2012.
After graduation from Buchanan
High School in Troy, she was
united in marriage to Rev. Perry
E. Brown. They were blessed with
a family of five children, to whom
she devoted her loving care. As a
pastor’s wife, Mrs. Brown served in
many different roles in the churches
Rev. Brown pastored, including Pianist
and Director of the Women’s
Missionary Society.
Early in their marriage, the
family moved to Springfield, MO,
where they served in a pastorate
for five years. They then moved to
Hannibal, MO, where they lived
for a number of years, continuing
in ministry. Leaving Hannibal, she
and Rev. Brown moved to Moscow
Mills, MO. In 1975, Rev. Brown
was called to pastor the Highland
Prairie Union Church at Ethlyn,
MO, where they served until 1988.
In 1980, they moved from Moscow
Mills to their home four miles
south of Troy, where Mrs. Brown
lived until her 100th birthday. At
that time, she moved to the Troy
Manor.
Mrs. Brown enjoyed the company
of her family, and in her later
years, she especially enjoyed the
large family reunions, and encouraged
all her children and grandchildren
to attend. She also loved being
surrounded by her flowers, for
which a sun room was added to her
home near Troy. She enjoyed traveling,
and often reminisced about her
trips to Grenada, Grand Cayman,
Jamaica, Hawaii, and many locations
throughout the United States.
More recently, she kept busy with
genealogy projects, and caring for
her cats and their kittens.
Mrs. Brown was preceded in
13
death by her husband, Rev. Perry
Brown, a daughter, Glenda Faye,
and a brother, Ernie Bueneman.
She is survived by two daughters,
Carolyn Sue Smashey (husband
David, deceased) of St. Charles,
MO, and Rachel Anne Goering
(husband William) of McPherson,
KS; two sons, Paul Robert (wife
Cheryl) of Boaz, AL, and Perry Everett,
Jr. (wife Phyllis) of Arlington
Heights, IL; eight grandchildren,
eight great-grandchildren, and one
great-great- grandchild; sister-inlaw,
Alberta Bueneman; nieces,
nephews and many, many friends.
Friends will be received from
1:00 p.m. to 2:00 p.m. on Saturday,
December 8, 2012 at Kemper-
Marsh-Millard Family Funeral
Home / Troy Chapel. Funeral services
will be held at 2:00 p.m. on
Saturday, December 8, 2012 at the
chapel. Rev. Edgar Wegener will officiate.
Mrs. Brown will be greatly
missed by her family and many
friends. Her cheerful smile, happy
laughter and fun-loving ways,
along with her wit and wisdom,
were special gifts she shared with
all who knew and loved her.
Expressions of sympathy may
be made to the Troy Manor in care
of Kemper-Marsh-Millard Family
Funeral Chapel, P.O. Box 222 Troy,
MO 63379. Online condolences
may be made at www.kempermarshmillardfamilychapels.com.
bonnie Lee Apple
Bonnie Lee Apple, age 74, of
Wentzville, MO, died on December
5, 2012 at 11:01 p.m. in Wentzville.
She was born on March 4, 1938 in
Bunceton, MO. She worked as a
manager. She was a member of Immanuel
Lutheran Church in Wentzville,
MO.
She is survived by two sons,
Mark and wife Lisa Apple of Wright
City, MO; Wayne and wife Heather
Apple of Wentzville, MO; two
daughters, Teresa and husband Jay
Holladay of Foristell, MO; Debbie
Apple of Wentzville, MO; nephew,
Bruce Richter of Valley Park, MO;
and eight grandchildren.
She was preceded in death by
her parents, Theodore and Nora
Barklage (nee Meers); her husband,
Robert Apple; one brother, Leonard
Barklage; and one sister, Virginia
Roark.
Funeral services will be held on
Monday, December 10 at 10 a.m.
at Pitman Funeral Home in Wentzville,
MO. Visitation will be held
on Sunday from 1:30 p.m. to 6 p.m.
at the funeral home. Burial will be
in S. Linn Cemetery in Wentzville,
MO.
Memorials may be made to
Immanuel Lutheran Church, Alzheimer's
Association, or to Nurses
and Company Home Health &
Hospice Foundation in care of Pitman
Funeral Home, 1545 Wentzville
Pkwy., Wentzville, MO 63385.
Share your condolences and memories
at www.pitmanfuneralhome.
com.
Get your marketing in
Focus
314-713-2400
Email:
focusnewsmo
@gmail.com

News Page
Winter care for House Plants
Submitted by: Desiree Rutherford,
University of Missouri Extension,
Lincoln County Master Gardener
During the winter, don’t neglect
those house plants, show
them some tender loving attention
and you will be brighten up those
dreary, cloudy days with healthy
plants.
With our furnaces and wood
stoves at maximum output, and
if you do not have a humidifier
adding moisture to the air in the
house, your plants will suffer. In
Missouri, most house plants are
tropical or sub-tropical in nature,
and their origination was in the
jungle or humid hot house. By
placing a shallow pan of water near
your house plants you will help
them absorb moisture from the
surrounding air to hydrate them.
It is also time to dust the leaves
of your house plants so that they
can utilize the most indoor or
window lighting for their growth.
Since our days are shorter in the
winter months, maximizing the
Autism disorders.............................................CONTINUED FROM PAGE 8
habilitation counselors early, well
before the youths’ senior years in
school, and have them meet with
the schools’ special education
teams. The counselors may not be
able to begin formal services yet,
but they can start conversations
with the individuals and the special
education teams.
Q: What should potential employers
know about hiring someone
with autism? How can managers
and co-workers facilitate better
workplaces for those individuals?
A: Some common features of
autism actually can be assets on
the job. Individuals with autism
generally like consistent work routines
and complying with rules,
procedures, policies and standards.
They often excel at noticing
patterns and deviations from
patterns, which can make them
especially equipped for roles in
quality control, computer applications,
etc. Also, when compared
with other workers, employees
with autism normally socialize less
and don’t waste time at work talking
with their colleagues about the
weather or the upcoming football
games.
Recently, Walgreens published
objective performance data about
cause of heart disease will eventually
be identified.
“Studies like this one help provide
new pathways for scientists to
investigate in more detail,” said coauthor
Thomas Quertermous, MD,
a Stanford professor of medicine.
“The promise is in providing better
insights into the pathophysiology
of this disease.”
This meta-analysis study built
upon previous research published
last year in Nature Genetics. In
that study, investigators examined
2.5 million SNPs (genetic variants
at specific locations on individual
chromosomes) from 14 GWA
studies, which led to the discovery
of 13 new gene regions associated
with heart disease. Investigators
looked at data from the complete
genetic profiles of more than
22,000 people of European descent
with heart disease and more than
64,000 healthy people.
In the new study, scientists
used all information from last
year’s study then added to it, reach-
light source will be a huge benefit
to your house plants. A simple
feather duster will suffice, or a
gentle rub with a soft towel will get
the job done without damaging the
surface of the leaves.
Watering the house plants can
be challenging in the winter time,
as the circulation of air in your
home may not be as efficient as
in the summer months when you
have the windows open and fans
running. Give the house plants
a drink of water - preferably rain
water or distilled water only when
they are slightly dry. Too much
water, the plants may develop root
rot, and too little water, the plants
will wither and die. If you have
been watering with city water or
deep well water, adjust your method
to more plant friendly means.
City water contains fluoride and
chlorine while deep well water
may contain an over abundance of
natural salts and minerals. Both
can have adverse effects on tropical
plants and cacti.
its autism and disability employment
project in its distribution
centers. The workers with disabilities
performed as well as or better
than other workers on all performance
measures, had significantly
lower turnover, and usually required
only minimal, inexpensive
accommodations. We have heard
the same thing from AMC Theatres
and other companies making
efforts to hire individuals with
autism. With informed accommodations
and modest support from
co-workers, those with autism
represent a dependable, untapped
labor pool.
Q: What do you see as the most
pressing issue facing individuals
with ASD, especially with regard
to employment?
