PART 1 — GENERAL (GEN)

AIP MACAO GEN 0.1-101 FEB 2007PART 1 — GENERAL (GEN)GEN 0.GEN 0.1 PREFACE1. Name of the publishing authorityThe AIP Macao is published by the Civil Aviation Authority.2. Applicable ICAO documentsThe AIP Macao is prepared in accordance with the Standards and Recommended Practices(SARPs) of Annex 15 to the Convention on International Civil Aviation and theAeronautical Information Services Manual (ICAO Doc 8126). Charts contained in the AIPare produced in accordance with Annex 4 to the Convention on International CivilAviation and the Aeronautical Chart Manual (ICAO 8697). Differences from ICAOStandards, Recommended Practices and Procedures are given in subsection GEN 1.7.3. The AIP structure and established regular amendment interval.3.1. The AIP structureThe AIP forms part of the Integrated Aeronautical Information Package, details of whichare given in subsection GEN 3.1.The AIP is made up of three Parts, General (GEN), En-route (ENR) and Aerodromes (AD),each divided into sections and subsections as applicable, containing various types ofinformation subjects.3.1.1. Part 1 — General (GEN)Part 1 consists of five sections containing information as briefly described hereafter.GEN 0. — Preface; Record of AIP Amendments; Record of AIP Supplements; Checklistof AIP pages; List of hand amendments to the AIP; and the Table of Contents toPart 1.GEN 1. Territorial regulations and requirements — Designated authorities; Entry, transitand departure of aircraft; Entry, transit and departure of passengers and crew;Entry, transit and departure of cargo; Aircraft instruments, equipment and flightdocuments; agreements / conventions; and Differences from ICAO Standards,Recommended Practices and Procedures.GEN 2. Tables and codes — Measuring system, aircraft marking, holidays; Abbreviationsused in AIS publications; Chart symbols; Location indicators; List of radionavigation aids; Conversion tables; and Sunrise/Sunset tables.Civil Aviation Authority – Macao, China AMDT 14

GEN 0.1-201 FEB 2007AIP MACAOGEN 3. Services — Aeronautical Information Services; Aeronautical Charts; Air TrafficServices; Communication Services; Meteorological Services; and Search andRescue.GEN 4. Charges for aerodromes / heliport and air navigation services — Aerodrome /heliport charges; and Air Navigation services charges.3.1.2. Part 2 — En-route (ENR)Part 2 consists of seven sections containing information as briefly described hereafter.ENR 0. — Table of Contents to Part 2.ENR 1. General Rules and Procedures — General rules; Visual flight rules; Instrumentflight rules; ATS airspace classification-, Holding, approach and departureprocedures; Radar services and procedures; Altimeter setting procedures; Regionalsupplementary procedures; Air traffic flow management; Flight planning;Addressing of flight plan messages; Interception of civil aircraft; Unlawfulinterference; Air traffic incidents.ENR 2. Air Traffic Services Airspace — Detailed description of Flight informationregions (FIR), Terminal control areas (TMA); and other regulated airspace.ENR 3. ATS Routes — Detailed description of ATS routes; Area navigation routes;Helicopter routes; Other routes; and En-route holding.Note : other types of routes which are specified in connection with procedures for trafficto and from aerodromes/heliports are described in the relevant sections andsubsections of Part 3 - Aerodromes.ENR 4. Radio Navigation Aids/Systems — Radio navigation aids-en-route; Specialnavigation systems; Name-code designators for significant points; andAeronautical ground lights - en-route.ENR 5. Navigation Warnings — Prohibited, restricted and danger areas; Military exerciseand training areas; Other activities of a dangerous nature; Air navigation obstacles- en-route; Aerial sporting and recreational activities; and Bird migration and areaswith sensitive fauna.ENR 6. En-route charts.3.1.3. Part 3 — Aerodrome (AD)Part 3 consists of four sections containing information as briefly described hereafter.AD 0. — Table of Contents to Part 3.AD 1. Aerodromes/Heliports — Introduction - Aerodrome/heliport availability; Rescueand fire fighting services and snow plan; Index to aerodromes and heliports; andGrouping of aerodromes/heliports.AD 2. Aerodromes — Detailed information about aerodromes, listed under 24subsections.AD 3. Heliports — Detailed information about heliports (not located at aerodromes).AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 0.1-301 FEB 20073.2. Regular amendment intervalRegular amendments to the AIP will be issued once every 28 days. The publication dateswill be on each of the AIRAC publication dates.4. Service to contact in case of detected AIP error or omissionsIn the compilation of the AIP, care has been taken to ensure that the information containedtherein is accurate and complete. Any errors and omissions which may nevertheless bedetected, as well as any correspondence concerning the Integrated Aeronautical Package,should be referred to:Director of Airport Infrastructure & Air NavigationCivil Aviation AuthorityAlameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, ChinaAFTN Address: VMMCYAYITelephone Number: (853) 2851 1213Fax Number: (853) 2833 8089Civil Aviation Authority – Macao, China AMDT 14

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 0.2 - 102 JAN 97GEN 0.2 RECORD OF AIP AMENDMENTSAIP AMENDMENTPublication Date InsertedNR date inserted byAIRAC AIP AMENDMENTPublication Effective InsertedNR/Year date date by0102030405060708091011121314151617181920212223242526Civil Aviation Authority of Macau

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 0.3 - 102 JAN 97GEN 0.3 RECORD OF AIP SUPPLEMENTSAIP section(s)CancellationNR/Year Subject affected period of validity recordCivil Aviation Authority of Macau

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 0.4 - 112 MAR 2009GEN 0.4 CHECKLIST OF AIP PAGESPART 1 - GENERAL (GEN)GEN 00.1-1 01 FEB 070.1-2 01 FEB 070.1-3 01 FEB 070.2-1 02 JAN 970.3-1 02 JAN 970.4-1 12 MAR090.4-2 12 MAR090.5-1 02 JAN 970.6-1 05 APR 010.6-2 05 APR 010.6-3 02 JAN 97GEN 11.1-1 01 FEB 071.1-2 27 MAR 081.1-3 01 FEB 071.2-1 01 FEB 071.2-2 01 FEB 071.2-3 01 FEB 071.2-4 01 FEB 071.2-5 01 FEB 071.2-7 01 FEB 071.2-8 01 FEB 071.3-1 01 FEB 071.3-2 01 FEB 071.3-3 01 FEB 071.3-4 01 FEB 071.4-1 01 FEB 071.4-2 01 FEB 071.4-3 27 MAR 081.5-1 01 FEB 071.6-1 01 FEB 071.6-2 01 FEB 071.6-3 01 FEB 071.6-4 01 JAN 091.6-5 01 JAN 091.7-1 01 JAN 091.7-2 01 JAN 091.7-3 01 JAN 091.7-4 01 JAN 091.7-5 01 JAN 09GEN 22.1-1 27 MAR 082.1-2 27 MAR 082.2-1 02 JAN 972.2-2 02 JAN 972.2-3 02 JAN 972.2-4 02 JAN 972.2-5 02 JAN 972.2-6 02 JAN 972.2-7 02 JAN 972.2-8 02 JAN 972.2-9 05 APR 012.3-1 30 JUL 982.4-1 25 JUL 022.5-1 02 JAN 972.6-1 02 JAN 972.6-2 02 JAN 972.7-1 30 JUL 982.7-2 02 JAN 97GEN 33.1-1 27 MAR 083.1-2 01 FEB 073.1-3 01 FEB 073.1-4 01 FEB 073.1-5 01 FEB 073.1-6 01 FEB 073.1-7 25 JUL 023.2-1 01 FEB 073.2-2 01 FEB 073.2-3 01 FEB 073.3-1 01 FEB 073.3-2 01 FEB 073.4-1 27 MAR 083.4-2 01 FEB 073.4-3 10 FEB 003.4-4 10 FEB 003.4-5 10 FEB 003.4-6 02 JAN 973.5-1 01 FEB 073.5-2 01 FEB 073.5-3 02 JAN 973.5-4 02 JAN 973.5-5 24 JUN 043.5-6 24 JUN 043.6-1 01 FEB 073.6-2 01 FEB 073.6-3 25 JUL 023.6-5 10 FEB 00GEN 44.1-1 01 FEB 074.1-2 01 FEB 074.1-3 01 FEB 074.1-4 01 FEB 074.2-1 02 JAN 97PART 2 - EN-ROUTE (ENR)ENR 00.6-1 02 JAN 970.6-2 02 JAN 97ENR 11.1-1 01 FEB 071.1-2 01 FEB 071.2-1 01 FEB 071.2-2 01 FEB 071.3-1 01 FEB 071.4-1 05 APR 011.5-1 24 JUN 041.5-2 24 JUN 041.5-3 24 JUN 041.6-1 02 JAN 971.7-1 10 FEB 001.7-2 30 JUL 981.8-1 02 JAN 971.9-1 02 JAN 971.10-1 27 MAR 081.11-1 01 FEB 071.12-1 02 JAN 971.13-1 02 JAN 971.14-1 01 FEB 071.14-2 01 FEB 071.14-3 01 FEB 071.14-4 01 FEB 071.14-5 01 FEB 071.14-7 31 JUL 971.14-8 31 JUL 971.14-9 31 JUL 971.14-10 13 FEB 971.14-11 13 FEB 97ENR 22.1-1 10 FEB 002.2-1 02 JAN 97ENR 33.1-1 02 JAN 973.2-1 02 JAN 973.3-1 02 JAN 973.4-1 01 JAN 093.4-2 01 FEB 073.4-3 05 APR 013.4-3A 01 FEB 073.4-4 05 APR 013.4-5 05 APR 013.5-1 02 JAN 973.6-1 02 JAN 97Civil Aviation Authority – Macao, China AIRAC AMDT 01/09

GEN 0.4 - 212 MAR 2009ENR 44.1-1 02 JAN 974.2-1 02 JAN 974.3-1 02 JAN 974.4-1 02 JAN 97ENR 55.1-1 02 JAN 975.2-1 02 JAN 975.3-1 02 JAN 975.4-1 02 JAN 975.5-1 02 JAN 975.6-1 02 JAN 97ENR 66-1 02 JAN 97PART 3 - AERODROMES (AD)AD 00.6-1 02 JAN 970.6-2 02 JAN 970.6-3 02 JAN 97AD 11.1-1 27 MAR 081.1-2 27 MAR 081.1-3 27 MAR 081.2-1 02 JAN 971.3-1 02 JAN 971.4-1 02 JAN 97AD 22 - VMMC - 1 27 MAR 082 - VMMC - 2 01 FEB 072 - VMMC - 3 01 FEB 072 - VMMC - 4 01 FEB 072 - VMMC - 5 01 FEB 072 - VMMC - 6 01 FEB 072 - VMMC - 7 01 FEB 072 - VMMC - 8 01 FEB 072 - VMMC - 9 01 FEB 072 - VMMC - 10 01 FEB 072 - VMMC - 11 01 FEB 072 - VMMC - 12 01 FEB 072 - VMMC - 13 01 FEB 072 - VMMC - 14 01 FEB 072 - VMMC - 15 01 FEB 072 - VMMC - 16 01 FEB 072 - VMMC - 17 24 JUN 042 - VMMC - 18 24 JUN 042 - VMMC - 19 02 JAN 972 - VMMC - 50 03 MAY 012 - VMMC - 51 03 MAY 012 - VMMC - 52 27 MAR 082 - VMMC - 53 27 MAR 082 - VMMC - 54 02 JAN 972 - VMMC - 55 02 JAN 972 - VMMC - 56 02 JAN 972 - VMMC - 57 01 JAN 092 - VMMC - 57 A 12 MAR092 - VMMC - 58 01 FEB 072 - VMMC - 59 01 FEB 072 - VMMC - 60 08 MAY 082 - VMMC - 60 A 08 MAY 082 - VMMC - 60 B 08 MAY 082 - VMMC - 61 12 MAR092 - VMMC - 62 12 MAR092 - VMMC - 62 A 08 MAY 082 - VMMC - 62 B 08 MAY 082 - VMMC - 62 C 08 MAY 082 - VMMC - 62 D 08 MAY 082 - VMMC - 62 E 12 MAR092 - VMMC - 62 F 12 MAR092 - VMMC - 62 G 08 MAY 08AIP MACAO2 - VMMC - 62 H 08 MAY 082 - VMMC - 62 I 08 MAY 082 - VMMC - 62 J 08 MAY 082 - VMMC - 63 01 FEB 072 - VMMC - 64 01 FEB 072 - VMMC - 64 A 25 JUL 022 - VMMC - 64 B 01 JAN 092 - VMMC - 65 27 MAR 082 - VMMC - 66 27 MAR 082 - VMMC - 67 27 MAR 082 - VMMC - 68 27 MAR 082 - VMMC - 69 08 MAY 082 - VMMC - 70 08 MAY 082 - VMMC - 71 31 OCT 022 - VMMC - 72 03 MAY 012 - VMMC - 73 03 MAY 012 - VMMC - 74 03 MAY 01AD 33 - 1 02 JAN 973 - 2 02 JAN 973 - 3 02 JAN 973 - 4 02 JAN 973 - 5 02 JAN 973 - 6 02 JAN 973 - 7 02 JAN 973 - 8 02 JAN 973 - 9 02 JAN 973 - 10 02 JAN 973 - 11 02 JAN 973 - 12 01 JAN 093 - 13 01 JAN 09AIRAC AMDT 01/09Civil Aviation Authority – Macao, China

AIP MACAU GEN 0.5 - 102 JAN 97GEN 0.5 LIST OF HAND AMENDMETS TO THE AIPAIP page(s)Introduced by AIPaffected Amendment text Amendment NRCivil Aviation Authority of Macau

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 0.6-105 APR 2001GEN 1GEN 0.6 TABLE OF CONTENTS TO PART 1NATIONAL REGULATIONS AND REQUIREMENTSPageGEN 1.1 Designated authorities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 1.1 - 1GEN 1.2 Entry, transit and departure of aircraft . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 1.2 - 1GEN 1.3 Entry, transit and departure of passengers and crew . . . . . . . . . . . . . . .GEN 1.3 - 1GEN 1.4 Entry, transit and departure of cargo . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 1.4 - 1GEN 1.5 Aircraft instruments, equipment and flight documents . . . . . . . . . . . . .GEN 1.5 - 1GEN 1.6GEN 1.7Summary of Macau Special Administrative Region laws, regulationsand international agreements / conventions . . . . . . . . . . . . . . . . . . . . . .GEN 1.6 - 1Differences from ICAO Standards, Recommended Practicesand Procedures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 1.7 - 1GEN 2 TABLES AND CODESGEN 2.1 Measuring system, aircraft markings, holidays . . . . . . . . . . . . . . . . . . .GEN 2.1 - 1GEN 2.1.1 Units of measurement . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.1 - 1GEN 2.1.2 Time system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.1 - 1GEN 2.1.3 Geodetic reference datum . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.1 - 2GEN 2.1.4 Aircraft markings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.1 - 2GEN 2.1.5 Public holidays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.1 - 3GEN 2.2 Abbreviations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.2 - 1GEN 2.3 Chart symbols . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.3 - 1GEN 2.4 Location indicators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.4 - 1GEN 2.5 List of radio navigation aids . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.5 - 1GEN 2.6 Conversion tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.6 - 1GEN 2.7 Sunrise/Sunset tables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 2.7 - 1Civil Aviation Authority - Macau, China AMDT 09

GEN 0.6-205 APR 2001AIP MACAUGEN 3SERVICESGEN 3.1 Aeronautical Information Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.1 - 1GEN 3.1.1 Responsible service . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.1 - 1GEN 3.1.2 Area of responsibility of AIS . . . . . . . . . . . . . . . . . . . . .GEN 3.1 - 1GEN 3.1.3 Aeronautical publications . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.1 - 1GEN 3.1.4 AIRAC system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.1 - 6GEN 3.1.5 Pre-flight information service at aerodrome . . . . . . . . . .GEN 3.1 - 6GEN 3.2 Aeronautical charts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.2 - 1GEN 3.2.1 Responsible services . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.2 - 1GEN 3.2.2 Maintenance of charts . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.2 - 1GEN 3.2.3 Purchase arrangements . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.2 - 1GEN 3.2.4 Aeronautical chart series available . . . . . . . . . . . . . . . . .GEN 3.2 - 1GEN 3.2.5 List of aeronautical charts available . . . . . . . . . . . . . . . .GEN 3.2 - 3GEN 3.2.6 Index to world aeronautical chart . . . . . . . . . . . . . . . . . .GEN 3.2 - 3GEN 3.2.7 Topographical charts . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.2 - 3GEN 3.2.8 Corrects to charts not contained in AIP . . . . . . . . . . . . .GEN 3.2 - 3GEN 3.3 Air traffic services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 1GEN 3.3.1 Responsible service . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 1GEN 3.3.2 Area of responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 1GEN 3.3.3 Types of services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 1GEN 3.3.4 Co-ordination between the operator and ATS . . . . . . . .GEN 3.3 - 2GEN 3.3.5 Minimum flight altitude . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 2GEN 3.3.6 ATS Unit address list . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.3 - 2GEN 3.4 Communication services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.4 - 1GEN 3.4.1 Responsible service . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.4 - 1GEN 3.4.2 Area of responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.4 - 1GEN 3.4.3 Types of service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.4 - 2GEN 3.4.4 Requirements and conditions . . . . . . . . . . . . . . . . . . . . .GEN 3.4 - 2GEN 3.5 Meteorological services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 1GEN 3.5.1 Responsible meteorological offices . . . . . . . . . . . . . . . .GEN 3.5 - 1GEN 3.5.2 Area of responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 1GEN 3.5.3 Meteorological observations and reports . . . . . . . . . . . .GEN 3.5 - 2GEN 3.5.4 Types of services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 3GEN 3.5.5 Notification required from operators . . . . . . . . . . . . . . .GEN 3.5 - 3GEN 3.5.6 Aircraft reports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 3GEN 3.5.7 VOLMET service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 4GEN 3.5.8 SIGMET service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.5 - 4GEN 3.5.9 Other automated meteorological services . . . . . . . . . . . .GEN 3.5 - 4GEN 3.5.10 Tropical cyclone and strong monsoon winds and localwinds effects on the approaches to MIA . . . . . . . . . . . .GEN 3.5 - 5AMDT 09Civil Aviation Authority - Macau, China

AIP MACAU GEN 0.6-302 JAN 97GEN 3.6 Search and rescue . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 1GEN 4.GEN 3.6.1 Responsible service . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 1GEN 3.6.2 Area of responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 1GEN 3.6.3 Types of service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 1GEN 3.6.4 SAR agreements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 3GEN 3.6.5 Conditions of availability . . . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 3GEN 3.6.6 Procedures and signals used . . . . . . . . . . . . . . . . . . . . . .GEN 3.6 - 3CHARGES FOR AERODROMES/HELIPORTS ANDAIR NAVIGATION SERVICES . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 4 - 1GEN 4.1 Aerodrome charges . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 4.1 - 1GEN 4.2 Air navigation services charges . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .GEN 4.2 - 1Civil Aviation Authority - Macau, China