A: We still have much to learn
about the best ways to support
people with autism in the workforce.
State vocational rehabilitation
agencies are starting to make
important changes in how they
provide services for autism. National
autism advocacy groups
and researchers, who have always
focused on children with ASD, are
starting to include employment
and adult issues in their areas of
activity. In addition, a handful of
ing 41,513 patients with heart disease
and 65,919 control patients.
To genetically fingerprint a large
number of subjects in a very costeffective
manner, the researchers
used a specialized genetic chip that
incorporated only the top signals
from the original meta-analysis of
the initial 14 GWA studies.
Quertermous is the principal
Stanford investigator of the Stanford/Kaiser
ADVANCE study of
heart disease, which was part of
the consortium involved in the research.
Other Stanford authors include
Joshua Knowles, MD, PhD,
instructor of cardiovascular medicine;
and Ben Goldstein, PhD,
senior biostatistician. The Stanford/Kaiser
ADVANCE study was
conducted in collaboration with
co-authors at the Kaiser Division
of Research in Oakland and the
HudsonAlpha Genome Sequencing
Center (formerly the Stanford
Human Genome Center).
A complete list of the funding
institutions and co-authors of the
Lastly, since we cannot garden
outside, it is the perfect opportunity
to re-pot root bound house
plants during the winter. The rule
to remember is: re-plant in a container
one size larger than the original
root bound plant. Use a good
all-purpose potting soil from your
garden center, and forget the rocks
or shards in the bottom of the new
pot. It is unnecessary to add volume
to the bottom of the pot, it
only collects mold and will make
the pot heavier to move.
Show your house plants some
extra care during the beginning
of December, and when the guests
visit during the holidays they will
know a gardener lives within!
For questions or comments,
please call the University of Missouri,
Extension Troy office, 636-
528-4613 or email us at lincolnco@
missouri.edu. If leaving a voice
message please allow a Lincoln
County Master Gardener a day or
two to return your call as we are a
volunteer organization.
enlightened companies—often because
of parent advocates in upper
management—are starting to hire
workers with autism and promote
the idea to other companies. Autism
self-advocate groups also are
working with businesses to promote
employment issues.
Time and again, I have heard
that employers or companies that
make systemic changes to accommodate
people with autism not
only get productive employees
with autism, they also find their
existing “non-autistic” workers
like and use the accommodations
and become more effective employees.
Everyone benefits.
Standifer is a clinical associate
professor in the Disability Policy
and Studies Office in MU’s School
of Health Professions. For disability
service providers, he has
authored two resources: Adult Autism
and Employment: A Guide
for Vocational Rehabilitation Professionals
and The Handbook of
Disabilities. Standifer organized
the Autism Works National Conference,
which brought together
disability employment services
providers, employers, and autism
advocates to discuss employment
issues facing adults with ASD.
Heart disease...............................................................CONTINUED FROM PAGE 9
work is available in the Nature Genetics
paper. None of the Stanford
authors reported any conflicts of
interests related to this paper.
Information about Stanford’s
Department of Medicine, which
also supported the Stanford portion
of the work, is available at
http://medicine.stanford.edu.
Get your marketing in
Focus
314-713-2400
Email:
focusnewsmo
@gmail.com
THE FOCUS NEWS Friday, December 7, 2012
It is terrible when, as one fancies
themselves a writer, finding
no words to occupy the white
space, leaving blank a sheet of paper
or computer screen; absent of
its proper little black “New Times
Roman” 12 pt font letters, which
create the words, then phrases into
paragraphs, and so on. It should
be said too, in the difficulty of not
only attaining those words, but
in expounding with them in to
“what” subject matter? Not that the
lack of subject matter proves elusive
to said writer, as a plethora of
possibilities remain in the choosing,
but, as to which one should
therein, one begin to chew away at?
Just what subject should one begin
to create word weavings, creating a
craftily woven written instrument
that permeates the minds of the
readers (the writer’s beloved audience)
to bring about deep meaning
and thought provoking enlightenment
to each page written; those
perfect words which need expressively
spoken and brought to this
unique audience. After all, it is this
audience which fuels a “so called”
writer, their frenzied folly and fodder
to expound their internal…
sometimes eternal (whichever applies)
so called, “wisdom”.
Yet, in this too, is the possibility
that whatever subject is found approved
to deliberate and expound
14
Poetizing Life:
Let a "Word" Be &
Poetry in Motion ® 2013
By: Heather Farrar
on, the writer may find a lack of
substance or worse yet, the dreaded
writers “block”. The writer’s ego,
too, can cause the pen to freeze or
silence the keyboard of its cadent
clacking, as an overwhelming feeling
takes control of said writer,
discouraging them to believe they
may not be knowledgeable enough
to speak on such matters of chosen
subject. For which then takes place
a lesson in humility (humility never
comes easy to this writer) who
then engulfs their soul and spirit
into the chosen subject through tutor
and lesson. An ounce of knowledge
becomes as liquid courage to
a writers effort; once more igniting
forth letter after letter the forward
motion to word- phrase- paragraph
in fervent written record on
their chosen subject.
No, the life of a writer is life
changing, in hope and desire to
the audience to which they direct
their voice and ever discovered by
that of the writer. The fear, there in,
may not be in the words, audience,
or subject, but in the silence of any
good combination that might well
be expressed in writing, lest each
word had not been given flight
through their airing, letting each
“word” be.
To this airing there is grateful
joy!
Spread of AIdS
........................................................................CONTINUED FROM PAGE 9
diagnosed, they can be counseled
about changing their behaviors to
help prevent the spread of the disease.
Observational studies have
shown that people who know their
HIV status are more likely to take
precautions, for instance, by using
condoms, avoiding sex with sex
workers or having sex in exchange
for money or drugs, the task force
noted.
In 2006, the federal Centers
for Disease Control recommended
routine voluntary screening for everyone
aged 13 to 64, but allowed
them to opt out of testing. Many
other professional groups, such as
the American College of Physicians,
also advise routine patient
screening. Yet universal screening,
followed by treatment, has never
been achieved in this country.
Owens said the task force did
consider the potential harms of
screening and testing. One potential
drawback is a false-positive test
result, though the screening test is
highly accurate, so this risk is quite
small, he said. Treatment also may
carry side effects, including the
possibility of a slightly increased
risk for heart problems. Stigmatization
and labeling are other
potential downsides of testing, he
said.
But on balance, he said, “We
feel the benefits are so substantial
that they far outweigh the potential
harm.”
He said the task force also emphasized
the importance of prevention:
“The best way to reduce
HIV disease and death is to avoid
becoming infected. So we want
people to take actions to reduce
their risk behaviors, such as using
safe sex practices and avoiding
other behaviors that put them at
risk.”
The task force’s draft recommendation
has been posted for
public comment on its website at
http://www.uspreventiveservicestaskforce.org.
Comments can be
submitted from Nov. 20 to Dec.
17 at www.uspreventiveservicestaskforce.org/tfcomment.htm.
The
panel then will finalize its recommendations,
which will be published
in the Annals of Internal
Medicine.

Prenatal Intervention
........................................................................CONTINUED FROM PAGE 8
stones for sensory, motor skill, and
muscle tone development in the
first three weeks of life.
"In our earlier work, we showed
that treating the mice during pregnancy
could prevent developmental
delay as assessed with milestones,"
Dr. Spong said. "In this
study, we showed that treatment
with NAP and SAL not only puts
the animals on a typical developmental
trajectory, it also improves
their ability to learn."
For the current study, pregnant
mice received injections of
the two protein fragments starting
eight days after conception. This
is equivalent to the end of the first
trimester in a human pregnancy.
The researchers tested the
learning skills of the mice when
the animals reached adulthood.
The mice were placed in a tank of
water on a clear platform. The tank
had symbols on each wall that the
mice could use to orient themselves.
Researchers then placed
the mice directly in the water and
timed how long it took them to locate
the platform. With repeated
trials, the mice become more adept
at the task and take less time to
reach the platform.