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 1.1-101 FEB 20071. Civil AviationGEN 1. TERRITORIAL REGULATIONS AND REQUIREMENTSGEN 1.1 DESIGNATED AUTHORITYDesignated Authority: Civil Aviation AuthorityPostal Address: Alameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, ChinaAFTN Address:VMMCYAYXTelephone Number: (853) 2851 1213Fax Number: (853) 2833 80892. Meteorology2.1. The Meteorological Authority in Macao is conferred to “Serviços Meteorológicos eGeofisicos”.Designated Authority: Serviços Meteorológicos e GeofisicosPostal Address: Caixa Postal 93Rampa de ObservatórioTaipa Grande, TaipaMacao, ChinaAFTN Address:VMMCYMYATelephone Number: (853) 8986214, 8986243Fax Number: (853) 2885 05572.2. The Meteorological Service for civil aviation are provided by Airport MeteorologicalOffice, a division of “Serviços Meteorológicos e Geofisicos”, located at the TerminalBuilding of Macao International Airport.Postal Address:Centro Meteorológico para a AeronauticaRoom 3016, Terminal BuildingMacau International AirportPAC ON, TaipaMacao, ChinaAFTN Address:VMMCYMYXTelephone Number: (853) 2886 1111 EXT 2508,(853) 2886 2203 (duty forecaster)Fax Number: (853) 2886 0017Civil Aviation Authority – Macao, China AMDT 14

GEN 1.1-227 MAR 20083. CustomsDesignated Authority:Postal Address:Serviços de AlfândegaTelephone Number: (853) 2855 9944Fax Number: (853) 2837 1136Rua S. Tiago da Barra Doca D. Carlos ISW BarraMacao, ChinaAIP MACAO4. ImmigrationDesignated Authority:Postal Address:Serviço de Migração de MacaoRua de ShangaiEdif. da Associação Comercial de Macao9° andarMacao, ChinaTelephone Number: (853) 2857 7338, 2878 5210Fax Number: (853) 2858 00895. HealthDesignated Authority:Postal Address:Telephone Number: (853) 2871 3104Fax Number: (853) 2871 31056. Airport chargesDesignated Authority:Postal Address:AFTN Address:VMMCYDYATelephone Number: (853) 88982829Fax Number: (853) 2886 2222Serviços de SaúdeEstrada do Visconde de S. JanuárioCentro Hospitalar Conde São JanuárioMacao, ChinaDirector of the Macao International AirportADA — Administration of Airports Ltd.Macau International AirportTaipaMacao, ChinaAMDT 15Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.1-301 FEB 20077. Agricultural quarantineDesignated Authority:Instituto para os Assuntos Cívicos e MunicipaisServiços de Inspecção e SanidadePostal address: Av.Almeida Ribeiro, No. 163Macao, ChinaTelephone Number: (853) 2851 5952Fax Number: (853) 2851 93038. Aircraft accidents investigationDesignated Authority: President of Civil Aviation AuthorityCivil Aviation AuthorityPostal address: Alameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, ChinaAFTN Address:VMMCYAYATelephone Number: (853) 2851 1213Fax Number: (853) 2833 8089Civil Aviation Authority – Macao, China AMDT 14

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 1.2 - 124 JUN 2004GEN 1.2 ENTRY, TRANSIT AND DEPARTURE OF AIRCRAFT1. GeneralAll flights to or from Macau International Airport and through Macau Aerodrome TrafficZone (ATZ) of Responsibility shall comply with the requirements of any law or instructionhaving the force of law, for the time being in force, relating to air navigation and airtransport.2. Scheduled air servicesThe Air Navigation Regulation of Macau requires that scheduled air services to and fromMacau by foreign registered aircraft may not be operated except under and in accordancewith the provisions of an operating permit which has been granted by the President of theCivil Aviation Authority.2.1 Procedure for airline diversion to People’s Republic of China airportsAirlines that want to use alternate airports situated in the People’s Republic China(PRC)shall make an application to Air Traffic Management Bureau of Civil AviationAdministration of China.Fax No. : 86-10-6403-3105AFTN : ZBBBCXXXThe application shall include:- identification (international registration mark)- flight number- schedule- type of aircraft- air route- intended alternate2.2 Summary of documents to be presented by aircraft captains or other authorisedagents2.2.1 It is necessary that the undermentioned main documents be submitted by Airline Operatorsto cover entry and departure of their aircraft to and from Macau. Responsibility for theircorrect presentation and submission is vested in the captain of the aircraft or handlingagent.2.2.2 Aircraft arrival documentsRequired by Cargo Manifest Traffic Form Passenger Manifest Crew ListCustoms Department 2 1 - -Immigration Department - 1 1 * 1Airport Management - 1 - -Total 2 3 1 1* Passengers manifest is only mandatory when exiting special bound passengers to surfacewhose destination is People’s Republic of China or Hong Kong. These passengers will beCivil Aviation Authority - Macao, China AMDT 12

GEN 1.2 - 224 JUN 2004AIP MACAUcontrolled by Immigration and Customs only in the People’s Republic of China or HongKong.2.2.3 Aircraft departure documentsNote 1: Special bound passengers are those passengers arriving to Macau with destinationto People’s Republic of China and Hong Kong or departing originally fromPeople’s Republic of China or Hong Kong. Special bound passengers are exempton arrival of Customs and Immigration control in Macau SAR, being this done onthe boundary control of those destinations.Note 2: In addition to the requirements listed in paragraphs 2.2.2 and 2.2.3, relevantdocuments covering freight and unaccompanied baggage (e.g. Consular Invoices,Licenses, Permits ...) must be submitted to the Customs Authorities for necessarychecking and clearance.Remark: When this facilitation programme (Note 1 & 2) is available, an AIC will be issued.2.3 Production of documents for inspection2.3.1 The captain or pilot in command of an aircraft shall, within a reasonable time after beingrequested to do so by an authorised person, produce to that person any of the followingdocuments:(a) the certificates of registration and airworthiness in force in respect of the aircraft ;(b) the licenses of its flight crew ;(c)such other documents as the aircraft is required by Airport Authority, like journeylog book, for instance.3. Non - scheduled air services3.1 IntroductionRequired by Cargo Manifest Traffic Form Passenger Manifest Crew ListCustoms Department 2 1 - -Immigration Department - 1 - 1Airport Management - 1 - -2 3 - 13.1.1 Any person wishing to use an aircraft in Macau for non-scheduled air services must obtaina permit from the President of the Civil Aviation Authority.3.1.2 Prior approval from the President of the Civil Aviation Authority shall also be sought fornon-scheduled flights to or from Macau for reasons other than carriage of passengers,cargo or mail for hire or reward.After authorisation being granted, the operator shall send the respective Flight Plan toMacau Tower, Guangzhou ACC, Zhuhai APP and Hong Kong ACC.3.1.3 THe period of non - scheduled air services permit will not exceed one month normally.AMDT 12Civil Aviation Authority - Macao, China

AIP MACAU GEN 1.2 - 305 APR 20013.2 Applications3.2.1 Before consideration can be given to an application for the operation of non-scheduled airservices to or from Macau the following information and documents must be submitted tothe President of Civil Aviation Authority:a) A valid air operator’s certificate or equivalent document issued by the applicant’snational aeronautical authorities, certifying that the aeronautical authorities are satisfiedthat the operator is competent to secure the safe operation of aircraft on flights for thepurpose of public transport, in accordance with such conditions and limitations as maybe specified in the certificate. This certificate shall contain at least the following:1) operator’s identification (name, address, etc.) ;2) date of issue and period of validity ;3) description of the types of operations authorised ;4) the type(s) of aircraft authorised for use ; and5) authorised areas of operation or routes.b) Documentary evidence from the operator’s insurance company to show that the aircraftto be used carry or carries appropriate third party insurance cover for any one accident,incident or occurrence as set out in GEN 1.2-5.3.2.2 In addition to the information and documents stated in paragraph 3.2.1 above, thefollowing information is also required in respect of each charter application:(a) Details of the proposed charter flight (i.e. the type of charter to be operated, theproposed operating schedule, etc.)(b) Justification for the charter flight.3.2.3 In cases where the applicant intends to use aircraft of another state of registry or of anotheroperator, whether under wet or dry lease arrangements, the following additionalrequirements will apply:(a) The applicant shall produce a copy of the aircraft lease agreement, or evidence that:1) such leasing arrangements would not be equivalent to allowing the lessor airlineaccess to traffic rights not otherwise available to that airline, and2) the financial benefit to be obtained by the lessor airline would not be related to theprofit or loss of the operation of the proposed flight.b) The President of Civil Aviation Authority must be satisfied with the arrangements madefor the allocation between the aeronautical authorities concerned of the responsibilitiesunder ICAO Annex 6 and the continuing airworthiness ofthe aircraft.3.2.4 Operators who propose to operate series of flights are advised to discuss their proposalswith the President of Civil Aviation Authority well in advance of the flights taking place,to secure approval in principle.3.2.5 The application must be submitted to the President of Civil Aviation Authority at least 3working days before the anticipated arrival/departure date of the flight in Macau.Civil Aviation Authority - Macau, China AMDT 09

GEN 1.2 - 405 APR 2001AIP MACAU3.3 Conditions governing the operation of non-scheduled air services3.3.1 In conformity with Article 5 of the Chicago Convention applications for non-scheduled airservices for the carriage of passengers or cargo will normally be approved if the Presidentof Civil Aviation Authority is satisfied that corresponding scheduled services cannot satisfya genuine demand by providing the service or capacity required and, in the case ofapplications made by airlines based outside Macau, that the government of the country inwhich the airline is based would be granted no less favourable treatment to Macau basedairline making a similar application.3.3.2 Applications for non-scheduled air services for the carriage of both passengers and cargowill not normally be considered.3.3.3 Permits for non-scheduled services are granted on condition that the holder does notadvertise such services for sale direct to general public.3.4 General3.4.1 Permits may contain such conditions as the President of Civil Aviation Authority thinks fithaving regard to the nature and circumstances of the applications.3.4.2 The captain of an aircraft which lands in Macau International Airport for non-trafficpurposes will, before departure, be required to sign at the Airport Dispatch Office, acertificate to the effect that the flight is not subject to a permit.3.5 Documentary requirements for clearance of aircraft3.5.1 The requirements are the same as for scheduled flights.4 Special procedures for general aviation aircraft4.1 General aviation aircraft including private aircraft, regardless of weight category, mustmeet specific requirements for the carriage of radio/navigation aids and fuel. (See GEN1.5-1).4.2 For administrative purposes, a 72 hours notification is required for private non-revenueflights (Three working days in advance).4.3 Overseas and local operators of private aircraft operating international flights to or fromMacau International Airport, shall employ the services of a recognised ground handlingagent and shall conform with the following procedures :The operator shall inform Guangzhou ACC, Zhuhai APP and Hong Kong ACC of theauthorisation for the use of Macau International Airport.4.3.1 Departing flightsa) The pilots, any crew members and all passengers are required to pass through thenormal Migration and Security Departure channels in the Passenger Terminal Buildingand be transported to the aircraft by the ground handling agent.b) The pilot is required to be in possession of a valid aircrew license issued in accordancewith the appropriate conventions and any other travel documents required by theMigration Department.AMDT 09Civil Aviation Authority - Macau, China

AIP MACAO GEN 1.2 - 501 FEB 20074.3.2. Arriving flightsa) After landing, the aircraft shall be taxied to position as directed by Air Traffic Control,where it will be met by the Migration and Customs Servicesb) The Pilots, crew members and all passengers shall be transported by the groundhandling agent to the Passenger Terminal Building for Customs, Migration and Quarantineclearance.c) Due to general Aviation stands configuration (compulsory push back) crews may berequested to carry the tow bar adapted to the type of their aircraft.4.4. Flight planBesides Macau Tower, flight plan shall be sent to Guangzhou ACC, Zhuhai APP and HongKong ACC5. Requests for use of Macau International Airport as alternate or diversion5.1. Application to use Macau as an alternate or diversion airport shall be sent to Civil AviationAuthority.5.2. After approved, the operator shall inform, Guangzhou ACC, Zhuhai APP and Hong KongACC.6. Health requirements6.1. Strict compliance with the provisions of the International Health Regulations of the WorldHealth Organisation is maintained.6.2. Disinsection of an aircraft, when required, should be carried out using methods approvedby the World Health Organisation.7. Compulsory third party insuranceGroup Classification Aircraft MaximumTake-off Weight as Stipulated in theManufacturer’s Airplane Flight ManualCombined Single Limit for Third PartyLiability for any one accident / incident /occurrence to be not less than MOP1 2 000 kg or less 15 000 0002 2 001 kg - 6 000 kg 45 000 0003 6 001 kg - 25 000 kg 120 000 0004 25 001 kg - 100 000 kg 500 000 0005 100 001 kg and above 900 000 000Civil Aviation Authority – Macao, China AMDT 14

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 1.2 - 701 FEB 2007APPLICATION FOR PERMISSION TO OPERATE NON-SCHEDULED SERVICESTo:President of Civil Aviation Authority, MacaoAlameda Dr. Carlos D’Assumpção, 336-342Centro Comerical Cheng Feng, 18 o AndarMacauTelephone:Fax:AFTN:Email:7964122/7964135 (Direct), 2851 1213 (General)7964115 (Direct), 2833 8089 (General)VMMCYAYXaacm@aacm.gov.moNature of Request: New Revision (If already approved, please specify Auth. Nr. _______________________)A - Aircraft Operator:B - Aircraft Nationality and Registration Mark(s):C - Aircraft Type(s):D - Name of Local Handling Agent:E - Charterer Information:Name: _____________________________ Email: ______________________________________Address: _______________________________________________________________________________Tel: _______________________________ Fax: ________________________________________F - Flight Number(s) / Date(s) of Operation, Arrival(s)/Departure(s) at MacaoG – Points of landing enroute to and from Macao:H - Type of Flight(s) [Please tick the applicable box]: Charter (Passenger/Cargo) [circle applicable] Extra flight (Passenger/Cargo) [circle applicable] Position/Ferry Test Training Technical stop Private Medical State FlightI – Reason/Purpose of Flight(s): Aerial Work (please specify) ______________________ Others (please specify) __________________________J - Passenger Flight(s)Points of Embarkation/DisembarkationFrom _______________________________ to MacaoFrom Macao to _______________________________K - Cargo Flight(s)Amount of Cargo (kg) _________________________Loading Point(s) ______________________________Unloading Point(s) ____________________________Number of Passengers____________________________________Description/Nature ___________________________Name of Consignor ___________________________Name of Consignee ___________________________L -Applicant: ___________________________________Email: ______________________________________Telephone: __________________________________Fax: ________________________________________Title: _______________________________________Signature: ___________________________________Date: _______________________________________N.B.1. The permit for non-scheduled services, if granted, must be produced to the duty officer in the Aeronautical Information Centre before departure.2. The timings in Section F above must be cleared with the Macao Scheduling Coordinator.3. Relevant information for non-scheduled services application is available online at: www.aacm.gov.moCivil Aviation Authority – Macao, China AMDT 14

AIP MACAO GEN 1.2 - 801 FEB 2007This permit is subject to the following conditionsCONDITIONSA) The operator shall take adequate precautions in relation to security and safety and shall comply with allreasonable directions given by the President of Civil Aviation Authority from time to time in that regardB) The requirements concerning non-scheduled air services as set out in the AIP Macau GEN 1.2-2 must be adheredto ;C) The operator may not advertise or in any other way offer directly member of public services authorised by thispermit ;D) The operator must be in possession of valid certificate of competency issued by the aeronautical authority of thestate of the operator ;E) The operator must be in possession of documentary evidence from the operator’s insurance company to the effectthat all aircraft carry appropriate third party insurance coverage for any one accident, incident or occurrence as setout in the Section GEN 1.2.5 of the AIP Macao.Any breach of the conditions above will render this permit invalid.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.3 - 101 FEB 2007GEN 1.3 ENTRY, TRANSIT AND DEPARTURE OF PASSENGERS AND CREW1. Customs requirements1.1. Customs formalities are conducted in conformity with standard international procedure,and as far as possible, in accordance with the Standards and Recommended Practices laiddown by the International Civil Aviation Organisation (Annex 9). The Airport CustomsStaff are under the jurisdiction of Macao Customs Services and they are responsible for theenforcement of various legislations of Macao affecting importation and exportation ofgoods.1.2. All travellers may carry, without any formalities being required, articles of a value notexceeding 10 000 MOP which are not included in the list of products or articles subject totax consumption or pre-authorisation.1.3. An incoming passenger is allowed to bring in without declaration the following quantitiesof commodities for his own use or consumption as listed in table number 1 of ChiefExecutive Order No. 225/2003:1.4. Each day a person is allowed to bring in the following amount of commodities (Pleaserefer to table number 1 of Chief Executive Order No. 225/2003 for specific guidance):- Dairy products; bird's eggs (fresh one excluded); natural honey; live plants; spawn;bulbs; edible tubers; edible fruits; seeds; sugar cane; ice-cream and edible ice; dog orcat food; animal or vegetable fertilizers; insecticides, herbicides, disinfectants andsimilar products; etc.(0.5kg of insecticides, herbicides, disinfectants and similar products are allowed perday, others are 1kg each per day and total of not more than 5kg per day)- 200 pieces of cigarettes or 50 pieces of cigars (the weight of each piece must notexceed 3 grams) or 100 pieces of cigarillos or 250 grams of tobacco;(total weight not exceeding 250 grams)- 1 liter of grape wine or beverages of alcoholic strength by volume not exceeding 30%vol. or 1 liter of beverages of alcoholic strength by volume exceeding 30%vol.1.5. Residents benefit from the same allowances granted to tourists for articles of personal useor which have been declared when leaving Macao.2. Immigration requirements2.1. The entry and staying in Macao is controlled by the Migration Service of Public SecurityPolice (CPSP). Following paragraphs are intended only as a guide.2.2. Passport requirement and travel documents(a) All passengers wishing to enter Macao must have valid travel documents, with visaswhere required, and adequate means of subsistence to support their proposed stay andthe objectives of the visit or staying in Macao.(b) “World Service Authority” issued documents are not recognised nor accepted.Civil Aviation Authority – Macao, China AMDT 14

GEN 1.3 - 201 FEB 20072.3. Visas requirementAIP MACAOArriving passengers (excluding “special bound passenger”) as defined in page GEN 1.2-2,2.2.3 Note 1, must have an authorization to enter Macao or a Diplomatic or Consular Visa,previously obtained. However, this is not required to the holders of following validdocuments:(a) Macao Resident Card (BIR)(b) Hong Kong Identity Card (HKIC), Hong Kong Permanent Identity Card or HongKong Re-entry Permit, if any of these documents serve for that passenger to enter inHong Kong. HKIC is only valid if holder has registered on it any of following codes“*”, “***” or “R”.(c) Resident Permit(d) Identity Permit for non-resident workerNote: Holders of documents referred in c) and d) are not exempt from producing validpassports.2.4. For passengers of following nationalities, visa and authorisation is not required. However,conditions stated in 2.6 are to be met.Arab Republic of Egypt Australia AustriaBelgium Brazil CanadaChile Commonwealth of Dominica CroatiaCyprus Republic Czech Republic DenmarkEstonia Finland FranceGermany Greece HungaryIceland India IndonesiaIreland Israel ItalyJapan Kiribati LebanonLiechtenstein Lithuania LuxembourgMalaysia Malta MexicoMonaco Mongolia NamibiaNetherlands New Zealand NorwayPhilippines Poland PortugalRepublic of Bulgaria Republic of Cabo Verde Republic of KoreaRepublic of Latvia Republic of Mali RomaniaSamoa Seychelles SingaporeSlovak Slovenia South AfricaSpain Sweden SwitzerlandTanzania Thailand The Principality of AndorraTurkey United Kingdom United States of AmericaUruguayAMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.3 - 301 FEB 20072.5. The passengers wishing to enter in Macao and not producing a consular Visa or an entrypermit previously obtained may be allowed by the Migration Service to stay in Macao for amaximum of 20 days.This authorisation is granted on arrival to any boundary immigration control port andsubject to payment of 100 MOP tax.2.6. Other requirements for entry in MacaoThe following citizens of below mentioned countries must produce a valid return ticket andmake proof of the possession of sufficient financial means for the stay (500 MOP for eachday):Bangladesh Nepal Thailand IndonesiaPakistan Myanmar PhilippinesAll African countries (with exception of the Republic of South Africa).This requirement does not apply to citizens holding valid residency permit or identitypermit for non-resident worker.2.7. SeamanCrew of ships, holders of the maritime identity document (seafarers) referred byconvention NR 108 of International Labour Organisation, are exempted of producingconsular visas or entry authorisation, when:a) Their ship is in Macaob) They are in transit to join the ship anywherec) Wanting to join their ship in Macaod) To be repatriated from the ship, via Macao 2.82.8. Aircrewa) Aircrew in uniform and included in the crew list mentioned in GEN 1.2 para 2.2.2 and2.2.3 must only produce the crew card.b) Aircrew in civilian dress, included or not in the crew list are required to produce thecrew certificate of the form established by Appendix 7 to Annex 9 of ChicagoConvention, being yet mandatory to exhibit his crew card on a very visible place.c) Crew from private aircraft are considered as a normal passenger. 2.92.9. Transit passengersNo special formality or requirement is necessary for transit passengers who, transitingthrough Macao, will continue travel to a third Country, if they remain in the internationalarea of the airport.Note:The entry in Macao is exempted from fees and taxes. The entry authorisation forthis case will be granted for a stay not exceeding two days, by means of a stampon passenger’s passport.Civil Aviation Authority – Macao, China AMDT 14

GEN 1.3 - 401 FEB 20072.10. Airline responsibilityAIP MACAOThe owner of the aircraft as well as all who have responsibility for the transport to Macaoof passenger or crew members without valid travel documents shall be liable to a fine of10 000 MOP for each undocumented person transported (crew or passenger).Cumulatively the airlines or owners of the aircraft are held responsible for the return totheir origin of all passengers whose entry into Macao has been refused.3. Public health requirements3.1. Strict compliance with the provisions of the International Health Regulations of the WorldHealth Organisation is maintained.Facilities are available for vaccination and the issuance of an international certificate ofvaccination.Disinfection of an aircraft, when required, should be carried out using methods approvedby the World Health Organisation.3.2. Illness or death on boardThe Captain of an incoming aircraft, who has a seriously ill or dead person on board, mustgive as much notice as possible by radio to the Airport Authorities of such occurrence.Relevant information concerning the necessity for having a doctor or ambulance standingbywould facilitate attention or removal as the case may be.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.4 - 101 FEB 20071. Customs requirementsGEN 1.4 ENTRY, TRANSIT AND DEPARTURE OF CARGO1.1. Customs formalities are conducted in conformity with standard international procedures,and as far as possible, in accordance with the Standards and Recommended Practices laiddown by the International Civil Aviation Organisation (Annex 9). The airport CustomsStaff are under the jurisdiction of Macao Customs Services and they are responsible for theenforcement of various legislations of Macao, affecting importation and exportation ofgoods.1.2. For reasons of health, safety, security and trade control, goods of the following categoriesare forbidden for travellers to carry:- Narcotics ;- Drugs, chemical and pharmaceutical products (except if these are for personal use) ;- Gunpowder and explosives, pyrotechnic articles and inflammable materials ;- Arms and ammunition (except if pre-authorisation was obtained) ;- Dangerous goods ;- Endangered species of animals and plants ;- Radioactive substances and irradiating apparatus ;- Pesticides.REMARKS:Licenses are issued by the “Serviços de Economia“ (Economic Services), Rua Dr. PedroJosé Lobo, n° 1-3, 2th Floor (Tel 2856 2622- Fax 28590309) during office working hours(9 a.m to 1 p.m and 2:30 p.m to 5:45 p.m Mondays to Thursday, and 9 a.m to 1 p.m and2:30 p.m to 5:30 p.m Friday).Excise is paid at the same address (6th Floor) during thesame office working hours.2. Agricultural quarantine requirementFor imported plants, if appropriate mentioned documents are not submitted, a quarantine ofimported plants will be requested.3. Health requirementsStrict compliance with the provisions of the International Health Regulations of the WorldHealth Organisation is maintained.a) Fish, shellfish, vegetables or beverages imported from a cholera infected place or airportshould be declared to the Health Authorities at Airport before unloading, when required.b) No feathers, sacks or rags taken on board the aircraft at a plague infected place or airportshould be unloaded unless such articles have been disinfected and disinsected to thesatisfaction of a Health officer.Civil Aviation Authority – Macao, China AMDT 14

GEN 1.4 - 201 FEB 2007AIP MACAO4. Animals on aircraftThe Macao Government requires the presentation of an application form (Licença deImportação Declaração de Importação or Declaração de Trânsito) in order to permit theimportation or transit of live animals (mammals, birds and reptiles), animal productsdestined for human consumption (meat, meat products, eggs, eggs products, milk, milkproducts) fish, crustaceans and molluscs.The application form is granted by Serviços de Inspecção e Sanidade of Instituto para osAssuntos Cívicos e Municipais (Tel: 28515952 Fax 28519303)No live animals, meat, animal products, fish, crustaceans or molluscs, can be brought intoMacao on board of any aircraft without holding:4.1. For live animals- International Animal Health Certificate (all animals)- Anti rabies Vaccination certificate (dogs and cats)- Vaccination certificate (covering other infectious diseases).- Such live animals must be:a) Carried and caged (with labels) in accordance with the current Live AnimalsRegulations of IATA (International Air Transport Association) and in such away as toensure humane management at all times if consigned as manifest cargo; orb) Carried and caged according to operators regulations and under specified condition ifconsigned in the cargo compartment as passenger luggage or in the cabin with the ownerpassenger.- Dogs and cats under 2 months old must not be imported.4.2. For meat, animal products, fish, crustaceans and molluscs- International sanitary certificate.- Such meat animal products, fish, crustaceans and molluscs must be:- Loaded in containers with only one kind of product or at least with products not likely tobe contaminated one by another.- Consigned as manifest cargo.Additional information:- In all above cases the owner/importer of the animals or products must, on arrival,produce the special permit for import the documentation certifying that it satisfies thesanitary requisites of Macao and present the animals or products for inspection.- Macao is a member of C.I.T.E.S (see Terms and Definitions).AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.4 - 327 MAR 20084.3. Vegetal ProductsIt is only allowed the importation of vegetal products when through duly authorisedeconomic agents.a) Vegetal products are subject to phytosanitary control on arrival by Instituto para osAssuntos Cívicos e Municipais, and must make proof of having:- Phytosanitary Certificate- Origin Certificate (when the origin is not mentioned in the phytosanitary certificate)- CITES Certificate (when vegetals belong to endangered species)b) Only in special cases,allowed by Instituto para os Assuntos Cívicos e Municipais, isauthorised the importation of plants with soil.5. Transport of Dangerous Goods by Air5.1. Operators who wish to obtain:a) general permission for carriage of dangerous goods in aircraft,b) permission for carriage of particular consignment of dangerous goods on a flight orseries of flights,should submit their application by post or fax to AACM. Any application for thepermission must reach AACM at least 10 working days prior to the first flight for which itis required.5.2. Detail requirements and application procedure are laid down in the Aeronautical CircularAC/OPS/005 - Transport of Dangerous Goods by Air. The said Aeronautical Circular isavailable from the AACM upon request.Civil Aviation Authority – Macao, China AMDT 15

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 1.5 - 101 FEB 2007GEN 1.5 AIRCRAFT INSTRUMENTS, EQUIPMENT AND FLIGHT DOCUMENTS1. GeneralCommercial air transport aircraft operating in Macao must adhere to the provisions ofAnnex 6 - Operation of Aircraft, Part I, Chapter 6 (Aeroplane Instruments, Equipment, andFlight Documents) and Chapter 7 (Aeroplane Communication and Navigation Equipment)2. Special equipment to be carried2.1. Rules for General Aviation Aircraft2.1.1. All general aviation aircraft, including private aircraft, regardless of weight category,operating through Macao are required to have full navigational capability:(1) Two-way VHF radio with appropriate frequencies;(2) VOR;(3) DME.2.1.2. Applications for flight into Macau by private aircraft must include confirmation that therequirements of paragraph 2.1.1 will be met.2.2. Carriage of radio equipment2.2.1. The requirements for the carriage of radio equipment are contained in the Air NavigationRegulation of Macau.2.3. Carriage of Secondary Surveillance Radar Transponders2.3.1. All aircraft flying within the Macau ATZ are required to carry Mode 3/A (4096 code) andMode C transponders which comply with the specifications of ICAO Annex 10 Part 1.3. Flight documentsAs mentioned in GEN 1.2.Civil Aviation Authority – Macao, China AMDT 14

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 1.6-101 FEB 2007GEN 1.6 SUMMARY OF MACAO SPECIAL ADMINISTRATIVEREGION LAWS, REGULATIONS AND INTERNATIONALAGREEMENTS / CONVENTIONS1 List of Laws and Regulations applicable to Civil Aviation in Macao SpecialAdministrative Region:ReferenceDecree Law n.10/91/M-4 FebruaryDecree Law n. 52/94/M-7 NovemberDecree Law n. 9/95/M-6 FebruaryPortaria n. 230/95/M-14 AugustPortaria n. 231/95/M-14 AugustPortaria n. 232/95/M-14 AugustPortaria n. 233/95/M-14 AugustPortaria n. 282/96/M-11 NovemberLaws and RegulationsEstablishes the Civil Aviation AuthorityEstablishes the legal system governing theaeronautical restrictions in the territory ofMacaoAmends the statute of the Civil AviationAuthorityRules the requirements and the fees for theissuance, replacement, validation and alterationof the Air Operators' CertificatesRules the requirements and the fees for theissuance, validation, suspension and revocationof technical crew and cabin crew licensesRules the authorization process to operate nonscheduledflights in Macau InternationalAirportDefines the surrounding areas of the MacauInternational Airport which are restricted by theaeronautical restrictionsUpdates the Macau International AirportchargesDecree Law n. 66/96/M-18 November Rules the baggages and other objectsabandoned in the Macau International AirportDecree Law n. 10/98/M-30 MarchPortaria n. 152/98/M-15 JuneOrdem Executiva n. 25/2003-2 JulyApproves the system for aircraft registryUpdates the Macau International AirportchargesApproves the Air Navigation Regulation ofMacauCivil Aviation Authority – Macao, China AMDT 14

GEN 1.6-201 FEB 2007AIP MACAOReferenceRegulamento Administrativo n.º 31/2003– 18 SeptemberRegulamento Administrativo n.º 10/2004– 5 AprilRegulamento Administrativo n.º 11/2004– 5 AprilOrdem Executiva n. 36/2004– 12 NovemberLaws and RegulationsAdministrative regulation regarding forbiddenarticles and certain offence committed on boardcivil aircraftDefines the basic principles ruling the civilaviation activities in the Macao SAR.Rules the liability limits of the operators ofaircrafta) Registered in the Macao SAR,b) Using Macao's civil aviationinfrastructures orc) Using the air space assigned to theMacao SAR.Updates the Macau International Airportcharges2. List of International Conventions on Civil Aviation matters applicable to MacaoSpecial Administrative Region:International ConventionsConvention on International Civil AviationChicago, December 7th 1944Convention for the Unification of Certain Rules relating to International Carriage by AirWarsaw, October 12th 1929Hague Protocol amending the Convention for the Unification of Certain Rules relating toInternational Carriage by AirHague, September 28th 1955Convention on the International Recognition of Rights in AircraftGeneva, June 19th 1948Convention on Offences and Certain Other Acts Committed on Board AircraftTokyo, September 14th 1963Convention for the Suppression of Unlawful Seizure of AircraftHague, December 16th 1970Convention for the Suppression of Unlawful Acts Against the Safety of Civil AviationMontreal, September 23rd 1971AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.6-301 FEB 2007TABLE 1.6.1Air Navigation OrderProvision for NotificationInstrument Landing SystemRadio FrequenciesMechanical radio watchDefinitions of an Aerodrome Traffic ZoneCarriage of Radio EquipmentCarriage of TransponderHolding and Instrument Approach ProceduresPosition ReportsRadio Frequencies for the Air Traffic Controlcommunications at aerodromeNotificationNotified in ENR Section.The radio frequencies in use by aeronauticalradio stations are notified in the AD Section.Frequencies fitted with suitable equipmentto permit the maintenance of a mechanicalradio watch are notified in the AD Section.Controlled airspace is notified in the ENRSection.A requirement ensure two waycommunications with Air Traffic ControlUnit.A requirement for the carriage of asecondary surveillance radar transponder isnotified in the GEN Section.Holding and Instrument ApproachProcedures are notified in the ENR Section.Position Reporting Procedures are notifiedin the ENR Section.Notified in the AD Section.Civil Aviation Authority – Macao, China AMDT 14

GEN 1.6-401 JAN 20093. Aeronautical CircularAIP MACAOThe President of Civil Aviation Authority, in exercise of his power under Paragraph 89 ofthe Air Navigation Regulation of Macao (ANRM) and Article 35 of the Statutes of CivilAviation Authority, approved by the Decree-Law 10/91/M, established this AeronauticalCircular (AC) system.3.1 General (GEN)Number Version SubjectAC/GEN/001 R00 New System of Issuance of Aeronautical CircularsAC/GEN/002 R00 Rules Concerning Aeronautical Accidents and IncidentsAC/GEN/003 R00 Mandatory Occurrence Reporting SchemeAC/GEN/004 R00Units Of Measurement To Be Used In Air And GroundOperations3.2 Airport (AGA)Number Version SubjectAC/AGA/001 R00Regulation on Liquids Carried on Passenger HandBaggageAC/AGA/002 R00Regulations about Restricted Items to be Carried intoAircraft Cabin and Restricted Areas3.3 Air Traffic ServicesNumber Version SubjectAC/ATS/001 R00 Scheme of Working Hours of Air Traffic ControllersAC/ATS/002 R00Safety Management System of the Air Traffic ServicesProvider3.4 AirworthinessNumber Version SubjectAC/AW/001 R01Process for Acceptance of Used Engines, Engine Modules,Auxiliary Power Units (APUs) and Propellers for Use onAircraft Requiring a Macao Certificate of AirworthinessAC/AW/002 R02 Acceptance of Aircraft ComponentsAC/AW/003 R02Cooperation Arrangement On Mutual Acceptance OfApproval Of Aircraft Maintenance Organisation BetweenGeneral Administration Of Civil Aviation Of China, CivilAviation Department, Hong Kong, China And CivilAviation Authority – Macao, ChinaAC/AW/004 R00Macao Aviation Requirements MAR-1 AirworthinessProceduresAMDT 16Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.6-501 JAN 2009AC/AW/005R00Coding and Registration of Macao 406 MHz EmergencyLocator Transmitter (ELT) for Search and RescueAC/AW/006 R00Macao Aviation Requirements MAR-66 Licensing ofAircraft Maintenance EngineerAC/AW/007 R00Implementation of Safety Management System inMaintenance OrganizationsAC/AW/008 R00 Macao Aviation Requirements3.5 Flight OperationsNumber Version SubjectAC/OPS/001 R00 Development of an AOC Holder's Safety DepartmentAC/OPS/002 R02 Operations Manual RequirementsAppendix 1 – Operations Manual RequirementsAppendix 2 – Organization and Contents of an OperationsManualAC/OPS/003 R00 Flight Safety Documents SystemAC/OPS/004 R00Application Procedures for the Issuance of an Air OperatorCertificate (AOC)AC/OPS/005 R00 Transport of Dangerous Goods by AirAC/OPS/006 R00 Cruise Relief Pilot Recent ExperienceAC/OPS/007 R00 Marshalling SignalsAC/OPS/008 R00Carriage of a Certified True Copy of the Air OperatorCertificate (AOC)AC/OPS/009 R00 Safety Management SystemAC/OPS/010 R00 Interception of Civil AircraftAC/OPS/011 R00Single Pilot Operations Under Instrument Flight Rules orAt Night3.6 Personnel LicensingNumber Version SubjectAC/PEL/001 R00 Cruise Relief Pilot RatingAC/PEL/002 R00 Language Proficiency RequirementsAttachment – ICAO Language Proficiency Rating ScaleAC/PEL/003 R01 New Format of the Medical CertificateAC/PEL/004 R00 Update of Medical ProvisionsAC/PEL/005 R00Limitation of privileges of pilots who have attained their60th birthdayCivil Aviation Authority – Macao, China AMDT 16