Over five days of testing, the
researchers found that the time
spent searching for the platform
decreased substantially for all
groups except the mice with the
extra copy of chromosome 16 that
were not treated with NAP and
end of the year
CleArAnCe
• diamond buildings • built by mennonites
• delivery within 50 miles included
All storAge buildings on lot
10-14% off
outside storage Available for boats & Campers
Get your marketing in
Focus
314-713-2400
Email:
focusnewsmo
@gmail.com
SAL in the womb.
The research of Dr. Spong’s
team is part of an NIH-wide focus
on Down syndrome outlined in a
2007 Down syndrome research
plan. The plan highlights research
priorities for the field, including
establishing a Down syndrome
patient registry, which was announced
Oct. 25, 2012.
About the Eunice Kennedy
Shriver National Institute of Child
Health and Human Development
(NICHD): The NICHD sponsors
research on development, before
and after birth; maternal, child,
and family health; reproductive
biology and population issues; and
medical rehabilitation. For more
information, visit the Institute's
website athttp://www.nichd.nih.
gov/.
This message has been sent to you as a service of
WINFIELD FOLEY
FIREFIGHTERS
ASSOCIATION
$ 5.00
Off
Any $ 30.00 Purchase
511 N. Hwy 47 • warreNtoN
www.amogflorist.com
636-456-9334 • 888-321-4050
Monday - Saturday 9:00 to 5:30pm
Expires 12/31/12
Dial 911
for all
emergencies
HUGE JACKPOTS
WEEKLY + $3,600 JACKPOT
payouts at every event
(if no one wins it will be higher next week)
DERBYS & PULL TABS AVAILABLE TOO!
2 Progressives every Bingo • Hot Ball & Texas Blackout
#5 Winfield Plaza
#5 Next Win� to Hickman’s eld Plaza IGA
Every Wednesday Night
Next Doors to Open Hickman's at 4:30 p.m. IGA
Every Wednesda
Wednesday Bingo Night begins & Last at Saturday 6:30 p.m. Of Each Month.
36”
Doors
Flat
Open At
Screen
4:30pm & 4:00pm
tV GiVeaway
On Saturday.
at the end oF the year.
Beginning Bingo Begins Beginthe
At 6:30pm 1st week & 6:00pm of novemeber.
On Saturday
Free entry with each admission ticket
received for attending bingo.
Progressive Jackpot Food & Beverages is up to $3,000 available Food Call & 636-56 636-566-6621
Beverages Available Call 636-566-6621
For current jackpot information and
For
bad
current
weather
jackpot
closings
information &
this week and that is in addition to
bad weather closings
the $3,600 in regular payouts.
or visit our website www.wffpd.org
or visit our website www.wffpd.org
Oil Changes • Brakes
State InSpectIonS
Not just oil... Pennzoil!
$ 8.00 off oil change
Present Coupon At Time Of Service.
Offers cannot be combined. Expires: 12/31/12
*Excludes all trucks & early bird oil change discounts.
50 King Drive, Troy, MO • 636-528-1718
QuailQuest.com
Your Quest for Quail Begins Here
Larry & Teresa Cook
Quail Hunting Guides / Owners
HC 68 Box 7320
Hartshorn, MO 65479
Home: 417-932-4012
QuailQuest@gmail.com
Web: QuailQuest.com
Hunting dogs also available for purchase
Brenda Sue’s
101 E. Main WARRENTON, MO| 636-456-7066
Full Line Costume Shop! | www.brendasues.com
25 All Christmas Decor
% OFF
Make Urban accentS YOUr DeStinatiOn FOr
a One OF a kinD ShOpping experience
636-239-1887
1085 Washington Square
Washington, MO distinctive home decor & boutique
Relaxed atmospheRe...
...affoRdable menu
all you eat
Fried chicken
all day Sunday $9.99
With Mashed Potatoes
& Vegetable
1/2 OFF
CHILDREN’S
COSTUME
When you buy 1 of equal or lesser
value. With this coupon. Exp. 10/16/10
Christmas Costumes for sale & for rent.
We also have ugly Christmas sweaters!
Costume Sales
& Rentals
$ 5.00 off
any food puRchase
of $30 oR moRe
One coupon per table. Not valid with any other offer. Expires 12/31/12.
892 Cherry Street
Troy, MO 63379
(636)528-9999
www.cherrystreetgrill.com

A&E Page
The Handmade
marketplace craft
Show: A collaboration
of Local Artists on Etsy
St. Charles Community College
is hosting a Handmade Marketplace
Craft Show on Saturday,
Dec. 15, between 9 a.m. and 4 p.m.
in the College Center Gym. The
event is free and open to the public.
This unique craft show features
a collaboration of local artists and
their crafts found on Etsy, an ecommerce
site where people can
buy or sell items ranging from art,
photography, jewelry, quilts, crafts,
toys or anything in between.
Attendees will have the op-
portunity to develop their creative
side by watching demonstrations
on how to make their own items.
Attendees will discover fine,
handmade items, watch demonstrations
and knockout some
holiday shopping – all at the same
time. Food will be available for
purchase.
For more information about
The Handmade Marketplace Craft
Show: A Collaboration of Local
Artists on Etsy, contact Tina Sieker
at 636-922-8314 or tsieker@stchas.
edu.
Scc Young People’s
Theatre Will Present
Irving berlin’s ‘White
christmas’ dec. 14-16
Cutline: Sarah York (left), Troyer Coultas, Brooke Villhard
and Sean Gundersen.
The Young People’s Theatre of
St. Charles Community College
will present Irving Berlin’s “White
Christmas” Dec. 14-16 in the Donald
D. Shook Fine Arts Building
theater on the SCC campus.
The show will be performed at
7 p.m. Friday-Saturday, Dec. 14-
15, and 2 p.m. Saturday-Sunday,
Dec. 15-16. Tickets are $8 for all
ages. The campus is located at 4601
Mid Rivers Mall Drive in Cottleville.
Based on the timeless film, the
musical features 17 well-known
Irving Berlin songs, such as “Blue
Skies,” “I love a Piano,” “How Deep
is the Ocean” and “White Christmas.”
Set after World War II, characters
Bob Wallace and Phil Davis
relentlessly pursue a busy and
highly successful song and dance
career. Their lives change completely
when they meet and follow
two sisters to Vermont for the
holidays. This romantic and uplifting
musical comedy is fun for the
whole family. Audience members
will celebrate the holidays with
wonderful songs and dancing and
relive this traditional favorite.
YPT cast members from St.
Peters include Cadence Bippen,
Carlin Bippen, Sam Bippen, Sean
Faszold, Jenni Fischer, Thomas
Fischer, Luke Gottreu, Eric Hahn,
Jessica Kahn, Grace Kotraba,
Daniel Larabee, Zoe Meier, Rain
Northrop, Alex Pendel, Andrew
Salmo, Jaide Sarchenko, Braden
Stille, Mitchell Stille, Tessa Stille,
Alyssa Winkeler, Teegan Winkler,
Jacob York and Sarah York.
YPT cast members from
O’Fallon include Alia Aaron, Joelle
Aaron, Dani Baker, Amanda
Blythe, Samuel Bottini, Jack De-
ters, Abbey Feldt, Jacob Feldt,
Seth Gleason, Taryn Herbst, Grayson
Jostes, Danny Kellett, Becca
Krauss, Kati Scheffer, Brooke Villhard,
Becca Waligurski, Curtis
Waligurski and Brendan Woods.
YPT cast members from St.
Charles include Brock Birkner,
Daniel Borrelli, Zac Cary, Ali
Gibbs, Kelly Gleeson, Anabel
Gundersen, Sean Gundersen,
Anna Johnston, Emma Koehler,
Abby Turner, Emily Turner.
YPT cast members from
Dardenne Prairie include Jana
Bowman, Troyer Coultas, CJ Powell
and Richie Powell.
YPT cast members from Lake
St. Louis include Jimmy Coogan,
Joey Coogan and Grace Thornton.
Additional YPT cast members
include Brynn Laspe of St. Louis,
Kylie McCance of Wentzville and
Allison Parks of Wentzville.