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 1.7-101 JAN 2009GEN 1.7 DIFFERENCES FROM ICAO STANDARDS, RECOMMENDEDPRACTICES AND PROCEDURES1. Annex 1 - Personnel Licensing (10 th Edition, Amendment 168)2.3.1.1 The applicant for a Private pilot license - Aeroplane or Private pilotlicense - Helicopter shall be not less than 18 years of age.2.4.2.1 c) Privileges of Commercial Pilot License-Aeroplanes holders when actingas pilot-in-command in commercial air transportation are subject to thefollowing conditions:to act as pilot-in command in commercial air transportation certified forsingle-pilot operation; but which maximum certificated take-off mass doesnot exceed 5,700 kg and which is of a type specified in the aircraft ratingsection included in the license, when the aeroplane is engaged in a flightfor the purpose of commercial air transportation; and provided that:i) he/she shall not, unless his/her license includes an instrumentrating, fly such an aircraft on any scheduled journey;ii)he/she shall not fly such an aircraft on a flight carrying passengersat night unless an instrument rating is included in his/her license;andiii) he/she shall not, unless his/her license includes an instrumentrating, fly any such aircraft of which the maximum certificatedtake-off mass exceeds 2300kg on any flight for the purpose ofcommercial air transport except a flight beginning and ending atMacao and not extending beyond 25 nautical miles from Macao;2.8.2.1 Privileges of Commercial Pilot License-Helicopters holders when actingas pilot-in-command in commercial air transportation are subject to thefollowing conditions:to act as pilot-in command in commercial air transportation certified forsingle-pilot operation; but which maximum certificated take-off mass doesnot exceed 5,700 kg and which is of a type specified in the aircraft ratingsection included in the license, when the aeroplane is engaged in a flightfor the purpose of commercial air transportation; and provided that:i) he/she shall not, unless his/her license includes an instrumentrating, fly such an aircraft on any scheduled journey;ii)iii)he/she shall not fly such an aircraft on a flight carrying passengersat night unless an instrument rating is included in his/her license;andhe/she shall not, unless his/her license includes an instrumentrating, fly any such aircraft of which the maximum certificatedtake-off mass exceeds 2300kg on any flight for the purpose ofcommercial air transport except a flight beginning and ending atCivil Aviation Authority – Macao, China AMDT 16

GEN 1.7-201 JAN 2009AIP MACAOMacao and not extending beyond 25 nautical miles from Macao;3.2.1.1 The applicant for a flight navigator license shall be not less than 21 yearsof age.3.3.1.1 The applicant for a flight engineer license shall be not less than 21 yearsof age.3.4 There are specific regulations relating to the Flight Radio OperatorLicense.4.2.1.1 Certifying staff must not be less than 21 years of age4.2.1.3 a) 1) Certifying staff for Category A – Minimum 3 years civil aircraftmaintenance experienceCertifying staff for Category B – Minimum 5 years civil aircraftmaintenance experience4.2.1.3 a) 2) Certifying staff for Category A – Minimum 1 years civil aircraftmaintenance experienceCertifying staff for Category B – Minimum 2 years civil aircraftmaintenance experience4.2.1.3 b) 1) Minimum 5 years civil aircraft maintenance experience6.1.1 The Class 2 Medical Assessments also applies to applicants for the FlightRadio Telephony Operator License.2. Annex 2 - Rules of the Air (10 th Edition, Amendment 41)4.6 Within Macao ATZ:a) Minimum height over congested area is 1500ft.b) Aircraft must maintain a minimum distance of 500 ft from persons,vessels, vehicles and structures.The minimum heights apply to all flights whether under both VFR andIFR.3. Annex 3 - Meteorological Service for International Air Navigation (16 th Edition,Amendment 74)NIL.4. Annex 4 - Aeronautical Charts (10 th Edition, Amendment 54)NIL.5. Annex5 - Units of Measurement to be used in Air and Ground Operations (4 th Edition,Amendment 16)NIL.6. Annex 6 - Operation of Aircraft6.1 Part I - International Commercial Air Transport - Aeroplanes) (8 th Edition,Amendment 32)4.9.1 Single pilot operations under IFR or at night not permitted.4.9.2 Single pilot operations under IFR or at night not permitted.AMDT 16Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.7-301 JAN 20095.4.1Operations of single-engine turbine powered aeroplanes at night and/or inIMC not permitted5.4.2Operations of single-engine turbine powered aeroplanes at night and/or inIMC not permittedAll turbined engined aeroplane registered in Macao, China of a maximum6.18.3* certificated take-off mass in excess of 5700kg or authorized to carry morethan 19 passengers shall be equipped with ACAS II6.21.1*This recommendation of forward-looking wind shear warning system isnot required.6.21.2*This recommendation of forward-looking wind shear warning system isnot required.6.22 Single pilot operations under IFR or at night not permitted.9.4.5 Single pilot operations under IFR or at night not permitted.* Denotes ICAO Recommended practices6.2 Part II - International General Aviation - Aeroplanes (7 th Edition, Amendment 17)NIL.6.3 Part III - International Operations - Helicopters (6 th Edition, Amendment 13)NIL.7. Annex 7 - Aircraft Nationality and Registration Marks (5 th Edition, Amendment 5)NIL.8. Annex 8 - Airworthiness of Aircraft (10 th Edition, Amendment 100)NIL.9. Annex 9 - Facilitation (12 th Edition, Amendment 20)2.4 The use of a document titled Traffic Form has made it possible toeliminate the following documents: General Declaration. PassengerManifest and Customs Clearance for entry and exit of goods, permit toload and unload cargo and customs entry declaration.2.5 Names, nationalities and functions of crew members are required.2.7 Presentation of Cargo Manifest is required.2.8 Air cargo reporting requirements are prescribed by local legislation underwhich no option, as proposed, is provided for.2.8.1 Information concerning the nature of goods is required.2.18 Portuguese and Chinese are the official languages.3.5.1 Machine readable passports are not available in Macau, but there are plansto be introduced in the near future.3.8 In case where a visa is required, the visa charge is payable except wherethere are agreements providing for exemption from such payment.3.8.1 There are no provisions for the machine reading of visas.3.8.3 Visas are valid 120 days.3.9 Arrival/Departure Card is required except for those who are MacauResident Identification Card holders.3.10 Arrival/Departure Card do not conform to Appendix 5 of Annex 9.3.29 Arrival/Departure Card is required except for those who are MacauCivil Aviation Authority – Macao, China AMDT 16

GEN 1.7-401 JAN 2009AIP MACAOResident Identification Card holders.3.36 Not acceptable. Legislation provides for the removal of any persons foundinadmissible in Macau to their last airport of embarkation or place oforigin or place of nationality of deportee.3.36.1 Not acceptable. Legislation now provides for the removal of any personsfound inadmissible in Macau to their last airport of embarkation or placeof origin, or place of nationality of deportee.3.37.1 A fine may be imposed on the operator (by law) if the passenger is not inpossession of the proper documents.4.9 Unaccompanied baggage is shipped as cargo and such is accompanied byan airway bill.4.53 b) and c) Unaccompanied baggage is regarded as cargo and physicallydirected to areas provided for cargo.5.4 The identification of the aircraft involved, the nature and identification ofthe consignments (packages), the gross weight and the place of loading ofgoods may be required to be included in a document to be presented as asummary declaration of goods to the customs authorities.5.5 Goods introduced into a Macau Territory are subject to Customssurveillance and may be checked by Customs Authorities.10. Annex 10 - Aeronautical Telecommunications10.1 Volume I - Radio Navigation Aids (6 th Edition, Amendment 83)LLZ RWY 16 (MCS) offset not in compliance with ICAO ANNEX 10 classification.Note: Some deviations (bends) between 6.5 NM and 4.5 NM10.2 Volume II - Communication Procedures including those with PANS Status (6 th Edition,Amendment 83)NIL.10.3 Volume III - Communications Systems (2 nd Edition, Amendment 83)NIL.10.4 Volume IV - Surveillance Radar and Collision Avoidance Systems (4 th Edition,Amendment 83)NIL.10.5 Volume V - Aeronautical Radio Frequency Spectrum Utilization (2 nd Edition,Amendment 83)NIL.11. Annex 11 - Air Traffic Services (13 th Edition, Amendment 46)NIL.12 Annex 12 - Search and Rescue (8 th Edition, Amendment 18)NIL.13. Annex 13 - Aircraft Accident Investigation (9 th Edition, Amendment 10)AMDT 16Civil Aviation Authority – Macao, China

AIP MACAO GEN 1.7-501 JAN 2009NIL.14. Annex 14 – Aerodromes14.1 Volume I - Aerodrome Design and Operations (4 th Edition, Amendment 9)3.4.3 Macau International Airport provides a runway strip that measures 150meters from the runway centerline except for the northwestern half whichis 106 meters. The area beyond the 106 meter mark falls within the waterbasin contained between the runway and the two taxiway bridges.3.5.3 The length of runway end safety area of Macau International Airport is 90m.14.2 Volume II - Heliports (2 nd Edition, Amendment 3)NIL.15. Annex 15 - Aeronautical Information Services (12 th Edition, Amendment 34)NIL.16. Annex 16 - Environmental Protection16.1 Volume I - Aircraft Noise (5 th Edition, Amendment 9)Part II1.5 Items 9, 10, 13, 14, 15, 16, 17 in this Annex are not included in NoiseCertificate (Form AACM 11A) issued by the AACM1.6 Noise Certificate (Form AACM 11A) issued by the AACM has its ownnumbering system16.2 Volume II - Aircraft Engine Emissions (3 rd Edition, Amendment 6)NIL.17. Annex 17 - Security - Safeguarding International Civil Aviation Against Acts ofUnlawful Interference (8 th Edition, Amendment 11)NIL.18 Annex 18 - The Safe Transport of Dangerous Goods by Air (3 rd Edition, Amendment 9)NIL.Civil Aviation Authority – Macao, China AMDT 16

INTENTIONALLYLEFTBLANK

GEN 2.1-227 MAR 2008AIP MACAO3. Geodetic reference datum3.1 Name/designation of datumAll published geographical coordinates indicating latitude and longitude are expressed interms of the World Geodetic System - 1984 (WGS84) geodetic reference datum.3.2 Area of applicationArea of application for the published geographical coordinates coincides with the area ofresponsibility of the Aeronautical Information Service, i.e. the entire Macau AerodromeTraffic Zone in accordance with the Local Agreement.4. Aircraft nationality and registration marks4.1 The nationality mark for aircraft registered in Macao is the letter “B”.4.2 The nationality mark is followed by a hyphen and a registration mark consisting of a threeletter group.4.3 The first letter of the registration mark being the letter “M”, representing Macao.Registration marks are issued within the combination “MAA” to “MZZ”.5. Official Public Holidays of MacaoThe official public holidays are published every year by means of an AIC.AMDT 15Civil Aviation Authority – Macao, China

AIP MACAU GEN 2.2 -102 JAN 97GEN 2.2 ABBREVIATIONS USED IN AIS PUBLICATIONSAbbreviations used in this AIP are contained in ICAO Doc 8400 and other abbreviation aslisted in the following:AA AmberAAA (or AAB, AAC etc., in sequence) Amended meteorologicalmessage (message type designator)A/A Air-to-airAAL Above aerodrome levelABM AbeamABN Aerodrome beaconABT AboutAC AltocumulusACC ‡ Area control centre or area controlACCID Notification of an aircraft accidentACFT AircraftACK AcknowledgeACL Altimeter check locationACN Aircraft classification numberACP Acceptance (message type designator)ACPT Accept or acceptedACT Active or activated or activityAD AerodromeADA Advisory areaADDN Addition or additionalADF ‡ Automatic direction-finding equipmentADIZ † (to be pronounced “AY-DIZ) Air defence identificationzoneADJ AdjacentADR Advisory routeADZ AdviseAFIL Flight plan filed in the airAFIS Aerodrome flight information serviceAFM Yes or affirm or affirmative or that is correctAFS Aeronautical fixed serviceAFT After .... (time or place)AFTN ‡ Aeronautical fixed telecommunication networkA/G Air-to-groundAGA Aerodromes, air routes and ground aidsAGL Above ground levelAGN AgainAIC Aeronautical information circularAIP Aeronautical information publicationAIRAC Aeronautical information regulation and controlAIREP † Air-reportAIS Aeronautical information servicesALA Alighting areaALERFA † Alert phaseALR Alerting (message type designator)ALS Approach lighting systemALT AltitudeALTN Alternate or alternating (light alternates in colour)ALTNAMAAMDAMSAMSLANSAOCAPAPCHAPPAPRAPRXAPSGAPVARFORARNGAROARPARPARQARRARRARSARSTASASCASDAASPHATA ‡ATC ‡ATD ‡ATIS ‡ATPATSATTNATZAUGAUTHAUWAUXAVASISAVBLAVGAVGAS †AWYAZMAlternate (aerodrome)Area minimum altitudeAmend or amended (used to indicate amendedmeteorological message ; message type designator)Aeronautical mobile serviceAbove mean sea levelAnswerAerodrome obstacle chartAirpotApproachApproach control office or approach control or approachcontrol serviceAprilApproximate or approximatelyAfter passingApprove or approved or approvalArea forecast (in aeronautical meterological code)ArrangeAir traffic services reporting officeAerodrome reference pointAir-report (message type designator)Automatic error corectionArrive or arrivalArrival (message type designator)Special air-report (message type designator)Arresting [specify (part of) aircraft arresting equipment]AltostratusAscent to or ascending toAccelerate - stop distance availableAsphaltActual time of arrivalAir traffic control (in general)Actual time of departureAutomatic terminal information serviceAt ..... (time or place)Air traffic servicesAttentionAerodrome traffic zoneAugustAuthorized or authorizationAll up weightAuxiliaryAbbreviated visual approach slope indicator systemAvailable or availabilityAverageAviation gasolineAirwayAzimuth† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

GEN 2.2 - 202 JAN 97BB BlueBA Braking actionBASE † Cloud baseBCFG Fog patchesBCN Beacon (aeronautical ground light))BCST BroadcastBDRY BoundaryBFR BeforeBKN BrokenBLDG BuildingBLO Below cloudsBLSN Blowing snowBLW BelowBOMB BombingBR MistBRF Shor (used to indicate the type of approach desired orrequired)BRG BearingBRKG BrakingBS Commercial broadcasting stationBTL Between layersBTN BetweenCC Centre (runway identification )C Degrees Celsius (Centigrade)CAT CategoryCAT Clear air turbulenceCAVOK † (to be pronounced “KAV-OH-KAY”) Visibility, cloud andpresent weather better than prescribed values or conditionsCB ‡ (to be pronounced “CEE BEE”) CumulonimbusCC CirrocumulusCCA (or CCB, CCC.... etc., in sequence) Correctedmeteorological message (message type designator)CD CandelaCDN Co-ordination (message type designator)CF Change frequency to...CGL Circling guidance light(s)CH ChannelCHG Modification (message type designator)CI CirrusCIT Near or over large townsCIV CivilCK CheckCL Centre lineCLA Clear type of ice formationCLBR CalibrationCLD CloudCLG CallingCLR Clear(s) or cleared to ... or clearanceCLSD Close or closed or closingCM CentimetreCMB ClimbCMPL Completion or completed or completeCNL Cancel or cancelledCNLCNSCOMCONCCONDCONSTCONTCOORCOPCORCOTCOVCPLCRZCSCTACTAMCTCCTLCTNCTRCUCUFCUSTCWCWYDAIP MACAUFlight plan cancellation (message type designator)ContinuousCommunicationsConcreteConditionConstruction or constructedContinue or continuedCo-ordinate or co-ordinationChange-over pointCorrect or correction or corrected (used to indicatecorrected meteorological message ; message typedesignator)At the coastCover or covered or coveringCurrent flight plan (message type designator)CruiseCirrostratusControl areaClimb to and maintainContactControlCautionControl zoneCumulusCumuliformCustomsContinuous waveClearwayD Danger area (followed by identification)DA Decision altitudeDCD Double channel duplexDCKG DockingDCS Double channel simplexDCT Direct (in relation to flight plan clearances and type ofapproach)DEC DecemberDEG DegreesDENEB Fog dispersal operationsDEP Depart or departureDEP Departure (message type designator)DES Descend to or descending toDEST DestinationDETRESFA † Distress phaseDEV Deviation or deviatingDFTI Distance from touchdown indicatorDH Decision heightDIF DiffuseDIST DistanceDIV Divert or divertingDLA Delay (message type designator)DLA Delay or delayedDME ‡ Distance measuring equipmentDNG Danger or dangerousDOM Domestic† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

AIP MACAU GEN 2.2 -302 JAN 97DPDPTDRDRGDRSNDSBDTAMDTGDTRTDTWDUCDURDVORDWDZEEEATEBEETEHFELBA †ELEVELREMEMBDEMERGENDENEENGENRTEOBTEQPTER*ESEESTETA*‡ETD ‡ETOEVEXCEXEREXPEXTDFFFFACFAFFALFAPDew point temperatureDepthDead reckoningDuringLow drifting snowDouble sidebandDescend to and maintainDate-time groupDeteriorate or deterioratingDual tandem wheelsDense upper cloudDurationDoppler VORDual wheelsDrizzleEast or aestern longitudeExcepted approach timeEastboundEstimated elapsed timeExtremely high frequency [30 000 to 300 000 MHz]Emergency location beacon – aircraftElevationExtra long rangeEmissionEmbedded in a layer.(to indicate cumulonimbus embeddedin layers of other clouds)EmergencyStop-end (related to RVR)East north eastEngineEn routeEstimated off-block timeEquipmentHere . . .or herewithEast south eastEstimate or estimated or estimate (as message typedesignator)Estimated time of arrival or estimating arrivalEstimated time of departure or estimating departureEstimated time over significant pointEveryExceptExercices or exercices or exerciseExpect or expected or expectingExtend or extendingDegree FahrenheitFixedFacilitiesFinal approach fixFacilitation of international air transportFinal approach pointFAXFBLFCFCSTFEBFGFICFIR ‡FISFISAFLFLDFLGFLRFLTFLTCKFLUCFLWFLYFMFNAFPLFPMFPRFRFREQFRIFRNGFRONT †FRQFSLFSSFSTFTFZFZDZFZFGFZRAGGG/AG/A/GGCA ‡GENGEOGLDGNDGNDCKGPGRGRADU †GRASSGRIDFacsimile transmissionLight (used to qualify icing, turbulence, interference orstatic reports)Funnel cloudForecastFebruaryFogFlight information centreFlight information regionFlight information serviceAutomated flight information serviceFlight levelFieldFlashingFlaresFlightFlight checkFluctuating or fluctuation or fluctuatedFollow(s) or followingFly or flyingFromFinal approachFiled flight plan (message type designator)Feet per minuteFlight plan routeFuel remainingFrequencyFridayFiringFront (relating to weather)FrequentFull stop landingFlight service stationFirstFeet (dimensional unit)FreezingFreezing drizzleFreezing fogFreezing rainGreenGround-to-airGround-to-air and air-to-groundGround controlled approach system or ground controlledapproachGeneralGeographic or trueGliderGroundGround checkGlide pathHail or soft hailGradual or graduallyGrass landing areaProcessed meteorological data in the form of grid pointvalues (in aeronautical meteorological code)† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

GEN 2.2 - 402 JAN 97AIP MACAUGRVLGSHH24HBNHDFHDGHELHF ‡HGTHJHLDGHNHOHOLHOSPHPAHRHSHURCNHVDFHVYHXHYRHZHZIGravelGround speedContinuous day and night serviceHazard beaconHigh frequency direction-finding stationHeadingHelicopterHigh frequency [ 3 000 to 30 000 kHz]Height or height aboveSunrise to sunsetHoldingSunset to sunriseService available to meet operational requirementsHolidayHospital aircraftHectopascalHoursService available during hours of scheduled operationsHurricaneHigh and very high frequency direction-finding stations (atthe same location)HeavyNo specific working hoursHigherDust hazeHertz (cycle per second)IAC Instrument approach chartIAF Initial approach fixIAO In and out of cloudsIAR Intersection of air routesIAS Indicated air speedIBN Identification beaconICE IcingID Identifier or identifyIDENT † IdentificationIF Intermediate approach fixIFF Identification friend/foeIFR ‡ Instrument flight rulesIGA International general aviationILS ‡ Instrument landing systemIM Inner markerIMC ‡ Instrument meteorological conditionsIMG ImmigrationIMPR Improve or improvingIMT Immediate or immediatelyINA Initial approachINBD InboundINC In cloudINCERFA † Incertainty phaseINFO † InformationINOPINPINPRINSINSINSTLINSTRINTINTER †INTLINTRGINTRPINTSFINTSTIRISAISBISOLJJANJTSTJULJUNKKGKHZKMKMHKPAKTKWLLLLAMLANLATLBLDALDGLDILENLFLGTLGTDLIHLILLIMLLZLMLMTInoperativeIf not possibleIn progressInches (dimensional unit)Inertial navigation systemInstall or installed or installationInstrumentIntersectionIntermittentInternationalInterrogatorInterrupt or interruption or interruptedIntensify or intensifyingIntensityIce on runwayInternational standard atmosphereIndependent sidebandIsolatedJanuaryJet streamJulyJuneKilogramsKilohertzKilometresKilometres per hourKilopascalKnotsKilowattsLeft (Runway identification)Locator (see LM, LO)Logical acknowledgement (message type designator)InlandLatitudePounds (weight)Landing distance availableLandingLanding direction indicatorLengthLow frequency [30 to 300 kHz]Light or lightingLightedLight intensity highLight intensity lowL.ight intensity mediumLocalizerLocator, middleLocal mean time† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

AIP MACAU GEN 2.2 -502 JAN 97LNGrequired)LOLOCLONGLORAN †LRGLSQLTDLTTLVLVELVLLYRMMMMAAMAGMAINTMAPMATPMARMARMASMAXMAYMCAMCWMDAMDFMDHMEAMEHTMET †METAR †MFMHDFMHVDFMHZMIDMIFGMILMIN*MKRMLS ‡MMMNMMNPSMNTMNTNLong (used to indicate the type of approach desired orLocator, outerLocal or locally or location or locatedLongitudeLORAN (long range air navigation system)Long rangeLine squallLimitedLandline teletypewriterLight and variable (relating to wind)Leave or leavingLevelLayer or layeredMach number (followed by figures)Metres (preceded by figures)Maximum authorized altitudeMagneticMaintenanceAeronautical maps and chartsMissed approach pointAt seaMarchManual A1 simplexMaximumMayMinimum crossing altitudeModulated continuous waveMinimum descent altitudeMedium frequency direction-finding stationMinimum descent heightMinimum en-route altitudeMinimum eye height over threshold for visual approachslope indicator systems)Meteorological or meteorologyAviation routine weather report (in aeronauticalmeteorological code)Medium frequency [300 to 3 000 kHz]Medium and high frequency direction-finding stations (atthe same location)Medium, high and very high frequency direction-findingstations (at the same location)MegahertzMid-point (related to RVR)Shallow fogMilitaryMinutesMarker radio beaconMicrowave landing systemMiddle markerMinimumMinimum navigation performance specificationsMonitor or monitoring or monitoredMaintainMOCMODMONMONMOTNEMOVMPHMPSMRAMRGMRPMSMSAMSGMSLMTMTUMTWMVDFMWOMXNMinimum obstacle clearance (required)Moderate (used to quality icing, turbulence, interferenceor static reports)Above mountainsMondayMeteorological Operational Telecommunications NetworkEuropeMove or moving or movementStatute miles per hourMetres per secondMinimum reception altitudeMedium rangeATS/MET reporting pointMinusMinimum sector altitudeMessageMean sea levelMountainMetric unitsMountain wavesMedium and very high frequency direction-finding stations(at the same location)Meteorological watch officeMixed type of ice formation (white and clear)N North or northern latitudeNAT North AtlanticNAV NavigationNB NorthboundNBFR Not beforeNC No changeNDB ‡ Non-directional radio beaconNE North-eastNEB North-eastboundNEG No or negative or permission not granted or that is notcorrectNGT NightNIL* † None or I have nothing to send to youNM Nautical milesNML NormalNNE North north eastNNW North north westNOF International NOTAM officeNOSIG † No significant change (used in trend-type landingforecasts)NOTAM † A notice containing information concerning theestablishment, condition or change in any aeronauticalfacility, service, procedure or hazard, the timelyknowledge of which is essential to personnel concernedwith flight operationsNOV NovemberNR NumberNRH No rempy heardNS NimbostratusNSC Nil significant cloudNW North-west† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

GEN 2.2 - 602 JAN 97NWB North-westboundNXT NextOOAC Oceanic area control centreOAS Obstacle assessment surfaceOBS Observe or observed or observationOBSC Obscure or obscured or obscuringOBST ObstacleOCA Obstacle clearance altitudeOCA Oceanic control areaOCC Occulting (light)OCH Obstacle clearance heightOCL Obstacle clearance limitOCNL Occasional or occasionallyOCS Obstacle clearance surfaceOCT OctoberOHD OverheadOM Outer markerOPA Opaque, white type of ice formationOPC The control indicated is operational controlOPMET † Operational meteorological (information)OPN Open or opening or openedOPR Operator or operate or operative or operating oroperationalOPS † OperationsO/R On requestORD Indication of an orderOSV Ocean station vesselOTP On topOTS Organized track systemOUBD OutboundOVC OvercastPP. . . Prohibited area (followed by identification)PALS Precision approach lighting system (specify category)PANS Procedures for air navigation servicesPAPI † Precision approach path indicatorPAR ‡ Precision approach radarPARL ParallelPAX Passenger (s)PCD Proceed or proceedingPCN Pavement classification numberPE Ice pelletsPER PerformancePERM PermanentPJE Parachute jumping exercicePLA Practice low approachPLN Flight planPLVL Present levelPN Prior notice requiredPNR Point of no returnPO Dust devilsPOB Persons on boardPPI Plan position indicatorPPR Prior permission requiredPPSN Present positionPRI PrimaryPRKG ParkingPROB † ProbabilityPROC ProcedurePROV ProvisionalPS PlusPSG PassingPSN PositionPSP Pierced steel plankPTN Procedure turnPTS Polar track structurePWR PowerQAIP MACAUQBI Compulsory IFR flightQDM ‡ Magnetic heading (zero wind)QDR Magnetic bearingQFE ‡ Atmospheric pressure at aerodrome elevation (or atrunway threshold)QFU Magnetic orientation of runwayQNH ‡ Altimeter sub-scale setting to obtain elevation when on thegroundQTE True bearingQUAD QuadrantRR RedR. . . Restricted area (followed by identification)R Right (runway identification)RA RainRAC Rules of the air and air traffic servicesRAFC Regional area forecast centreRAG RaggedRAG Runway arresting gearRAI Runway alignment indicatorRAPID † Rapid or rapidlyRASH Rain showersRASN Rain and snow or showers of rain and snowRB Rescue boatRCA Reach cruising altitudeRCC Rescue co-ordination centreRCF Radiocommunication failure (message type designator)RCH Reach or reachingRCL Runway centre lineRCLL Runway centre line light(s)RDH Reference datum height (for ILS)RDL RadialRDO RadioRE Recent (used to qualify weather phenomena such as rain,e.g. recent rain = RERA)REC Receive or receiverREDL Runway edge light(s)† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

AIP MACAU GEN 2.2 -702 JAN 97REF Reference to .... or refer to . . .REG RegistrationRENL Runway end light(s)REP Report or reporting or reporting pointREQ Request or requestedRERTE RerouteRESA Runway end safety areaRG Range (lights)RIF Reclearance in flightRITE Right (direction of turn)RL Report leavingRLA Relay toRLLS Runway lead-in lighting systemRMK RemarkRNAV † (to be pronounced “AR-NAV”) Area navigationRNG Radio rangeROBEX † Regional OPMET bulletin exchange (scheme)ROC Rate of climbROD Rate of descentROFOR Route forecast (in aeronautical meteorological code)RON Receiving onlyRPL Repetitive flight planRPLC Replace or replacedRPS Radar position symbolRQMNTS RequirementsRQP Request flight plan (message type indicator)RQS Request supplementary flight plan (message typeindicator)RR Report reachingRRA (or RRB, RRC ... etc., in sequence) Delayed meteorologicalmessage (message type designator)RSC Rescue sub-centreRSCD Runway surface conditionRSP Responder beaconRSR En-route surveillance radarRTD Delayed (used to indicate delayed meteorological message; message type designator)RTE RouteRTF RadiotelephoneRTG RadiotelegraphRTHL Runway threshold light(s)RTN Return or returned or returningRTS Return to serviceRTT RadioteletypewriterRTZL Runway touchdown zone light(s)RUT Standard regional route transmitting frequenciesRV Rescue vesselRVR ‡ Runway visual rangeRWY RunwaySS South or southern latitudeSA Duststorm, sandstorm, rising dust or rising sandSALS Simple approach lighting systemSAN SanitarySAP As soon as possibleSAR Search and rescueSARPS Standards and Recommended Practices (ICAO)SAT SaturdaySB SouthboundSC StratocumulusSCT ScatteredSDBY Stand bySE South-eastSEB South-eastboundSEC SecondsSECT SectorSELCAL † Selective calling systemSEP SeptemberSER Service or servicing or servedSEV Severe (used e.g. to qualify icing and turbulence reports)SFC SurfaceSG Snow grainsSGL SignalSH ShowersSHF Super high frequency [3 000 to 30 000 MHz]SID † Standard instrument departureSIF Selective identification featureSIGMET † Information concerning en-route weather phenomenawhich may affect the safety of aircraft operationsSIGWX Significant weatherSIMUL Simultaneous or simultaneouslySIWL Single isolated wheel loadSKC Sky clearSKED Schedule or scheduledSLP Speed limiting pointSLW SlowSMC Surface movement controlSMR Surface movement radarSN SnowSNOWTAM † A special series NOTAM notifying the presence orremoval of hazardous conditions due to snow, ice, slushor standing water associated with snow, slush and ice onthe movement area, by means of a specific formatSNSH Snow showersSPECI † Aviation selected special weather report (in aeronauticalmeteorological code)SPECIAL † Special meteorological report (in abbreviated plainlanguage)SPL Supplementary flight plan (message type designator)SPOT † Spot windSQ SquallSR SunriseSRA Surveillance radar approachSRE Surveillance radar element of precision approach radarsystemSRG Short rangeSRR Search and rescue regionSRY SecondarySS SunsetSSB Single sidebandSSE South south eastSSR ‡ Secondary surveillance radar† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

GEN 2.2 - 802 JAN 97AIP MACAUSSTSSWSTSTASTAR †STDSTFSTNSTNRSTOLSTSSTWLSUBJSUNSUPPSSVCSVCBLSWSWBSWYTTTATACAN †TAF †TAIL †TARTASTAXTCTCUTDOTDZTECRTELTEMPO †TEND †TFCTGLTGSTHRTHRUTHUTIL †TIPTKOFTMA ‡TNATNHTOTOCTODATOP †TORATPSupersonic transportSouth south westStratusStraight in approachStandard instrument arrivalStandardStratiformStationStationaryShort take-off and landingStatusStopway light(s)Subject toSundayRegional supplementary proceduresService messageServiceableSouth-westSouth-westboundStopwayTemperatureTransition altitudeUHF tactical air navigation aidAerodrome forecastTail windTerminal area surveillance radarTrue airspeedTaxiing or taxiTropical cycloneTowering cumulusTornadoTouchdown zoneTechnical reasonTelephoneTemporary or temporarilyTrend or tending toTrafficTouch-and-go landingTaxiing guidance systemThresholdThroughThursdayUntilUntil past. ...(place)Take offTerminal control areaTurn altitudeTurn heightTo...(place)Top of climbTake-off distance availableCloud topTake-off run avalaibleTurning pointTR TrackTRA Temporary reserved airspaceTRANS Transmits or transmitter`TRLVL Transition levelTROP TropopauseTS ThunderstormTSGR Thunderstorm with hailTSSA Thunderstorm with duststorm or sandstormTT TeletypewriterTUE TuesdayTURB TurbulenceTVOR Terminal OVRTWR Aerodrome control tower or aerodrome controlTWY TaxiwayTWYL Taxiway-linkTYP Type of aircraftTYPH TyphoonUUAB Until advised by ...UAC Upper area control centreUAR Upper air routeUDF Ultra high frequency direction-finding stationUFN Until further noticeUHDT Unable higher due trafficUHF ‡ Ultra high frequency [300 to 3 000 MHz]UIC Upper information regionUIR ‡ Upper flight information regionULR Ultra long rangeUNA UnableUNAP Unable to approveUNL UnlimitedUNREL UnreliableU/S UnservicableUTA Upper control areaUTC ‡ Co-ordinated universal timeVVAC Visual approach chartVAL In valleysVAN Runway control vanVAR Magnetic variationVAR Visual-aural radio rangeVASIS † Visual approach slope indicator systemVCY VicinityVDF Very high frequency direction-finding stationVER VerticalVFR ‡ Visual flight rulesVHF ‡ Very high frequency [30 to 300 MHz]VIP ‡ Very important personVIS VisibilityVLF Very low frequency [3 to 30 kHz]VLR Very long rangeVMC ‡ Visual meteorological conditionsVOLMET † Meteorological information for aircraft in flight† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China

AIP MACAU GEN 2.2 -905 APR 2001VOR ‡ VHF omnidirectional radio rangeVORTAC † VOR and TACAN combinationVOT VOR airborne equipment test facilityVRB VariableVSA By visual reference to the groundVSP Vertical speedVTOL Vertical take-off and landingWW West or western longitudeW WitheWAC World Aeronautical Chart - IACO 1:1 000 000WAFC World area forecast centreWB WestboundWBAR Wing bar lightsWDI Wind direction indicatorWDSPR WidespreadWED WednesdayWEF With effect from or effective fromWI WithinWID WidthWIE With immediate effect or effective immediatelyWILCO † Will complyWINTEM Forescast upper wind and temperature for aviationWIP Work in progressWKN Weaken or weakeningWNW West north westWO WithoutWPTWRNGWSWSWWTWTSPTWXXXXBARXNGXSXXYYYCZYDYRWay-pointWarningWind shearWest south westWeightWaterspoutWeatherCrossCrossbar (of approach lighting system)CrossingAtmosphericsHeavdy (used to qualify weather phenomena such as rain,e.g. heavy rain = XXRA)YellowYellow caution zone (runway lighting)YardsYourAAACMADAAMAOCCATIRFBBPSCCAACCADNon ICAO abbreviations used in the Integrated Aeronautical Information Package elements Published By MacauCivil Aviation AuthorityMacau, ChinaAdministration of Airports Ltd.Air Macau Company Ltd.Airport Operation CoordinationCenterAir Traffic Incident Report FormBit Per SecondThe General Administration ofCivil Aviation of ChinaCivil Aviation Department ofHong KongCAMCO 2FMacau International AirportCompanyCarbon DioxideFBU Flight briefing unit (AISAerodrome Unit)FIU Flight Information Unit (AIC,METEO and Dispatch OfficeService)HHKDHPKKNKVAHong Kong dollar(s)Hourse PowerKilo NewtonKilo Volt AmpLLDD/dLVOLVPMMOPPPARAPIBUUS$Landline data circuit, digitalLow visibility operationsLow visibility proceduresMacau Pataca(s) (local currency)ParagraphPre-flight Information BulletinAmerican dollar(s)† When radiotelephony is used, the abbreviations and terms are transmitted as spoken words.‡ When radiotelephony is used, the abbreviations and terms are transmitted using the individual letters in non-phonetic form.* Abbreviation is also available for use in communicating with stations of the maritime mobile service.Civil Aviation Authority - Macau, China AMDT 09

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 2.3 - 130 JUL 98GEN 2.3 CHART SYMBOLSGENERAL SYMBOLSINSTRUMENT APPROACH CHARTRADIO NAVIGATION FACILITIESVORDMEVOR DMENDB and LOCATORRelief100200030Basic radio facility symbolWith obstructionROUTESTrack025°A 901212FLFlight levelName of the routeHolding FixDistance in NMScale-breakOn requestreporting pointCompulsoryreporting pointMissed approachAirportAREASATZ• • • •• •• • • •FIR boundaryRestricted airspace(prohibited, dangerand restricted )ZG R 52VISUAL APPROACH AND LANDING CHARTDisplaced thresholdPAPIRunwayStop way, clear wayOBSTRUCTIONSUnlightedLighted604(584)Elevation on top(AMSL)Height(AGL)TaxiwayHelipadAircraft circuitHAircraft parkingSpot elevation5Wind direction indicator unlightedlightedHelicopter circuitTransmissometreCTOPOGRAPHYContoursAREA, STAR AND SID CHARTSMinimum safe altitude 25AirportVOR RadialMotorway or road with motorway caracteristicLarge roadOther important roadImportantbuildingsBuilt-up area105030EscarpmentR 160° ZAO11.5 NM MCUDME DistanceTree/Grass zoneWater areaMarine light or beaconCIVIL AVIATION AUTHORITY OF MACAU

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 2.4 -125 JUL 2002GEN 2.4 LOCATION INDICATORS1. ENCODE2. DECODELocationIndicatorIndicatorLocationMACAO/ INTL AIRPORTVMMCVMMCMACAO / INTL AIRPORTMACAO/ HELIPORTVMMHVMMHMACAO / HELIPORTHONK KONG FIRVHHKVHHKHONG KONG FIRZHUHAI APPZGJDZGJDZHUHAI APPGUANGZHOU ACCZGGGZGGGGUANGZHOU ACCCivil Aviation Authority - Macao, China AMDT 11

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 2.5 - 102 JAN 97GEN 2.5 LIST OF RADIO NAVIGATION AIDSID Station Name Facility PurposeMCU MACAU DVOR / DME AMCS MACAU LLZ / DME AMCN MACAU LLZ / DME AZAO JIUZHOU DVOR ANote: A = AerodromeE = EnrouteAE = dual purposeCivil Aviation Authority of Macau