The Young People’s Theatre is a
performing arts program for kids
and their families produced by the
SCC Corporate and Community
Development Division.
For more information or tickets,
call 636-922-8233, or visit
www.stchastickets.com.
Irving Berlin’s “White Christmas”
is based upon the Paramount
Pictures Film, written for the
screen by Norman Krasna, Norman
Panama and Melvin Frank.
Music and lyrics are by Irving Berlin
and the book is by David Ives
and Paul Blake. The original stage
production was directed by Walter
Bobbie, with orchestrations by
Larry Blank and vocal and dance
arrangements by Bruce Pomahac.
Irving Berlin’s “White Christmas”
is presented through special arrangement
with R&H Theatricals.
THE FOCUS NEWS Friday, December 7, 2012
Events Calendar
FRIDAY, DECEMBER 7
• The Living Christmas Story at First Baptist Church, 6955
Hwy 100 in Washington from 6:00-8:30 p.m. Dec. 7-9. Experience
the sights and sounds of Bethlehem on the night Jesus
was born. 636-239-2432 or www.showmefaith.org
• Keeping Christmas at Boone Monument Village, 15226
Boone Monument Road, (between hwy D and hwy 47 south
of Marthasville, next to the Boone-Bryan cemetery) Tour the
ca 1800 Bryan log cabin, the brick Dickhaus-Stemme home,
the Mellien log cabin and Devereaux school, all from the mid-
1800's. Stroll the candlelit pathways of this 200 year old farm
where Daniel and Rebecca Boone once walked. Admission:
age 12+ $8.00, under 12 $5.00. For more information call 636-
359-6175 or email cschoppenhorst@yahoo.com . December 7,
8, 14 & 15 (6-9 pm) and December 9 (1-4 pm)
• DaVinci Machines II: The Australian Exhibition at 800
Market St., Ste. 100 St. Louis (across from City Gardens, one
block north of Busch Stadium) through May 2013. With over
60 machines on display, the collection features replicas of the
major and most striking inventions of the original Renaissance
Man. 314-241-1241 or info@discoverdavinci.com
• DJ Skate at St. Peters Rec-Plex, 5200 Mexico Rd. from 7:00-
9:00 p.m. The lights turn down and the music turns up as DJ
Funk Master plays the latest hits along with special requests.
Games, prizes and fun for all ages. Rec-Plex admission (plus
skate rental, if needed). Be sure to bring a lock to lock up your
belongings.
• Pearl Harbor Day Ceremony at St. Peters Cultural Arts
Centre, 1 St. Peters Centre Blvd. from 10:00-11:00 a.m., a special
remembrance ceremony to honor the more than 2,400
men and women who lost their lives in the Dec. 7, 1941, Japanese
attack at Pearl Harbor, Hawaii.
• Santa at the Downtown Amtrak station in Washington at
5:00 p.m. Greet Santa and Mrs. Claus as they get off the train,
then join them in the depot for photos. 636-239-1743
• Great Beast Feast Wild game Dinner at Stone Hill Winery
in Hermann at 7:00 p.m. benefits Leukemia and Lymphoma
Society. 800-909-9463
• Christmas Walk in Augusta December 7 & 14 from 5:00-
10:00 p.m. Over 1,500 luminaries light your way through
historic Augusta. A complimentary trolley shuttle through
town to visit shops and antique stores, wineries and brewery,
restaurants and food stands. There is Christmas caroling and
a giant Christmas tree at a local church. Enjoy the challenge
of gathering items from all the shops in the holiday scavenger
hunt and turn your answers in at the history museum and register
for prizes from local merchants. The town square features
a horse drawn carriage ride around the heart of town, a toasty
bon fire with chestnuts roasting, marshmallows toasting, and
Santa Claus. Free. 636-228-4005 or augusta-chamber.org
• Historical Society Old Jail Tour in Troy from 5:00-8:00 p.m.
during Night of 1000 Stars. Children must be accompanied by
an adult and no food or drink is allowed.
• Know the 10 Signs of Alzheimer’s Disease and Dementia
Program at 9370 Olive Blvd., St. Louis reviews the warning
signs and discusses the importance of early detection as well
as treatment options, information and support and ways to reduce
the risk factors for Alzheimer’s. Preregistration required:
www.alz.org/stl, or 800-272-3900.
• Candlelight Tour December 7, 8, 14, 15 at Daniel Boone
Home, 1868 Highway F, Defiance at 6:00 p.m. Night has fallen,
the stars shine above, and thousands of candles illuminate a
world on the edge of the frontier. Step back to the 19th century
and witness Christmas as it was celebrated in the past. Learn
about different cultures and traditions while enjoying period
decorations and hot wassail.
• Tour of Gowns Charity Wedding Gown Sale at Millennium
Hotel, 200 S. 4th Street, St. Louis 5:00-9:00 p.m. (admission)
& Saturday 10:00 a.m.-8:00 p.m. (free). Designer wedding
gowns and bridal accessories up to 85% off retail price. Hundreds
of designer, couture, and gently-used gowns from $99 to
$4,000, all styles in sizes 0-30 to match any wedding theme or
budget. Layaway with up to 12 month payment terms. Visa,
MasterCard, Discover, American Express and debit cards.
20% discount for active military and reserves (proof of service
required). 877-721-4673 or www.bridesabc.org. http://
bridesagainstbreastcancer.org to register/order tickets. Proceeds
provide education, information, & outreach to people
impacted by cancer.
• Spirit of Christmas Dinner & Dance at Progress Park Center
in Wentzville from 6:00-9:00 p.m. for ages 50+. Enjoy a
delightful evening with music, dancing, a visit from Santa, a
great dinner and door prizes! Pre-register (636-332-9236) at
least a week in advance. Minimum registration needed.
• Celebration of Lights at Fort Zumwalt Park (Interstate 70 to
the Bryan Road exit) in O'Fallon through December 31. Sundays
& Tuesday-Thursday: 6:30-9:00 p.m. Friday and Saturday:
6:30-10:00 p.m. Drive-through dazzling holiday one mile
display of over one million lights depicting holiday scenes.
Walk-through night December 14, train ride Mondays by reservation
(no vehicles). 636-379-5614 or www.ofallon.mo.us
• Christmas Traditions at Historic St. Charles Downtown
District through December 24 celebrates with caroling, chestnut
roasting, authentically costumed Santas from around
the world, and a Santa Parade each weekend. Candlelight
shopping and dining Wednesday, Friday, and Saturday evenings
until 9:00 p.m., special activities beginning at 6:30
p.m. Free; some activities charge a fee. 800-366-2427, www.
stcharleschristmas.com
• Holiday Night Lights at Wentzville Rotary Park Friday-Sun-
16
day 6:00-10:00 p.m. through Dec. 9. One-mile drive through
more than 35 lighted holiday scenes.
• "The Velvet Years 1965-67: Warhol's Factory" at Foundry
Art Centre, 520 N. Main Center, St. Charles from 10:00 a.m.
to 5:00 p.m. through December. 1965-67 photographs depict
Andy Warhol’s studio, the Factory, when he was emerging as
a prominent visual artist and avant-garde filmmaker. foundryartcentre.org.
SATURDAY, DECEMBER 8
• Kristkindl Markt at Hermannhof Festhalle from 10:00 a.m.
to 4:00 p.m. Saturday and Sunday evokes the ambience of European
Christmas markets. Free!
• German Bakery in Hermann Saturday 10:00 a.m. to 4:00
p.m. & Sunday noon to 4:00 p.m. features traditional holiday
baked goods, music and mulled cider. Tours of the newly renovated
museum rooms are free for children 5 and under. Free
admission to bakery and gift shop.
• St. George Rectory Tour in Hermann Saturday and Sunday
11:00 a.m. to 8:00 p.m. From wine cellar to attic, the historic
Franciscan friary sparkles with lavish holiday displays, including
nearly 100 themed Christmas trees. Freewill offering.
• Weihnachtfest at Deutscheim State Historic Site in Hermann
Saturday and Sunday 10:00 a.m. to 4:00 p.m. Experience
a 19th-century German Christmas celebration Sample traditional
German Christmas cookies as you learn about German
Christmas customs.
• Say Cheese Wine Trail December 8-9. Sip and sample wine
and cheese pairings at seven stops on the scenic Hermann
Wine Trail.
• Columbia Handbell Ensemble at St. George Catholic
Church in Hermann at 7:30 p.m.
• Breakfast with Santa at Rec-Plex South, 5250 Mexico Road,
St. Peters from 8:30-10:30 a.m. Santa will join children ages
2-8 for a delicious continental breakfast, crafts, and their favorite
Christmas songs. Parents and grandparents, join in on
the fun for breakfast with Santa and make some unforgettable
memories. Don’t forget to bring a camera. Advance registration
by Dec. 3 at ext. 1400 at 636.939.2FUN.
• Breakfast with Santa at Progress Park Center in Wentzville
from 8:30-9:30 a.m. Have you been naughty or nice? Join
Santa for breakfast followed by a craft and fun games. Each
child will have individual time with Santa for parents to take
pictures. Craft and games are targeted for children ages 2 &
up; younger children will need help from a parent. All participants
need to be pre-registered by Dec. 3. Children under 2
are free, but need to register. 636-332-9236
• Bake Sale at St. Peter's UCC, 20 E. Fifth St. Washington from
8:30 a.m. to 12:00 p.m. 636-239-6176
• Your Picture with Santa at Farmers' Market on Main Street
in Washington from 10:00 a.m. to 1:00 p.m. Saturdays before
Christmas. $5 (bring a nonperishable food item for Loving
Hearts and receive $1 off).
• Community Festival of Trees at St. Peter's UCC Church, 20
E. Fifth St. in Washington from 3:00-7:00 p.m. Dec. 8-9. 50+
uniquely themed trees decorated by community groups, businesses
and families. Canned good donations accepted. Special
weekday tours by appointment.. 636-239-6176
• Kaysie Marie Pearl Dinner/Silent Auction Benefit at
American Legion Post 349 in Clarksville from 11:00 a.m. to
4:00 p.m. Catfish, spaghetti, potato salad, drinks and desserts.
Please send donations to Collier's Funeral Home.
• Hoop Shoot Contest for boys and girls ages 8-13 at Claude
Brown Intermediate Gym. Registration begins at 9:30 a.m.
with the competition starting at 10:00 a.m. Contestants must
bring a birth certificate or passport for age verification. Winners
will advance to the district, state, regional and national
competitions. 636-295-5610
• Santa at Foley City Hall, 617 Elm Street from 1:00-3:00 p.m.
• Kindling of Missouri’s Tallest Menorah at 6655 Delmar
Blvd. at 7:00 p.m. The festival of Chanukah (or Hanukkah)
celebrates the ancient victory of the Maccabees, a small band
of Jewish fighters, against their Greek Assyrian oppressors,
in their struggle for religious freedom in the Land of Israel.
In commemoration of these events, the Menorah is kindled
on each night of Chanukah, with one light being added each
night. In contemporary America, Chanukah is a time for
families to celebrate together by lighting a home ‘Menorah’
(candelabra), playing ‘Dreidel’ (a Chanukah top) and sharing
holiday foods, including the traditional ‘Latkes’ (shallow fried
potato pancakes).
• Tours of Maternity Suites at SSM DePaul Health Center at
10:00 a.m. 1-hour tour 4th Thursdays and 2nd Saturdays except
holidays. Register no later than Tuesday before 4th Thursday
or Thursday before 2nd Saturday. Registration required at
314-776-3627.
• Visit With Santa at Progress Park Center in Wentzville.
Breakfast 8:30-9:30 a.m. Pizza Lunch 11:00 a.m.-
12:00 p.m. for ages up to 12. Eat, then enjoy a craft, games
and visit with Santa. Pre-register at least one week, minimum
registration needed. 636-332-9236
• 1980’s Trivia Night at Progress Park Center in Wentzville.
Doors open 6:30 p.m., Trivia at 7:00 p.m. Ten rounds with ten
questions each. Mulligans available for purchase. Teams of 8,
ages 21+. Pre-register at least one week, minimum registration
needed. 636-332-9236

A&E Page
• Mannheim Steamroller Christmas at The Fox in St. Louis
at 4:00 p.m. and 8:00 p.m. Grammy Award winner Chip Davis
has created a show that features beloved Christmas music
along with dazzling multimedia effects performed in an intimate
setting. Don't miss this ultimate holiday tradition from
the #1 Christmas music artist in history!
• Second Saturday Servants Christian men, women and
youth help those in need. 636-528-7935 or PO Box 44, Troy,
MO 63379
• All You Need Is Love Food Pantry at 59 Auburn Church
Road, 5 miles east of Silex, from 10:00 a.m. to 12:30 p.m. Saturdays.
573-485-6996 or northlincolnparish.com
• Washington Farmers Market on Main Street from 8:00
a.m. to 2:00 p.m. Saturdays through December.
SUNDAY, DECEMBER 9
• Ambassadors of Harmony and Our Lady of Snows Tour
starts in the west parking lot at City Hall, One St. Peters Centre
Blvd. The 157-member barbershop harmony style group
performing at Touhill Performing Arts Center. Afterwards,
tour the Shrine's millions of holiday lights in “The Way of
Lights” display. $95/person includes motor coach transportation,
admission, lunch. 636-397-6903, ext. 1624
• Historic Washington Holiday House Tour from 4:00-8:00
p.m. Visit six beautiful historic homes filled with holiday
cheer. Email slavabowman@yahoo.com
• Christmas Bell Choir Concert at St. Peter's UCC, 20 E.
Fifth St. Washington at 7:00 p.m. 636-239-6176
• Troy Garden Club Holiday Home Tour from 1:00-4:00 p.m.
A holiday tea at noon at Lincoln County Council on Aging,
1380 Boone Street in Troy will have Britton House "Preachers
& Politicians" and other organizations cookbooks for sale.
This year's participants: Zion United Church of Christ, Larry
and Lee Ann Henebry, Dr. Mary Ingmire, Karl and Linda
Bickel, Faye Pavelka. Tickets at Peoples Bank & Trust, Wood
Street in Troy and Troy Flower Shop, 650 E Cherry Street and
Garden Club members. 636-528-8528
• Moscow Mills Lions Club All-You-Can-Eat Breakfast
from 7:30 a.m. to noon.
• Gram's Christmas Tea Party and Fashion Show at 463 E
Hwy 47, Troy from 3:00-4:00 p.m. Tea, juice and finger-foods,
fashion show, door prizes and vendor booths! 636-528-7030
or 636-462-3000. Admission.
• Central Missouri Honor Flight Ball at Holiday Inn Executive
Center, 2200 I-70 Drive SW, Columbia beginning at 5:30
p.m. for a lovely evening in a relaxed military-ball atmosphere
to help raise money to send veterans to Washington, DC to
visit their memorials. The evening includes all the trappings
of a military ball, fabulous banquet meal, cash bar and special
toasts, big band music from the Memories Orchestra, singing
and dancing. Dress: Military/Civilian Formal or Semi-
Formal. Tickets: email centralmissourihonorflight@yahoo.
com or 573-256-1930.
• Second Sunday Breakfast at Our Lady of Lourdes, 1000
Madison Ave, Washington from 8:00-11:30 a.m. 636-239-
3520. No breakfast in June.
MONDAY, DECEMBER 10
• Warren County Health Matters Lunch at 101 Mockingbird
Lane, Suite 100, Warrenton from 12:00-1:00 p.m. Wellness
Challenge winner announced, fun & games, party food. Bring
your favorite cookies or cookie bars to share and an inexpensive
wrapped gift to play a game! RSVP at 636-456-7474 or
email pprivett@warrencountymo.org
• Holiday Night Lights Walk Through Evening at Rotary
Park in Wentzville from 6-:00-8:00 p.m. Enjoy a special evening
strolling along the beautiful lighted displays and then
visit with Santa. $3 per person (under 6 is free.) 636-332-9236
• Healthy Meal Replacement Program Orientation at SSM
DePaul Wellness Center Mondays from 6:00-7:00 p.m. and
Tuesdays Noon-1:00 p.m. in December. Attend a free orientation
to learn the five success variables needed to lose weight,
diet options and how important physical activity really is.