INTENTIONALLYLEFTBLANK

AIP MACAU GEN 2.6 - 102 JAN 97GEN 2.6 CONVERSION TABLESNM to kmNM = 1.852 kmkm to NM1 km = 0.54 NMft to m1 ft = 0.3048 mm to ft1 m = 3.281 ftNMkmkmNMftmmft0.1 0.1850.2 0.3700.3 0.5560.4 0.7410.5 0.9260.6 1.1110.7 1.2960.8 1.4820.9 1.6671 1.8522 3.7043 5.5564 7.4085 9.2606 11.1127 12.9648 14.8169 16.66810 18.52020 37.04030 55.56040 74.08050 92.60060 111.12070 129.64080 148.16090 166.680100 185.200200 370.400300 555.600400 740.800500 926.0000.1 0.050.2 0.110.3 0.160.4 0.220.5 0.270.6 0.320.7 0.380.8 0.430.9 0.491 0.542 1.083 1.624 2.165 2.706 3.247 3.788 4.329 4.8610 5.4020 10.8030 16.2040 21.6050 27.0060 32.4070 37.8080 43.2090 48.60100 54.00200 107.99300 161.99400 215.98500 269.981 0.3052 0.6103 0.9144 1.2195 1.5246 1.8297 2.1348 2.4389 2.74310 3.04820 6.09630 9.14440 12.19250 15.24060 18.28870 21.33680 24.38490 27.432100 30.480200 60.960300 91.440400 121.920500 152.400600 182.880700 213.360800 243.840900 274.3201000 304.8002000 609.6003000 914.4004000 1219.2005000 1524.0006000 1828.8007000 2133.6008000 2438.4009000 2743.20010000 3048.0001 3.282 6.563 9.844 13.125 16.406 19.697 22.978 26.259 29.5310 32.8120 65.6230 98.4340 131.2350 164.0460 196.8570 229.6680 262.4790 295.28100 328.08200 656.17300 984.25400 1312.34500 1640.42600 1968.50700 2296.59800 2624.67900 2952.761000 3280.842000 6561.683000 9842.524000 13123.365000 16404.20Civil Aviation Authority of Macau

GEN 2.6 - 202 JAN 97AIP MACAUFrom decimal minutes of an arc to seconds of an arcminsecminsecminsecminsec0.01 0.60.02 1.20.03 1.80.04 2.40.05 3.00.06 3.60.07 4.20.08 4.80.09 5.40.10 6.00.11 6.60.12 7.20.13 7.80.14 8.40.15 9.00.16 9.60.17 10.20.18 10.80.19 11.40.20 12.00.21 12.60.22 13.20.23 13.80.24 14.40.25 15.00.26 15.60.27 16.20.28 16.80.29 17.40.30 18.00.31 18.60.32 19.20.33 19.80.34 20.40.35 21.00.36 21.60.37 22.20.38 22.80.39 23.40.40 24.00.41 24.60.42 25.20.43 25.80.44 26.40.45 27.00.46 27.60.47 28.20.48 28.80.49 29.40.50 30.00.51 30.60.52 31.20.53 31.80.54 32.40.55 33.00.56 33.60.57 34.20.58 34.80.59 35.40.60 36.00.61 36.60.62 37.20.63 37.80.64 38.40.65 39.00.66 39.60.67 40.20.68 40.80.69 41.40.70 42.00.71 42.60.72 43.20.73 43.80.74 44.40.75 45.00.76 45.60.77 46.20.78 46.80.79 47.40.80 48.00.81 48.60.82 49.20.83 49.80.84 50.40.85 51.00.86 51.60.87 52.20.88 52.80.89 53.40.90 54.00.91 54.60.92 55.20.93 55.80.94 56.40.95 57.00.96 57.60.97 58.20.98 58.80.99 59.4From seconds of an arc to decimal minutes of an arcsecminsecminsecminsecmin1 0.022 0.033 0.054 0.075 0.086 0.107 0.128 0.139 0.1510 0.1711 0.1812 0.2013 0.2214 0.2315 0.2516 0.2717 0.2818 0.3019 0.3220 0.3321 0.3522 0.3723 0.3824 0.4025 0.4226 0.4327 0.4528 0.4729 0.4830 0.5031 0.5232 0.5333 0.5534 0.5735 0.5836 0.6037 0.6238 0.6339 0.6540 0.6741 0.6842 0.7043 0.7244 0.7345 0.7546 0.7747 0.7848 0.8049 0.8250 0.8351 0.8552 0.8753 0.8854 0.9055 0.9256 0.9357 0.9558 0.9759 0.98Civil Aviation Authority of Macau

AIP MACAU GEN 2.7 - 130 JUL 98GEN 2.7 SUNRISE/SUNSET TABLES1 The times in the sunrise and sunset tables are in Macau Standard Time (UTC + 8).Although these times vary a little from year to year, the times of sunrise and sunset arewithin one or two minutes for any year.2 Station Name : Macau International AirportICAO Location Indicator : VMMCGeographical Coordinates : 22°08’58” N 113°35’29” E2.1 Sunrise TableDAY/Month JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC1 07 05 07 05 06 48 06 18 05 54 05 42 05 46 05 58 06 09 06 18 06 29 06 482 07 05 07 05 06 48 06 18 05 54 05 42 05 46 05 59 06 09 06 18 06 29 06 483 07 05 07 04 06 48 06 18 05 54 05 42 05 47 05 59 06 09 06 18 06 32 06 504 07 06 07 04 06 46 06 16 05 52 05 42 05 47 05 59 06 10 06 19 06 32 06 505 07 06 07 04 06 43 06 16 05 52 05 42 05 47 06 00 06 10 06 19 06 32 06 506 07 06 07 03 06 43 06 16 05 52 05 42 05 48 06 00 06 10 06 19 06 33 06 527 07 07 07 03 06 43 06 13 05 50 05 42 05 48 06 00 06 11 06 20 06 33 06 528 07 07 07 03 06 41 06 13 05 50 05 42 05 48 06 01 06 11 06 20 06 33 06 529 07 07 07 01 06 41 06 13 05 50 05 42 05 49 06 01 06 11 06 20 06 35 06 5410 07 07 07 01 06 41 06 10 05 49 05 42 05 49 06 01 06 11 06 20 06 35 06 5411 07 07 07 01 06 38 06 10 05 49 05 42 05 49 06 02 06 11 06 20 06 35 06 5412 07 07 06 59 06 38 06 10 05 49 05 42 05 50 06 02 06 11 06 20 06 36 06 5613 07 08 06 59 06 38 06 07 05 48 05 42 05 50 06 02 06 12 06 21 06 36 06 5614 07 08 06 59 06 36 06 07 05 48 05 42 05 50 06 03 06 12 06 21 06 36 06 5615 07 08 06 57 06 36 06 07 05 48 05 42 05 51 06 04 06 12 06 21 06 38 06 5716 07 08 06 57 06 36 06 05 05 46 05 42 05 51 06 04 06 13 06 23 06 38 06 5717 07 08 06 57 06 33 06 05 05 46 05 42 05 51 06 05 06 13 06 23 06 38 06 5718 07 08 06 55 06 33 06 05 05 46 05 43 05 52 06 05 06 13 06 23 06 40 06 5919 07 08 06 55 06 33 06 03 05 44 05 43 05 52 06 05 06 15 06 24 06 40 06 5920 07 08 06 55 06 29 06 03 05 44 05 43 05 52 06 05 06 15 06 24 06 40 06 5921 07 08 06 53 06 29 06 03 05 44 05 43 05 54 06 05 06 15 06 24 06 42 07 0122 07 07 06 53 06 29 06 00 05 44 05 43 05 54 06 05 06 16 06 25 06 42 07 0123 07 07 06 53 06 26 06 00 05 44 05 43 05 54 06 06 06 16 06 25 06 42 07 0124 07 07 06 51 06 26 06 00 05 44 05 44 05 55 06 06 06 16 06 25 06 45 07 0225 07 06 06 51 06 26 05 58 05 43 05 44 05 55 06 06 06 17 06 27 06 45 07 0226 07 06 06 51 06 24 05 58 05 43 05 44 05 55 06 07 06 17 06 27 06 45 07 0227 07 06 06 48 06 24 05 58 05 43 05 45 05 56 06 07 06 17 06 27 06 46 07 0328 07 06 06 48 06 24 05 56 05 42 05 45 05 56 06 07 06 17 06 28 06 46 07 0329 07 06 (06 49) 06 21 05 56 05 42 05 45 05 56 06 08 06 17 06 28 06 46 07 0330 07 06 06 21 05 56 05 42 05 46 05 58 06 08 06 17 06 28 06 48 07 0531 07 05 06 21 05 42 05 58 06 08 06 29 07 05NOTE : ( ) sunrise time on 29th February in Leap year.Civil Aviation Authority of Macau

GEN 2.7 - 202 JAN 97AIP MACAU2.2 Sunset TableDAY/Month JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC1 17 54 18 15 18 30 18 41 18 53 19 06 19 13 19 07 18 42 18 13 17 49 17 412 17 54 18 15 18 31 18 41 18 53 19 06 19 13 19 05 18 42 18 13 17 49 17 413 17 54 18 15 18 31 18 41 18 53 19 07 19 14 19 05 18 42 18 13 17 47 17 424 17 56 18 16 18 31 18 42 18 54 19 07 19 14 19 05 18 39 18 10 17 47 17 425 17 56 18 16 18 32 18 42 18 54 19 07 19 14 19 04 18 39 18 10 17 47 17 426 17 56 18 18 18 32 18 42 18 54 19 08 19 14 19 04 18 39 18 10 17 46 17 427 17 58 18 18 18 32 18 43 18 55 19 08 19 14 19 04 18 37 18 08 17 46 17 428 17 58 18 18 18 33 18 43 18 55 19 08 19 14 19 02 18 37 18 08 17 46 17 429 17 58 18 20 18 33 18 43 18 55 19 09 19 13 19 02 18 37 18 08 17 45 17 4310 17 50 18 20 18 33 16 44 18 56 19 09 19 13 19 02 18 34 18 05 17 45 17 4311 18 00 18 20 18 34 18 44 18 56 19 09 19 13 19 00 18 34 18 05 17 45 17 4312 18 00 18 22 18 34 18 44 18 56 19 10 19 13 19 00 18 34 18 05 17 44 17 4413 18 02 18 22 18 34 18 46 18 57 19 10 19 13 19 00 18 31 18 03 17 44 17 4414 18 02 18 22 18 34 18 46 18 57 19 10 19 13 18 58 18 31 18 03 17 44 17 4415 18 02 18 24 18 34 18 46 18 57 19 11 19 13 18 58 18 31 18 03 17 43 17 4516 18 04 18 24 18 34 18 47 18 59 19 11 19 13 18 58 18 28 18 00 17 43 17 4517 18 04 18 24 18 37 18 47 18 59 19 11 19 13 18 55 18 28 18 00 17 43 17 4518 18 04 18 25 18 37 18 47 18 59 19 12 19 12 18 55 18:28 18 00 17 42 17 4719 18 06 18 25 18 37 18 48 19 01 19 12 19 12 18 55 18 26 17 57 17 42 17 4720 18 06 18 25 18 36 18 48 19 01 19 12 19 12 18 53 18 26 17 57 17 42 17 4721 18 06 18 26 18 38 18 48 19 01 19 12 19 11 18 53 18 26 17 57 17 41 17 4822 18 09 18 26 18 38 18 49 19 02 19 12 19 11 18 53 18 23 17 55 17 41 17 4823 18 09 18 26 18 39 18 49 19 02 19 12 19 11 18 50 18 23 17 55 17 41 17 4824 18 09 18 28 18 39 18 49 19 02 19 13 19 10 18 50 18 23 17 55 17 41 17 5025 18 11 18 28 16 39 18 50 19 03 19 13 19 10 18 50 18 18 17 53 17 41 17 5026 18 11 18 28 18 40 18 50 19 03 19 13 19 10 18 48 18 18 17 53 17 41 17 5027 18 11 18 29 18 40 18 50 19 03 19 13 19 08 18 48 18 18 17 53 17 41 17 5128 18 13 18 29 18 40 18 52 19 04 19 13 19 08 18 48 18 15 17 51 17 41 17 5129 18 13 (18 30) 18 41 18 52 19 04 19 13 19 08 18 45 18 15 17 51 17 41 17 5130 18 13 18 41 18 52 19 04 19 13 19 07 18 45 18 15 17 51 17 41 17 5331 18 15 18 41 19 06 19 07 18 45 17 49 17 53NOTE : ( ) sunset time on 29th February in Leap year.Civil Aviation Authority of Macau

AIP MACAO GEN 3.1-127 MAR 2008GEN 3. SERVICESGEN 3.1 AERONAUTICAL INFORMATION SERVICES1 Responsible service1.1 Aeronautical AuthorityThe Authority responsible for AIS in Macao, China is the Civil Aviation Authority.Postal Address : Alameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, ChinaAFTN Address : VMMCYAYITelephone Number : (853) 2851 1213Fax Number : (853) 2833 80891.2 Organisation of Aeronautical Information Service1.2.1 The Aeronautical Information Service is a section of the Airport Infrastructure and AirNavigation Department of the Civil Aviation Authority.1.2.2 The International NOTAM Office is a delegated responsibility of the Macao InternationalAirport management and is located at the following address :Postal Address : ADA - Administration of Airports, AIC ServiceMacau International AirportPAC ON TaipaMacao, ChinaAFTN Address : VMMCYNYXTelephone Number : (853) 2886 1111 Ext. 2203Fax Number : (853) 2886 11451.3 The services are provided in accordance with the provisions contained in ICAO 15Aeronautical Information Services.2 Area of responsibility of AISThe Aeronautical Information Service is responsible for the collection and dissemination ofinformation relating to the Macao Aerodrome Traffic Zone (Macao ATZ).3 Aeronautical publicationsAeronautical information is published as an Integrated Aeronautical Information Package bythe Civil Aviation Authority.Civil Aviation Authority – Macao, China AMDT 15

GEN 3.1-201 FEB 2007AIP MACAOThe Integrated Aeronautical Information Package consists of the following elements :a) AIP, including amendment service ;b) Supplements to the AIP ;c) NOTAMs and PIB ,d) AIC ;e) Checklists and Summaries.3.2 AIP MacaoThe AIP is the basic source for permanent information and long duration temporary changes,which are essential for the safety of air navigation. The AIP is published in one volume andcontains all relevant information for international civil aviation. It is published in Englishand updated by means of AIP amendments and/or supplemented by means of AIPSupplements.3.3 Amendment serviceThe AIP amendments consist of new and/or reprinted pages and, in case of minor changes,of a list with manuscript corrections called hand corrections. In order to facilitate their use,the reprinted pages will contain a vertical line preceding the changes which have beenincorporated.There are two types of amendments :- Regular amendments containing permanent information which is not of operationalsignificance for the safe conduct of a flight and does not require an advanced notificationto the users. These amendments are published in a regular interval of 4 weeks theAIRAC publication dates will be used for the issuing of regular amendments.The numbering of these amendments is consecutive.- AIRAC amendments, containing permanent information which is of operationalsignificance for the safe conduct of a flight and requires an advanced notification to theusers. AIRAC amendments are published 42 days in advance of the effective date.Therefore, the pages of these amendments shall not be introduced within the AIP upontheir receipt ; correct procedure will be the insertion of such pages only on the effectivedate.- The numbering of these amendments is consecutive and based on the calendar year i.e.AIP AIRAC AMDT NR 2/95, meaning that it is the 2nd AIRAC AMDT issued in theyear of 1995. When no AIRAC information has been issued for a given effective date,an “AIRAC NIL” notification will be published by NOTAM, at least 28 days in advanceof the effective date concerned.Cover page on this type of amendments will be coloured (pink).Civil Aviation Authority – Macao, China AMDT 14

AIP MACAO GEN 3.1-301 Feb 20073.4 AIP supplementsAIP Supplements are used to publish temporary information of long duration (3 months orlonger) and/or information of operational significance containing comprehensive texts,charts or diagrams, even if this information is of short duration (less than 3 months). Theinformation is to be inserted within the AIP, at the beginning of the appropriate subsection,following the indications given on the cover sheet of each supplement.AIP Supplements may have a defined period validity or an estimate date of terminus. Ineach case of supplement must be kept within the AIP during the complete period of validity.The supplements may be cancelled (or replaced) by other supplements, by AIP amendmentor by NOTAM.There are two types of supplements :- Regular supplements, containing information which is not of operational significance forthe safe conduct of a flight and does not require an advanced notification to the users.These supplements are published whenever necessary.- AIRAC supplements, containing information which is of operational significance for thesafe conduct of a flight and requires an advanced notification to the users. AIRACprocedures will be followed as for the amendments (see 3.3 above).The numbering of the supplements will be consecutive and based on the calendar year.The cover page of each supplement will give indications on the subject (s), validity, correctplace for the introduction of the supplement pages, and NOTAM cancellation orreplacement by the supplement. All Supplements are coloured (yellow) in order to beconspicuous, no differentiation is made between regular and AIRAC supplements (theacronym AIRAC will appear in bold on the front page of the AIRAC type supplements). Achecklist of supplements in force will be published each month by means of the monthlyprinted plain language summary of NOTAM in force.3.5 NOTAM and Pre-flight Information Bulletins (PIB)NOTAM are distributed by telecommunications (AFTN) only. They are distributed by theMacao International NOTAM office as follows :- One single series A containing information about Macau International Airport andMacao Heliport, information of interest to both international and domestic recipients,such as regulations and procedures, air/ground communications, navigation warningsand unserviceability of air navigation obstacles lights in accordance with ICAO Annex15 paragraph 5.1.1.1.- A checklist of NOTAM in force is issued every month.- NOTAM are distributed to all states which interchange NOTAM information withMacao International NOTAM office.Civil Aviation Authority – Macao, China AMDT 14