877-477-6954 to register.
• Divorce Care and Divorce Care 4 Kids at The Crossings
Church, 115 May Rd, Wentzville (behind Kohl's) from 6:30-
8:30 p.m. Mondays for adults and children ages 6-12, a safe
place to express your feelings. 314-285-5721, www.thecrossingschurch.com
TUESDAY, DECEMBER 11
• Show-Me- Chanukah at the Lazaroff Chabad Center, 8124
Delmar Blvd. in St. Louis at 5:30 p.m. The program will include
a Menorah lighting Ceremony, hot latkes (fried potato
pancakes – a Chanukah favorite) and Chanukah themed children’s
crafts.
• How to Help Domestic Violence Victims Workshop at
Woman's Place, 7372 Marietta Ave. St. Louis from 6:00-9:00
p.m. 2nd Tuesdays for friends and family members to learn
how to best support victims, encourage safe choices and identify
"red flags" of potentially lethal escalation. Learn the "Ten
Things to Do or Say" and the "Five Things to Never Do or
Say". How to address perpetrators is also covered. Registration
required at 314-645-4848. www.womansplacestl.org
• New Beginnings Support Group in Tucker Conference
Room on the 2nd floor at Mercy Hospital, 901 E. Fifth St. in
Washington from 6:00-7:30 p.m. 2nd Tuesdays offers information
and support, guest speaker, question/answer session
and group discussion to people who are considering or have
undergone bariatric surgery. Family members welcome. 636-
239-8878 or bariatricinfo@mercy.net.
• Breast Cancer Support Group in the Tucker Room on the
2nd floor, Mercy Hospital, 901 E. Fifth St. in Washington at
7:00 p.m. 2nd Tuesdays offers education and social networking
resources to people with breast cancer and their loved
ones. 636-432-3527
• Come Play with Us! at Progress Park Gym in Wentzville
from 10:00-11:00 a.m. Tuesdays for age 5 & under. They provide
balls, hula hoops and other play toys for you and your
little one to enjoy playing together. Parents are required to
remain with their child(ren) and encouraged to play with the
little ones. Just show up and pay the fee ($1) per person.
WEDNESDAY, DECEMBER 12
• Holiday Family Evenings at Foundry Art Centre, 520 N.
Main Center, St. Charles from 5:30-7:30 p.m. Dec. 12 & 19.
Create holiday crafts with your family to escape the winter
weather and make some memories! Enjoy hot cocoa and cookies,
too. Free! 636-255-0270 or www.foundryartcentre.org
• CPR and First Aid Training at 7:30 a.m. to give you confidence
to respond in an emergency situation with the skills
that can save a life. Whether you work with children or want
training for employees there is an American Heart Association
program for you. This training compliments adult learning
styles with hands-on practice and real life scenarios. Certification
cards last for two years. To learn more, Community
Outreach at 636-528-3300.
• Show-Me- Chanukah at Chesterfield Mall on the first level
at the entrance near Dillard’s at 6:30 p.m. features a Chanukah
hunt, live music, doughnuts and a Menorah lighting ceremony.
• Infant Care Class at SSM DePaul Health Center at 6:30
p.m. Topics: bathing, feeding, nutrition, taking temperatures,
immunizations, growth and development. 314-776-3627 to
register.
• Hip and Knee Replacement Class at May Center Room
B, SSM DePaul Health Center at 2:00 p.m. Mary Reedy, 314-
630-3803 to register or information.
• Weight Loss Surgery Seminar at May Center, SSM DePaul
Health Center at 7:00 p.m. to learn the benefits and risks of
bariatric surgery, types of bariatric surgery and who is considered
a surgical candidate. 314-SSM-DOCS to register.
• Shhhh! It’s A Secret at Progress Park in Wentzville from
6:00-7:00 p.m. (ages 3-5) and 7:15-8:15 p.m. (ages 6-8). Create
3 one-of-a-kind gifts to give. At the conclusion of class they
will be wrapped and ready to give! Pre-register at least one
week, minimum registration needed. 636-332-9236
• Wicked, The Untold Story of the Witches of Oz at the Fox
Theater in St. Louis through January 6. How these two grow
to become the Wicked Witch of the West and Glinda the
Good makes for "the most complete and completely satisfying
new musical in a long time" (USA Today).
• Pre-diabetes: Lower Your Risk Class in the Education Department,
Mercy Medical Building, 851 E. Fifth St. in Washington
helps identify risks for pre-diabetes and offers methods
to reduce them. Pre-diabetes occurs when blood glucose
levels are higher than normal but not high enough to be called
diabetes. Adopting healthy lifestyle habits can help prevent
the progression of this disease. To register, 636-239-8248.
• Free Mammograms and Breast Screenings in Suite 100 at
Mercy Medical Building, 851 East Fifth Street in Washington
to qualifying women 40-64 years of age with little or no health
insurance. Registration required, 314-251-6400 or 877-569-
6400.
• Man to Man at Barnes-Jewish St. Peters Hospital Health-
Wise Department, 10 Hospital Dr., St. Peters from 6:00-7:30
p.m. 2nd Wednesdays. This American Cancer Society support
group is for men diagnosed with prostate cancer at any stage.
Mercy Moms Connect in the Family Waiting Room, 4th floor,
Mercy Hospital, 901 E. Fifth St. in Washington from 10:00-
11:00 a.m. 2nd Wednesdays, an informal gathering of new
parents and their children led by maternal child educator.
Sessions feature guest speakers and topics relevant to parenting.
636-239-8645
• Breastfeeding Support Group in Family Waiting Room
(4th floor) at Mercy Hospital, 901 E. Fifth St. in Washington
from 11:00-11:45 a.m. on 2nd and 4th Wednesdays offers new
and expectant moms education and assistance with breastfeeding
led by certified educators and a lactation consultant.
636-239-8645
THURSDAY, DECEMBER 13
• Mighty Hearts and Lungs Support Group at SSM DePaul
Health Center from Noon to 1:00 p.m. For patients and family
members coping with cardiac and pulmonary health issues;
learn how to better manage your condition for a healthier life.
314-344-6023 to register or more information.
• Holiday Night Lights Drive Through at Rotary Park in
Wentzville through Dec. 30 daily from 6:00-10:00 p.m. Onemile
drive through more than 35 lighted holiday scenes.
• WomenHeart of St. Charles County in the HealthWise
Center Cardiology Center (hospital entrance B), Suite 117,
Professional Building I, 6 Jungermann Circle in St. Peters
from 6:30-7:30 p.m. 2nd Thursdays is dedicated to promoting
women’s heart health through advocacy, education and
patient support.
• Pilates at WingHaven Medical Building, Suite 80, 5551
WingHaven Blvd., O'Fallon from 7:00-8:00 p.m. Thursdays.
636-379-0092, www.stlukes-stl.com
To list your event, email: focusnewsmo@gmail.com
THE FOCUS NEWS Friday, December 7, 2012
17
Scc Partners With
St. charles county Arts
council to Offer
Non-credit classes
St. Charles Community College
is partnering with the St.
Charles County Arts Council to
offer a variety of non-credit continuing
education classes for the
community at the Lillian Yahn
Gallery in the Arts Council headquarters
located in Winghaven
(O’Fallon), Mo.
“This partnership is mutually
beneficial, and will enhance the
ability of both organizations to
meet their goal of providing the
community with high quality arts
and cultural classes and experiences,”
said Tina Seiker, SCC associate
dean for continuing education.
Classes begin in January 2013
and include the following:
• Art and Wine Extravaganza!
• Experiential Drawing: Mark
Making With a Mixed Media Approach
• Creative Photos With Beautiful
Butterflies
• Arts Funding – Making It
Big! • iPad for the Visual Artist
• Watercolor, Composition,
Color and Creativity! (Ages 7-12)
• Yoga 4 Teens and Tweens
(Ages 7-12)
• Small Scale Sculpture Art
The classes vary in cost, from
$39-$99. For more information or
to register for classes, visit stchas.
edu/learnforlife or call 636-922-
8233.
“We’re excited to work with
SCC and hope the partnership will
bring more awareness to the arts in
the St. Charles community,” said
Bruce Howard, president of the
St. Charles County Arts Council
board.
The partnership provides SCC
the opportunity to offer a broad variety
of classes in art, music, writing,
performance and other personal
enrichment classes to people
of all ages at an off-campus location.
Classes will be held at Lillian
Yahn Gallery, 7443 Village Center
Drive, O’Fallon, MO 63368.
The St. Charles County Arts
Council is an umbrella organization
that advocates for all arts and
artists in St. Charles County. Their
purpose is to encourage and develop
the arts by creating public
awareness of county arts activities,
to foster communication among
visual, performing and literary arts
groups, to work for common goals
in the interest of community art
development, to sponsor exhibits,
workshops, art shows and events
and to aid individual members
and organizations in their efforts
to create art awareness and activities
in the county.
The SCC Continuing Education
Department promotes lifelong
learning by developing classes
that encourage the community to
pursue their talents and passions.
For more information, visit www.
stchas.edu/learnforlife.
St. Charles Community College
is a public, comprehensive
two-year community college with
associate degrees and certificate
programs in the arts, business, sciences
and career-technical fields.
SCC provides workforce training
and community-based personal
and professional development as
well as cultural, recreational and
entertainment opportunities. For
more information, visit www.stchas.edu.
More Traffic = More Money
Drive More business to your store
Advertise in The Focus
Call Now!
314-713-2400
focusnewsmo@gmail.com
Ceramic Bisque
Christmas Tree &
Bisque Christmas
Ornaments
Ready to Paint OR Painted &
Ready to Go Home With You!
Your Source for Clay & Ceramic Supplies
Car-jo ceramics
321 MONROE STREET, TROY, MO
636-528-4463

News Page
Vitro Fertilization
........................................................................CONTINUED FROM PAGE 8
the chromosomal composition of
those four-celled embryos predicted
by their previous method to be
successful. The 75 human embryos
used in the study were originally
intended for use in IVF. They were
donated for research by infertile
couples to the Stanford RENEW
Biobank. They are unusual in that
they were frozen within hours of
fertilization. Clinicians normally
monitor the development of fertilized
embryos for three to five days
in an attempt to identify those that
are the best candidates for transfer.
Those remaining are then frozen
for later use — either in future
IVF cycles for that couple, or as
research tools to learn more about
human development. However,
the clinics visited by the couples
who donated the embryos for this
study supported earlier freezing as
a standard practice.
The researchers thawed the
embryos and monitored the developmental
milestones with
time-lapse photography as they
progressed over the course of two
days to approximately the four-cell
stage. They found that only 53 of
the original 75 embryos progressed
beyond the one-cell stage. They
then dissembled the 53 embryos
into individual cells, analyzed the
chromosomal content of each cell,
and compared the findings with
each embryo’s predicted chance of
success. A normal human embryo
has 23 pairs of chromosomes; each
pair contains one chromosome
from each parent.
“We found that, although the
parameters we defined earlier do
very well in predicting blastocyst
success,” said Reijo Pera, “about
50 percent of those with normal
developmental timing have the
wrong number of chromosomes.”
That is, even though they would
likely go on to become blastocysts,
they were unlikely to result in
healthy pregnancies.
The researchers found that
they could increase their chances
of picking an embryo with the
correct number of chromosomes
by combining their previous parameters
with an analysis of a perplexing
embryonic process called
fragmentation, which is thought to
possibly represent a breakdown of
cellular components within an embryo.
(Although embryos exhibiting
fragmentation are currently
avoided during IVF, some can
result in successful pregnancies.)
However, there’s not been a clear
link between fragmentation and
chromosomal number until now.
There is also some evidence that
fragmentation can occur during
natural human conceptions, indicating
that it is not just associated
with IVF.
“We were surprised to find that
several embryos had cells that were
missing one or more chromosomes
with numbers that were not consistent
with known types of errors,”
said first-author Chavez. Added
Reijo Pera, “We later realized that
some of these chromosomal errors
were being generated through the
process of fragmentation.”
The researchers concluded
that, although neither developmental
timing nor the presence of
fragmentation was a foolproof way
to pick a healthy, chromosomally
intact embryo, a combination of
the two approaches appears much
more likely to be successful.
“We found that using the cellcycle
parameters in conjunction
with fragmentation dynamics —
such as timing, degree and the
persistence and resorption of fragments
— rather than the incidence
of fragmentation itself was most
predictive of embryo chromosom-
al status,” said Chavez.
The research also pinpointed
a somewhat surprising possible
source of at least some lethal errors:
the father’s contribution. Although
the sperm’s role is usually
written off as a straightforward delivery
of presumably unsullied genetic
information, Reijo Pera and
her colleagues found that it may
not be so simple.
“We learned that about 20 percent
of human embryos are normal,
about 25 percent are carrying
errors introduced by the egg, and
the remaining 55 percent have errors
that could be caused by either
the sperm or the egg,” said Reijo
Pera. “And yet, currently, there is
almost no screening process: if a
sperm is moving vigorously in a
laboratory dish, it’s considered to
be a suitable candidate for IVF.”
Other Stanford co-authors include
postdoctoral scholar Jinnuo
Han, PhD, and Berry Behr, MD,
professor of obstetrics and gynecology
and director of Stanford’s in
vitro fertilization laboratory. They
collaborated with researchers from
Auxogyn Inc., a privately held
Menlo Park-based company. Auxogyn
was founded by Reijo Pera
and Behr, who hold stock in the
company. Auxogen has licensed
the previous technology described
in the Nature Biotechnology paper
from Stanford.
The study was funded by the
March of Dimes and the California
Institute for Regenerative
Medicine.
Information about Stanford’s
Department of Obstetrics & Gynecology,
which also supported the
work, is available at http://obgyn.
stanford.edu/.
Willow
Willow
This young lady is stunning from nose
to tail. Although, life may not have
always been fair to her she chooses
to start each day positive and happy.
Willow is cautious and has not had a
lot of life experiences but guarantee
that won’t slow her down. She simply
needs your commitment of time
and love. So, what are you doing the
visit rest www.petfinders.com
www.petfinders.com.
of her life? She is currently being
fostered in a private home for more
details contact 573-340-DOGS. The
Montgomery City Animal Shelter is
open daily from 9-12 or for a complete
listing of pets that are available please
visit www.petfinders.com
THE FOCUS NEWS Friday, December 7, 2012
19
• cLASSIFIEdS •
DRIVERS-OTR:
Growing Fleet!
GREAT MILES, PAY,
BENEFITS, HOMETIME!
Clean MVR, 2yrs exp,
CDL-A.
Karen: 636-584-6073
www.climateexpress.com
DRIVERS:
Home Daily, Part-time,
Great Paying Multiple
Shift Openings!
Dedicated E. St. Louis
Account
WERNER ENTERPRISES
1-800-397-2324
RSVP Teams and Solo's
$$4000.00 Sign on.
$$ Weekly Home-Time
Pre-Pass Provided!!
No Touch Freight.
Class A CDL. Hogan.