GEN 3.1-401 FEB 2007Macao International NOTAM Office - NOTAM interchangeAIP MACAOICAO Location NOTAM Office Rec. Series Country Received SendIndicatorAGGHYNYX Honiara Solomon Is. xANAUYNYX Nauru A Nauru x xAYPMYNYX Port Moresby A Papua N. G. xBIRKYNYX Reykjavik A Iceland xCYHQYNYX Ottawa A/B Canada x xEBBRYNYX Bruxelles A Belgium x xEDDZYNYX Frankfurt A Germany x xEETNYNYX Tallinn A Estonia x xEFHKYNYX Helsinki A Finland x xEGGNYNYX London A/B United Kingdom x xEHAMYNYX Amsterdam A Netherlands x xEHMCYNYX Amsterdam M Netherlands x xEINNYNYX Shannon A Ireland x xEKCHYNYX Kobenhavn A Denmark xENGMYNYX Oslo A/C/D/G/H/P Norway xEPWWYNYX Warsaw A Pologne xESSAYNYX Stockholm A/B Sweden x xFAJSYNYX Johannesburg A South Africa X xFSIAYNYX Mahe A Seychelles x xHECAYNYX Cairo A/W Egypt x xHKJKYNYX Nairobi A Kenya x xKDCAYNYX Washington A + (1) United States x xLBSFYNYX Sofia A Bulgaria x xLCNCYNYX Nicosia A Cyprus x xLDZAYNYX Zagreb A Croatia x xLEANYNYX Madrid A Spain x xLFFAYNYX Paris A France x xLGGGYNYX Athinai A/B Greece x xLHBPYNYX Budapest A Hungary x xLIIAYNYX Rome A/W Italia x xLJLAYNYX Wien Ljubljana A Slovenia x xLKPRYNYX Praha A Czech Rep. xLLADYNYX Tel Aviv A Israel x xLMMMYNYX Malta A Malta x xLOWWYNYX Wien A Austria x xLPPPYNYX Lisboa A Portugal x xLRBBYNYX Bucaresti A/B Romania x xLSSNYNYX Zurich A Switzerland x xLTAAYNYX Ankara A/B/C Turkey x xLYBBYNYX Beograd A Srbija/Crna xGora/Serbia andMontenegroLZIBYNYX Bratislava A Slovakia xNFOFYNYX Nadi A Fiji x xNZCHYNYX Christchurch B/P New Zealand x xOAKBYNYX Kabul A Afghanistan xOBBBYNYX Bahrain A Bahrain x xOEJDYNYX Jeddah A Saudi Arabia x xOIIIYNYX Tehran A Iran x xOJAIYNYX Amman A Jordan x xOKNOYNYX Kuwait A Kuwait x xOMAEYNYX Abu-Dhabi A Un. Arab Em. x xOOMSYNYX Muscat A Oman x xOPKCYNYX Karachi A Pakistan x xOSDIYNYX Damascus A Syrian xRJAAYNYX Tokyo A Japan x xRKRRYNYX Seoul A Korea x xRPLLYNYX Manila B Phillipines x xUAAKYNYX Almaty K Kazakhstan X xUBBUYNYX Baku A Azerbaijan xUDDDYNYX Armenia A Armenia X xUGGGYNYX Tbilisi G/N Georgia xUKKRYNYX Ukraine A/B Ukraine x xUTTAYOYX Tashkent D Uzbekistan xUUUUYNYX Moskva A Russia x xVABBYNYX Bombay A India x xVCCCYNYX Colombo A Sri Lanka x xVDPPYNYX Phnom-Penh A/B Cambodia x xCivil Aviation Authority – Macao, China AMDT 14

AIP MACAO GEN 3.1-501 FEB 2007Macao International NOTAM Office - NOTAM interchange (continue)ICAO Location NOTAM Office Rec. Series Country Received SendIndicatorVECCYNYX Calcutta A India x xVGZRYNYX Dhaka A Bangladesh x xVHHHYNYX Hong Kong A Hong Kong x xVIDPYNYX New Delhi A/G India x xVLAOYNYX Vientiane A Laos x xVNKTYNYX Kathmandu A Nepal x xVOMMYNYX Madras A India x xVRMMYNYX Male A Maldives x xVTBDYNYX Bangkok A Thailand x xVVVVYNYX Ho-Chi-Minh B Vietnam x xVYYYYNYX Yangon A/B Myanmar x xWBSBYNYX Brunei A Brunei x xWMKKYNYX Kuala Lumpur A/D Malaysia x xWRRRYNYX Jakarta A/B Indonesia X xWSSSYNYX Singapore A Singapore x xYBBBYNYX Brisbane G/N/S Australia x xZBBBYNYX Beijing A China x xZKKKYNYX Pyong Yang A North Korea x X(1) Following location ind.- KDCA, KFDC, KLAS, KLAX, KOAK KSEA, KSFO, KZLA, KZOA.,KZSE, PAFA, PANC, PAZA, PGRO,PGSN, PGWT, PGZU, PHNL, PHJR, PMDY.Route bulletins, aerodrome bulletins and list of valid NOTAM are available for distributionat AIC service in Macau International Airport.3.6 Aeronautical Information Circular (AIC)AIC contains information of general technical interest and information relative toadministrative matters which is not appropriate to the AIP or NOTAM. AICs are distributedin two series:Series A - containing information for international distributionSeries B - containing information for local distributionAIC concerning matters for both international and local interest are available in English. Theserial number of each series starts with number 1 on the 1st of January each year. AChecklist of AIC currently in force is issued at the end of each calendar year.3.7 Checklists and summariesChecklists and summaries are administrative material without operational significance.Their purpose is to help recipients of the elements of the integrated package verifying thecontinuity and validity of the information they handle. A Printed Plain Language Summaryof NOTAM in force is issued on the 1st day of every month. It also contains a checklist ofthe AIP Supplements currently in force and an indication of the latest publications issued.Distribution is made to all recipients of the integrated package elements.Civil Aviation Authority – Macao, China AMDT 14

GEN 3.1-601 FEB 2007AIP MACAO3.8 Sale of publicationsApplication for purchase of the AIP MACAO and subscription to amendment service shouldbe sent to :Alameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, China4 AIRAC systemIn order to control and regulate the flow of information implying amendments to charts,route manuals, Flight Management Systems, etc., whenever possible such information willbe issued on predetermined dates according to the AIRAC system. This type of informationwill be published as AIRAC AIP amendments or AIRAC AIP supplements.Whenever major changes are being planned, and where additional notice is desirable (andpracticable), the publication date will be 56 days in advance of the AIRAC effective date. Atthe AIRAC publication date a NOTAM giving a short description of the contents of theAIRAC amendment or supplement, will be issued. When no AIRAC information has beenissued an "AIRAC NIL" information will be issued by NOTAM, at least 28 days in advanceof the AIRAC effective date.The predetermined dates of the AIRAC system are published every year by means of anAIC.5 Pre-flight Information Service5.1 A pre-flight information service unit is available at Macau International Airport.5.2 Pre-flight information is provided by means of up-dated Pre-Flight Information Bulletins orby display of aeronautical documents for self-briefing. Verbal briefing might be provided onrequest.5.2.1 PIB will contain both aerodrome and en-route information (including navigation warning),related to the Macao Pre-Flight Coverage Zone.Civil Aviation Authority – Macao, China AMDT 14

AIP MACAO GEN 3.1-725 JUL 20025.3 Macao Flight Briefing Unit coverage zone :ASIAEUROPEPACIFICN. AMERICAAUSTRALASIAMID ASIAAFRICABangladeshAustriaGuamCanadaAustraliaBahrainSeychellesCambodiaBelgiumHawaii(west coast)New ZealandKuwaitSouth AfricaChinaHong KongBulgariaCzech RepUSA(west coast)Papua-NewGuineaMauritiusSaudi ArabiaIranDenmarkUnited Arab EmiratesJapanFranceMacaoGermanyMalaysiaGreeceMaldivesHungaryMyanmarIrelandNorth KoreaItalyPakistanLuxembourgPhilippinesMacedoniaRussiaNeitherlands(Asian Part)NorwaySingaporePolandSouth KoreaPortugalThailandRomaniaVietnamRussia(European part)SlovaquiaSloveneSpainSwedenSwitzerlandTurkeyUKYugoslaviaCivil Aviation Authority – Macao, China AMDT 11

INTENTIONALLYLEFTBLANK

GEN 3.2 - 201 FEB 2007AIP MACAOb) Aircraft Parking / Docking Chart - ICAOThis chart provides information to facilitate the ground movement of aircraft betweenthe taxiways and the aircraft stands and the parking / docking of aircraft cannot beshown with sufficient clarity on Aerodrome Chart.c) Aerodrome Obstacle Chart - ICAO - Type AThis chart contains detailed information on obstacles in the take-off flight path areasof the aerodrome. It is shown in plan and profile view.d) Precision Approach Terrain Chart - ICAOThis chart provides detailed terrain profile information within a defined portion of thefinal approach so as to enable aircraft operating agencies to assess the effect of theterrain on decision height determination by the use of radio altimeter.e) Area Chart - ICAOThis chart shows in detail the terminal routings and air traffic services system forarriving flights.f) Standard Arrival Chart - Instrument (STAR) - ICAOThis chart provides the flight crew with information that will enable them to complywith the designated standard arrival route - instrument from the en-route phase to theapproach phase.g) Standard Departure Chart - Instrument (SID) - ICAOThis chart provides the flight crew with information that will enable them to complywith the designated standard departure route - instrument from the take-off phase tothe en-route phase.h) Instrument Approach Chart - ICAOThis chart provides the flight crew with information that will enable them to performan approved instrument approach procedure to the runway of intended landingincluding the missed approach procedure and where applicable, associated holdingpatterns.i) Visual Approach Chart - ICAOThis chart provides information on aerodrome, obstacles, designated airspace, visualapproach information, radio navigation aids and communication facilities.AMDT 14Civil Aviation Authority – Macao, China

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 3.3 - 101 FEB 20071. Responsible AuthorityGEN 3.3 AIR TRAFFIC SERVICESThe Authority responsible for the overall administration of air traffic services forinternational civil aviation is the Civil Aviation Authority.Postal Address: Civil Aviation AuthorityAlameda Dr. Carlos D’Assumpção, 336-342Centro Comercial Cheng Feng, 18º andarMacao, ChinaAFTN Address: VMMCYAYXTelephone Number: (853) 2851 1213Fax Number: (853) 2833 8089The services are provided in accordance with the provisions contained in the followingICAO documents:Annex 2 - Rules of the AirAnnex 11 - Air Traffic ServicesDoc 4444 - Procedures for Air Navigation Services - Rules of the Air and Air TrafficServices (PANS-ATM)Doc 8168 - Procedures for Air Navigation Services - Aircraft Operations (PANS-OPS)Doc 7030 - Regional Supplementary ProceduresDifferences to these provisions are detailed in subsection GEN 1.7.2. Area of ResponsibilityThe Macau ATZ lies at the southeast edge of the Guangzhou Flight Information Regionabutting the Hong Kong Flight Information Region. Air Traffic Control is exercised in allcontrolled airspace. All flight information, air traffic control and alerting services areprovided by Guangzhou and Hong Kong Area Control Centres respectively.3. Type of Services3.1. An Aerodrome Traffic Zone is established at Macau aerodrome. Flight information, airtraffic control and alerting services within ATZ are provided by Zhuhai, Hong Kongapproach and Macau aerodrome control.3.2. ENR 1.4 describes the airspace designated for air traffic service purposes.3.3. In general, the air traffic rules and procedures in force and the organisation of air trafficservices in Macao are in conformity with ICAO Standards, Recommended Practices andProcedures.4. Co-ordination between the operator and ATSCo-ordination between the operator and air traffic services is effected in accordance with2.15 of ICAO ANNEX 11 and 2.1.1.4 and 2.1.1.5 of Part VIII of the Procedure for Airnavigation Services — Rules of the Air and Air Traffic Services (Doc 4444, PANS-ATM).Civil Aviation Authority – Macao, China AMDT 14

GEN 3.3 - 201 FEB 2007AIP MACAO5. Minimum flight altitudeThe minimum flight altitude on the ATS routes, as presented in Hong Kong AIP and ChinaAIP.6. Air Traffic ServicesCivil Aviation Authority delegated the provision of air traffic services in Macau ATZ toMacau International Airport Management:Postal Address: ADA-Administration of Airports Ltd., ATS DivisionMacau International AirportPAN ON, TaipaMACAOAFTN Address: VMMCYGYXTelephone Number: (853) 8982826Fax Number: (853) 2886 1294PABX Number: (853) 2886 1111AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 3.4 - 127 MAR 20081. Responsible serviceGEN 3.4 COMMUNICATION SERVICES1.1. The organisation responsible for the operation of aeronautical communication andnavigational facilities at Macao is ADA — Administration of Airports Ltd..Postal Address :ADA - Administration of AirportsMacau International AirportPAC ON TaipaMacao, ChinaAFTN Address : VMMCYNYXTelephone Number : (853) 2886 1111Fax Number : (853) 2886 2222The service is provided in accordance with the provisions contained in the following ICAOdocuments:Annex 10 Aeronautical TelecommunicationsDOC 7030 Regional Supplementary ProceduresDOC 7910 Location IndicatorsDOC 8400 Procedures for Air Navigation Services — ICAO Abbreviations and Codes(PANS-ABC)DOC 8585 Designators for Aircraft Operating Agencies, Aeronautical Authorities andServicesNote: LLZ RWY 16 (MCS) offset not in compliance of ICAO ANNEX 10 classification,as mentioned in GEN 1.7 - 32. Area of responsibility2.1. Arrangements for aeronautical radio communication and navigation services on acontinuing basis within the Macao ATZ should be made with the Civil Aviation Authority,who is also responsible for the application of the regulations concerning the design, typeand installation of radio station on Macao registered aircraft.Civil Aviation Authority – Macao, China AMDT 15

GEN 3.4 - 201 FEB 20073. Type of services3.1. Radio and Radar Navigation Service3.1.1. The following types of radio aids to navigation are available:AIP MACAO- Instrument Landing System (ILS)- Doppler VHF Omnidirectional Radio Range (D-VOR)- Distance Measuring Equipment (DME)- Instrument Guidance System (IGS) (LLZ/DME)3.1.2. Radar:Primary and secondary radars existing not to be used for radar control. Radar is used fortraffic observation and on emergency situations.3.2. Mobile serviceThe aeronautical stations maintain a continuous watch on their stated frequencies duringthe published hours of service unless otherwise notified. In all air-ground radiocommunications English language is in use.3.3. Broadcasting servicesMeteorological broadcasts are available for the use of aircraft in flight. Full details aregiven in subsection GEN 3.5.3.4. Language used: English.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAU GEN 3.4 - 305 APR 2001AERONAUTICAL FIXED SERVICES - INTERNATIONAL AND NATIONAL CIRCUITS *STATION CORRESPONDENT NUMBER AND RADIO FREQUENCIES TYPE HOURSName Location Call Sign Name Call Sign TYPE OF Trans Rec OF (UTC) REMARKSIndicator CHANNELS kHz kHz TRAFFIC1 2 3 4 5 6 7 8 9 10 11MACAU VMMC HONG KONG 2400 BPS - - AFTN H24LDD/dGUANGZHOU 2400 BPS AFTN H24LDD/dMACAU TWR HONG KONG HK APP 2 x LTF - - ATS H24 Direct controller to controller voice link.APP ControlMACAU TWR ZHUHAI ZHUHAI 2 x LTF - - ATS H24 Direct controller to controller voice link.APP Control APP* For local circuits connecting different offices to a COM Centre, see diagrams GEN 3.4-4 and 3.4-5Civil Aviation Authority - Macau, China AMDT 09

GEN 3.4 - 405 APR 2001AIP MACAUAERONAUTICAL FIXED SERVICE - TELEGRAPHTWRVMMCZTZXAIRP. DISPATCH OFFICEVMMCYDYDAIRP. OPERAT. CENTREVMMCYDYOMETEO OFFICEVMMCYMYXAIRPORT EMERG.CENTREVMMCYVYXINOFVMMCYNYXFIUVMMCYOYXAROVMMCZPZXMACAUAFTNSTATIONVMMCYFYFHONG KONGCOM CENTREVHHHYFYXGUANGZHOUCOM CENTREZGGGYFYXMETEO SERVICESVMMCYMYACIVIL AVIATIONAUTHORITY OF MACAUChairmanVMMCYAYADirector of Airport & AirNavigation InfrastructureVMMCYAYBAccident/IncidentInvestagationVMMCYAYCAISVMMCYAYIGeneralVMMCYAYXLEGEND1200 BPS LTT Duplex CircuitLAN2400 BPS LDD/dTo be Implemented LaterAMDT 09Civil Aviation Authority - Macau, China

AIP MACAU GEN 3.4 - 510 FEB 2000AERONAUTICAL FIXED SERVICE - TELEPHONEHONG KONGAPPZHUHAIAPPMACAUTWRCivil Aviation Authority Macau, China AMDT 08

GEN 3.4 - 602 JAN 97AIP MACAUVHF (FM) BROADCAST STATIONSTATION or CHAIN SERVICE IDENTIFICATION EM FREQUENCY HOURS COORDINATES OPERATING AUTHORITYKHz/MHz (UTC) AND REMARKS1 2 3 4 5 6 7 8MACAU B S Radio Villa verde A 3 E 738 KHz 2200-1600 22° 12’ 21” N Language: Chinese113° 33’ 25” E U/SLocation: 346° / 3.2 NM ARPMACAU B S Teledifusao de MACAU A 3 E 900 KHz 0000-2400 22° 12’ 21” N Language: Chinese(TDM) 113° 32’ 43” E U/SLocation: 336° / 3.5 NM ARPMACAU B S Teledifusao de MACAU F 8 E 98 MHz 0000-2400 22° 11’ 49” N Language: Portuguese(TDM) 113° 32’ 46” E Coverage: 5.4 NMLocation: 333° / 2.93 NM ARPMACAU B S Teledifusao de MACAU F 8 E 100.7 MHz 0000-2400 22° 11’ 49” N Language: Chinese(TDM) 113° 32’ 46” E Coverage: 5.4 NMLocation: 333° / 2.93 NM ARPCivil Aviation Authority Macau, China

AIP MACAO GEN 3.5 - 101 FEB 20071. Responsible serviceGEN 3.5 METEOROLOGICAL SERVICES1.1. The Meteorological Authority in Macao is conferred to “Serviços Meteorológicos eGeofisicos”.Postal Address:Serviços Meteorológicos e GeofisicosCaixa Postal 93Rampa de ObservatórioTaipa Grande, TaipaMACAUAFTN Address: VMMCYMYATelephone: (853) 8986214, 8986243Fax Number: (853) 2885 05571.2. The Meteorological Service for civil aviation are provided by Airport MeteorologicalOffice, a division of “Serviços Meteorológicos e Geofisicos”, located at the TerminalBuilding of Macau International Airport.Postal Address: Centro Meteorológico para a AeronauticaRoom 3016, Terminal BuildingMacau International AirportPAC ON, TaipaMACAUAFTN Address: VMMCYMYXTelephone: (853) 2886 1111 EXT 2508,(853) 2886 2203 (duty forecaster)Fax Number: (853) 2886 00171.3. The service is provided in accordance with the provisions contained in the following ICAOdocuments:Annex 3 — Meteorological Service for International Air NavigationDoc 7030 — Regional Supplementary ProceduresDifference to these provisions are detailed in subsection GEN 1.7.2. Area of responsibilityThe Airport Meteorological Office provides meteorological services for Macau ATZ.Civil Aviation Authority – Macao, China AMDT 14