CALL SANDRA
866-275-8840
WWW.HOGAN1.COM
This young lady is stunning from nose to tail. Although, life may not
have always been fair to her she chooses to start each day positive Focus
and
happy. Willow llow is cautious and has not had a lot of life experiences but
guarantee that won‛t slow her down. She simply needs your commitment
of time and love. So, what are you doing the rest of her life? She
is currently being fostered in a private home for more details contact
573-340-DOGS. DOGS. The Montgomery City Animal Shelter is open daily
from 9-12 12 or for a complete listing of pets that are available please
All Bisqueware on
the Shelf:
Buy one get one 1/2 off
other
Discounts
& Bargains
in Store
Tuesdays
7:00 - 9:00PM
Saturday 9 AM-12 PM
Classes - Supplies - Bisque - Slip
1573 Sugar Grove Rd., Troy, MO • 636-462-6498
cancer Screening
........................................................................CONTINUED FROM PAGE 9
tion," he said adding that the improvements
come after a decade
in which women's cancer screening
rates have remained stagnant.
Even so, 4.5 million low-income
women will remain uninsured
and could have great difficulty
affording cancer screening
costs on their own, the authors
Get your marketing in
314-713-2400
Email:
focusnewsmo
@gmail.com
said. They note that such women
will continue to need the help provided
by the Center for Disease
Control and Prevention's breast
and cervical cancer screening
program, which offers uninsured,
poor women access to screening
tests and even referrals for followup
care if a cancer is found.
REAL ESTATE
Pre-Owned HOmes witH Land in
Hawk POint, and FOLey, mO areas.
Priced tO seLL and wOnt Last.
Financing is avaiLabLe On tHese
HOmes. caLL us tOday FOr
Pictures and mOre inFO!!
636-462-5345
dOubLewide On Lake
near warrentOn
For Sale in Senior Mobile Home Park with 25 acre lake on culde-sac.View
of lake from inlet to dam. Home is 24 x 36 with 2
Bedrooms, 2 full baths, 3 ceiling fans, 10 x 20 porch that has
$3,500 in new insulated windows & door. Large shed, gas BBQ
grill, siding, roof and carport 10 yrs. old, many flowers & shade
trees. Swimming pool, horseshoe pits, club house with two
slate pool tables & more. $22,000 or make offer.
636-456-1906
December Special!
4 Bedroom 2 Bath Living Room &
Family Room 1,812 sq ft Home!
$55,900 includes Delivery, Set Up,
Skirting, A/C
Best Prices Guaranteed!
american Family Home Sales
551 John Deere Dr., Troy MO 63379
636-366-4505 / 800-316-3513
Mon-Sat 9am - 5pm
Sunday by appointment
SERVICES
Cornerstone Excavating LLC
Commercial & Residential
All Types of Custom
Excavation Service
CALL TODAY!
State Licensed Septic Installer
Site Work • Grading • Clearing • Storm Debris
Sanitary, Electric & Waterline Installation/Repair
Excavation for Footings & Retaining Walls
Kyle Throgmorton
Mobile: 636-358-1505
"The CDC's breast and cervical
cancer program serves as a
lifeline helping hundreds of thousands
of uninsured women get
the screening services they need,"
said Paula Lantz, PhD, professor
and chair of the SPHHS Department
of Health Policy and a noted
women's health expert. Moreover,
almost all states offer Medicaid
coverage for cancer treatment
if they are diagnosed under the
CDC program.
Office: 636-528-5565
Fax: 636-528-4772

we will PAy more thAn mArket PriCe
WE BUY GOLD
for your Gold This Month Only!
we will PAy more thAn mArket PriCe
old sterlinG silver Gold & PlAtinum
Gold & silver
Coins
• Pre-1964 Dimes/Quarters/Half Dollars
• Silver Dollars Coins • US Gold Coins
• .999 • Pre-1964 Pure Gold, Dimes/Quarters/Half Silver Bars & Coins Dollars
• Silver Dollars • US Gold Coins
• Krugerrand/Maple Leafs/Liberties/Sovereigns
PRE-OWnEd TRuckS, SuVS & cARS STARTIng AT $ 2,995
‘76 CHeVy impaLa
350 V-8 engine, automatic, white, one family
vehicle, always garaged, Flowmaster
exhaust, autometer gauges, 142,xxx miles
$ 6,200
‘07 CHrysLer 300
Very clean, well maintained, mostly highway
miles, 3.5L, 6 cylinder automatic, blue,
140,xxx miles
$ 6,995
Jewelry for your - Gold Scrap This Gold Month - Coins Only!
• .925 & Sterling Silver Jewelry
• Mexico Silver
• Sterling Flatware & Service Pieces
• Sorry, • .925 no & Silver Sterling Plated Silver Items Jewelry
old sterlinG silver
• Mexico Silver
• Sterling Flatware & Service Pieces
• Sorry, no Silver Plated Items
Gold & silver
• .999 Pure Gold, Silver Bars & Coins
• Krugerrand/Maple Leafs/Liberties/Sovereigns
‘01 saTurn sL2
Fully loaded, 1.9L, 4 cylinder automatic,
silver, 105,xxx miles
$ 4,495
‘00 CHrysLer Voyager
SE, Seating for 7, 3.3L, 6 cylinder automatic,
green, 126,xxx miles
$ 3,495
‘05 suzuki Forenza s
Very clean, one owner, 81,xxx miles, 2.0L,
4 cylinder, manual transmission, black,
81,xxx miles
$ 5,495
‘96 saTurn sL2
Great fuel economy, 1.9L, 4 cylinder
automatic, red, 135,xxx miles
$ 3,495
• Dental Gold • Jewelers Sweeps
Antique • Old Charm & estAte Bracelets • Old ChainssAle
Jewelry
diAmonds
• Large Diamonds • Old European Cut Diamonds
• Large • Diamond Diamonds Bracelets, • Old European Earrings, Cut Pendants Diamonds
• Unwanted • Diamond Wedding Bracelets, & Earrings, Engagement Pendants Rings
• Platinum Diamond Rings • Antique Diamond Rings
• Cameos & Animal Jewelry
Pins • Old Gold & Platinum Watches
• Platinum Diamond Rings • Antique Diamond Rings
• 1940’s Retro Jewelry • Art Deco Jewelry
• Cameos & Animal Pins • Old Gold & Platinum Watches
• Gemstone Jewelry • Broken Antique Jewelry
‘05 kia opTima
One owner, fully loaded, 2.7L, 4 cylinder
automatic, radiant red, 49,xxx miles
$ 8,995
‘05 ToyoTa Camry
LE, very clean, one owner, excellent fuel
economy, 2.4L, 4 cylinder automatic,
metallic grey, 110,xxx miles
$ 8,995
• Broken Jewelry • Scrap Gold & Platinum
• Old Mountings • Band & Class Rings
• Dental Gold • Jewelers Sweeps
• Old Charm Bracelets • Old Chains
Antique & estAte sAle
diAmonds
• Unwanted Wedding & Engagement Rings
Gold & PlAtinum
• Broken Jewelry • Scrap Gold & Platinum
• Old Mountings • Band & Class Rings
• 1940’s Retro Jewelry • Art Deco Jewelry
• Gemstone Jewelry • Broken Antique Jewelry
All stAr PAwn And Jewelry
1005 S. Callahan Rd • Wentzville, MO
1005 S. Callahan Rd • Wentzville, MO
P. 636-887-0075 P. 636-887-0075 F. F. 636-887-0361 • www.allstarpawn.net
‘03 suzuki XL7
4x4, 2.7L, 6 cylinder automatic, white,
133,xxx miles
$ 5,995
‘02 Ford F-150
Supercrew, 4x4, XLT, FX4 off road package,
5.4 L, V-8, black, 106,xxx miles
$ 10,995
Scan with your smart
phone for more inventory
‘04 Honda odyssey
EXL, very clean, fully loaded, rear DVD
entertainment, power sliding doors, 3.5L, 6
cylinder automatic, silver, 162,xxx miles
$ 5,700
‘06 dodge Viper srT-10
Convertible, 8.3L, 10 cylinders, 6 speed
manual. Corsa exhaust, K&N filters, 3M
clear bugshield, 4,6xx miles.
$ 56,995
WE OffER IndOOR/OuTdOOR bOAT And RV STORAgE STARTIng AT $25/mOnTH
www.I70AutoSports.com • 636-456-0304
Exit 193 - Warrenton - East of Hwy 47 on the I-70 South Outer Road