GEN 3.5 - 201 FEB 20073. Meteorological observations and reports3.1. Table GEN 3.5.3 Meteorological observations and reportsName of station/LocationindicatorMACAU/MacauVMMCType &frequency ofobservation/automaticobservingequipmentType of METReports &SupplementaryinformationincludedAIP MACAOHours ofObservation System & Sites Operation1 2 3 4 5 6Hourly plus METAR,H24 NIL.specialSPECIObservation TREND WSCUP anemometer RWY 16CUP anemometer RWY 34CUP anemometer middle ptTransmissometer RWY 16Transmissometer RWY 34Transmissometer middle ptCeilometer RWY 16Ceilometer RWY 34AWS middle ptClimatologicalinformationExplanatory Note: METARSPECITRENDWSH24Routine weather reportSelected special weather reportLanding forecastWind shear24 hours3.2. Observing system and operating procedures3.2.1. Surface wind is measured by three cup anemometers mounted on the masts of 10 metershigh. The actual height of the anemometers is approximately 7 meters above the runway.Two of the anemometers are set abeam the 16 and 34 touchdown zone and the other one isset abeam the middle point. All three anemometers are positioned at a distance of 130meters on the East side of the runway centre line. Wind indicators are installed in themeteorological office and the air traffic services units. Observations made at the middlepoint anemometer constitutes the official wind report.3.2.2. RVR is measured by three transmissometers set abeam of both the touchdown zone and themiddle point of the runway. They are positioned at a distance of 120 meters on the Eastside of the runway centre line and are 2.5 meters above the runway. RVR values derivedfrom the transmissometers located near the touchdown zone are include in the MET reportwhenever the horizontal visibility is observed to be less than 1500 meters.3.2.3. The height of cloud base is measured by two ceilrometers located at either end of therunway at distance of 105 meters on the East side of the runway centre line.3.2.4. An Automatic Weather Station located near the middle transmissometer is used to measurethe air temperature, dew point temperature, atmospheric pressure and precipitation. All thereadings of the sensors and the calculated QNH and humidity are displayed in the weatherterminal in Meteorological office and ATC.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAU GEN 3.5 - 302 JAN 974 Types of services4.1 Flight documentation is provided at the Airport Meteorological Office for all flightsleaving Macau.The flight documentation comprises:- significant weather chart ;- upper wind and upper air temperature charts ;- latest available aerodrome forecasts (in TAF code form) for the departure, destination andalternate aerodromes ;- relevant SIGMET messages ;- for short haul flight (flying time of two hours or less) the latest METAR for the departure,destination and alternate aerodromes are also supplied.4.2 Briefing and ConsultationA meteorologist is available from 00 to 24 UTC to provide briefing and consultation forflight crew members. In order to obtain the latest information including the meteorologicalsatellite and weather radar information, flight crew are advised to attend the briefing andconsultation before departure. For the planning of VFR flight, plain language summaryforecast of enroute weather conditions may be requested.4.3 Aerodrome WarningsThe Meteorological Office of the Macau International Airport issues Aerodrome Warningsfor tropical cyclone and strong monsoon expected to affect the aerodrome.5 Notification required from operators5.1 An operator requiring meteorological service or changes in existing meteorological serviceshall notify, sufficiently in advance, the Airport Meteorological Office.5.2 The Airport Meteorological Office shall be notified by the operator requiring service when:a) new route or new types of operations are planned;b) changes of a lasting character are to be made in scheduled operationsc) other changes, affecting the provision of meteorological service, are planned5.3 The Airport Meteorological Office shall be notified by the operator or a flight crew member:a) of flight schedulesb) when non-scheduled are to be operatedc) when flights are delayed, advanced or cancelled6 Aircraft reportsNot required.Civil Aviation Authority of Macau

GEN 3.5 - 402 JAN 97AIP MACAU7 VOLMET servicesNil.8 SIGMET servicesNil.9 Other automated MET services9.1 Meteorological broadcastsNAME CALL SIGN/ID EM FREQ TIME (UTC) HOURS (UTC) STATIONS CONTENTS1 2 3 4 5 6 7 8MACAU MACAU ATIS 126,4 CNS H24 MACAU MET ReportSpecial TRENDforecastNote: ATISCNSH24METARSPECIAutomatic Terminal Information ServiceContinuous24 HoursRoutine weather reportSelected special weather report.10 Tropical cyclone and strong monsoon winds and local winds effects on the approachesto Macau International Airport10.1 Tropical cyclone10.1.1 IntroductionTropical cyclone may occur over the South China Sea at any time of the year, but haveonly produced persistent winds of gale force or over (mean winds speed exceeding 33knots) in the local Airport area during the months May to November. On one occasion(during the passage of C.T.S. Becky, 1993), the mean hourly wind speed reached 67 knots(124 km/h) in Macau and gusts exceeding 89 knots (166 km/h) were recorded (during thepassage of Ty, Ruby, 1964).10.1.2 Warning issued by the “Serviço Meteorológicos e Geofisicos, Macau (SMGM)”10.1.2.1 Whenever a typhoon, severe tropical storm, tropical storm or tropical depression centredwithin about 430 nautical miles (800 km) of Macau, warnings are issued by the SMGM toa number of addresses including the Meteorological Office, the Air Traffic Services Units,the Rescue Coordination Centre and to the Airport Terminal Building Information Office.These warnings are also issued for dissemination beyond the aerodrome and broadcast toaircraft in flight (see PARA 9 above). In addition, the SMGM also passes the informationCivil Aviation Authority of Macau

AIP MACAU GEN 3.5 - 502 JAN 97to the Civil Protection Operation Centre and other Government departments by fax.10.1.2.2 Macau's Tropical Cyclone Warning SignalsThere are eight signals in use in Macau. They are Number 1, 3, 8NW, 8SW, 8NE, 8SE, 9and 10:Nr 1 Signalis purely advisory. It is a Stand By Signal and calls attention to the fact thatthere is a tropical cyclone centred within about 430 NM (800 km) fromMacau which may later affect Macau.Nr 3 Signalwarns of strong winds. The centre of a tropical cyclone follows a pattern ofmovement that sustained wind speed to be experienced in Macau maypossibly range from 22 to 34 kt (41 to 63 km/h) with gusts up to 60 kt(111 km/h).Nr 8NW Signal - Nr 8SW Signal - Nr 8NE Signal - Nr 8SE SignalWarns of gale or storm force winds. The centre of a tropical cyclone isnearing and sustained wind speed to be experienced in Macau, from thequarter indicated, may possibly range from 34 to 64 kt (63 to 119 km/h) withgusts reaching up to 100 kt (185 km/h).Nr 9 Signalthe centre of the tropical cyclone is less than 100 NM (160 km) and it isexpected that Macau might be severely affected.Nr 10 Signal the centre of the on-coming typhoon should strike at the immediateapproaches of Macau. The sustained wind speed should exceed 64 kt (119km/h) with gusts of great intensity.Tropical Cyclone Warning Bulletins issued by the SMGM are disseminated to the variousplaces and broadcast by all sound and television stations. In addition, visual signals aredisplayed day and night at signal stations in Macau, Taipa and Coloane.Details of the symbols and lights used for the signals are shown in Macau's TropicalCyclone Warning Card issued by the SMGM.10.2 Strong monsoon windsWhen strong to gale force winds which are associated with winter monsoon (from theNortheast quadrant) or summer monsoon (from the Southwest quadrant) are occurring orexpected to occur in the local area, the Strong Monsoon Signal (black ball) will be hoistedand warnings will be issued by the SMGM. The Strong Monsoon Signal indicates that theCivil Aviation Authority of Macau

GEN 3.5 - 602 JAN 97AIP MACAUsustained wind speed in Macau due to the monsoon wind exceeds, or is forecast to exceed22 kt (41 km/h).Note: this signal is not applied during tropical cyclone situation.10.3 Local wind effects on the approaches to Macau International Airport- the area of Macau International Airport is possibly subject to the wind shear event causedby microbursts and gust fronts of thunderstorms.- there are no significant topographic features near the airport which cause an inordinateamount of turbulence. The source of turbulence in the area is instability due toconvection.The above conclusion is based on the historical wind observations in the meteorologicalstations in Macau, Taipa and Coloane. The details of these wind effects will be concludedonce the three anemometers located along the runway are installed and sufficient data isobtained.Civil Aviation Authority of Macau

AIP MACAO GEN 3.6 - 101 FEB 20071. Responsible serviceGEN 3.6 SEARCH AND RESCUEThe Civil Aviation Authority is the Authority for Search and Rescue in the Macao ATZ.Macao Tower will be responsible for the activities of all measures and plans for immediateRescue (or Search, if being the case).Within the limits of Macao ATZ, local helicopters and or light aircraft may be deployed incooperation with craft and personnel from other departments of the Macao SpecialAdministrative Regional Government (namely ships from Capitania dos Portos) or may berequested to private owned enterprises, according to a prefixed plan.For medium and long range SAR activities over the high seas, aircraft whose destination isMacao or has origin in Macao, will be assisted under the authority and coordination of theRescue Coordination Centre of Guangzhou in the People’s Republic of China or of theRescue Coordination Centre of the Civil Aviation Department of Hong Kong.The search and rescue service is provided in accordance with the ICAO Standards,recommended Practices and Procedures contained in the following documents:Annex 12 Search and RescueAnnex 13 Aircraft Accident InvestigationDOC 7030 Regional Supplementary Procedures2. Area of responsibilitySearch and rescue service is provide within Macao ATZ.3. Type of services3.1. Details of Rescue Units are given in Table 3.6.3. In addition, various elements of the“Capitania dos Portos”, the Security Forces of Macao, Public Security Police, the Marineand Customs Police, Merchant Marine, Fire and Ambulance Services and PublicTelecommunications, are available to the Search and Rescue Organisation.Table 3.6.3 Search and rescue unitsName Location Facilities Remarks22°08’58”N 2 boats for rescue in the Speed 35 kt113°35’29”E vicinity of airportCapacity *22°08’58”N 2 boats for fire fighting inSpeed 35 kt113°35’29”E the vicinity of airportMacauInternationalAirport22°08’58”N113°35’29”E2 boats for fire fighting inthe vicinity of airportSpeed 25 kt MAXCapacity *** 4 life rafts with a capacity of 25 persons each, on each rescue boat (200 persons on total).Additional rescue capacity on the 2 fire fighting boats.** Max rescue capacity: 85 persons and 20 life raft (20 person each raft)Civil Aviation Authority – Macao, China AMDT 14

GEN 3.6 - 201 FEB 20073.2. Rescue co-ordination serviceMacao Rescue Unit (Macao TWR)Coordination of SAR operations - Airport Emergency CentrePostal Address : Macau International Airport (SAR)PAC ONTaipaMacao, ChinaAFTN Address :Macao TWR – VMMCZTZXAirport Emergency Centre - VMMCYVYXAIP MACAOFax number : (853) 2886 0024Telephone : (853) 2886 0019, 2886 0020, 2886 00213.3. Additional maritime organisation and means for rescue3.3.1. Since the Macau International Airport is surrounded by water, the “Capitania dos Portos”(Marine Administration) has available means for Search and Rescue, coordinated through aSearch and Rescue Operations Post, working 24 hours daily (Fax 28726769, Tel 28726766,28726768).The following are the maritime means, which are available for rescue:a) Marine and Customs Police- 3 patrols boats on duty 24 hours a day, and on immediate callb) Capitania dos Portos- one 800 HP salvage tug- one 186 HP salvage tug(in readiness of 2 hours)c) STDM (Sociedate Turismo e Dimensões de Macao) - (upon request from MacaoMaritime Rescue Operations Post)- one 350 HP salvage tug- one 624 HP salvage tug(24 hours on duty berthing on Outer Harbour)d) Miscellaneous CraftSmall craft, including harbour launches and High Speed Craft (Jetfoils, hydrofoils, Jetcats,Hovercrafts, Hi-Speed Ferries, Jumbocats, etc...) are other sources suitable for rescueoperations.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 3.6 - 325 JUL 20023.3.2 Details of coordination and “on scene command” for Rescue in Macao ATZ waters, are asfollows:UNITAREA OF RESPONSIBILITY1 Airport overall responsibility, control and coordination: The Airport and 1000 meters around the runway in water- Macao Airport Emergency Operations Centre area.2 Joint responsibility of Macao Airport Emergency Between 1000 meters and 3000 meters around the runwayOperations Centre and “Capitania dos Portos”in water area.(on scene commander of marine operating means)3 Capitania dos Portos Between 3000 meters around runway and the limits of(on scene commander of maritime operating means) Macao ATZ in water area.4 Fire Fighting Department (Corpo de Bombeiros) Ground Area outside airport fencewith coordination of Civil Protection Operation Office(the Centro Operações da Protecção Civil (COPC))4 SAR agreementsMacao is within the responsibility of Guangzhou SAR center for the Pearl River DeltaArea. Cooperation links are established between Guangzhou RCC and Hong Kong RCCfor possible mutal assistance in the area.5 Conditions of availabilityAlthough specific SAR aircraft and surface vessels are not immediately available inMacao, other organisations will, on request, provide assistance and specialised SARaircraft, equipment and personnel for conduct of air and sea searches.6 Procedures and signals used6.1 ProceduresProcedures for pilot-in-command observing an accident or intercepting a distress calland/or message are outlined in Annex 12, Chapter 5.6.2 Communications6.2.1 Transmission and reception of distress and urgency message within the Macao ATZ arehandled in accordance with Annex 10, Vol. II, Chapter 5, Para 5.3.6.2.2 For communications during SAR operations, the codes and abbreviations published inICAO Doc 8400 (Codes and Abbreviations) are used.6.2.3 Information concerning positions, call signs, frequencies and hours of operation on Macaoaeronautical stations is published in the AD2 section.6.2.4 The frequency 121.5 MHz is guarded continuously at Macao Tower. The Macao MaritimePost of Search and Rescue guards the international distress frequency.6.3 Search and rescue signalsThe search and rescue signals to be used are those prescribed in Annex 12, Appendix A,paragraphs 2 and 3.Civil Aviation Authority - Macao, China AMDT 11

INTENTIONALLYLEFTBLANK

AIP MACAU SEARCH AND RESCUE PLANGEN 3.6 - 510 FEB 2000C HI NADajiuzhouHeng zhouDa Pai22°15'O FI CMACAUP UB L4R E' SL EO PP E4TAIPA13000 m1 2 31000mSanjiao IslandXilu Island22°10'Ta-Lou-p'aiCOLOANEDalu IslandDatouzhouSanzhou22°05'ShilanzhouHuangmao IslandDalie IslandATZ MACAU SFC / 3000 AMSLXiaoputai IslandXiaolie IslandDong'ao IslandGUANGZHOU ZGZU FIRHONG KONG FIRXiaowanshan Island22°00'113° 30' 113° 35' 113° 40'CIVIL AVIATION AUTHORITY OF MACAUCORRECTIONS : ReviewAMDT 08

INTENTIONALLYLEFTBLANK

AIP MACAO GEN 4.1 - 101 FEB 2007GEN 4. CHARGES FOR AERODROMES/HELIPORTS ANDAIR NAVIGATION SERVICESGEN 4.1 AERODROME CHARGESGeneral conditionsUnless a prior arrangement has been made with the Director of the Macau InternationalAirport, all landing, parking and refueling charges due and payable in respect of an aircraftshall be payable before the aircraft leaves the airport, and the Director may refuse to giveclearance for that aircraft to depart or for any other aircraft that is operated by the operatorof that aircraft to depart until such charges have been paid.For as long as an aircraft is upon the Airport, the Director shall have a lien, both particularand general, over the aircraft, its parts and accessories, for all charges that shall be orbecome due and payable to the Director, in respect of the aircraft or in respect of any otheraircraft that is operated by the operator of that aircraft. The lien referred to in paragraph 1.2a) above, shall not lapse or be lost by reason of the aircraft departing from the Airport, butshall continue and be exercisable at any time when the aircraft shall return to and be uponthe Airport, for as long as the said charges shall remain unpaid.1 Landing fees (in MOP):The Landing fee includes the following:- Terminal air traffic control;- Use of radio and visual navigation;- Parking for the first 60 minutes after landing and for the last 60 minutes prior totaking off.Landings in one month/AirlineAircraft1st tier2nd tierMTOW in tons up to 60 landingsover 60 landingsBasic Per ton Basic Per tonup to 9 810 - 785 -10 to 50 810 85 785 6951 to 100 4 295 65 3 614 58101 to 200 7 545 57 6 514 55more than 200 13 245 38 12 014 35Note : Whenever the number of landings leads to a change of tier, the fee applicable to totaloperations performed during that month is that applicable to the last operation according tothe index.Civil Aviation Authority – Macao, China AMDT 14

GEN 4.1 - 201 FEB 2007AIP MACAO1.1 Landing fees exemptionsa) aircraft in the exclusive services for the Portuguese Republic or the People’sRepublic of China;b) aircraft in official missions or under special agreements or on a reciprocity basis;c) aircraft in humanitarian or search and rescue operations;d) aircraft that due to technical, meteorological or similar contingency cases and forcedto return to the airport;e) aircraft whose finality of the operation may justify the exemption.1.2 Landing fees reduction:a) Aircraft engaged in local training and equipment testing flights, may be entitled to areduction up to 75%.b) Aircraft landing between 23:00 to 07:00 local time are entitled to a 50% reduction.2 Aircraft parking fees (in MOP):Landings in one month/AirlineAircraft1st tier2nd tierMTOW in tons up to 60 landingsover 60 landingsPer hourPer hourup to 9 51 4110 to 50 129 10351 to 150 180 144151 to 250 232 185more than 250 283 227Note : Whenever the number of landings leads to a change of tier, the fee applicable to totalparking hours during the month in question is that applicable to the last operationaccording to the index.2.1 Parking fees exemptionsa) aircraft in the exclusive services for the Portuguese Republic or the People’sRepublic of China;b) aircraft in official missions or under special agreements or on a reciprocity basis;c) aircraft in humanitarian or search and rescue operations;d) aircraft that due to technical, meteorological or similar contingency cases and forcedto return to the airport, the reason for returning to the airport may justify theexemption of parking time;e) aircraft whose finality of the operation may justify the exemption of the parking time.AMDT 14Civil Aviation Authority – Macao, China

AIP MACAO GEN 4.1 - 301 FEB 20073 Passenger fees:For each passenger, older than 2 years of age, boarded to any destination MOP 90For each passenger in transfer, meaning those that continue their onward MOP 40journey changing aircraft and flight number, without going through customsand immigration control, as well as those continuing their journey in less than48 hours after disembarking at the MIA3.1 Passenger fees exemptionsa) Infants under 2 years of age;b) Passengers in direct transit, i.e. those who will proceed on the same aircraft or inanother aircraft under the same flight number, with or without going throughcustoms and immigration control;c) Passengers of aircraft landing in cases of forced return to the airport due to technicaldeficiencies, weather conditions or other force majeure reasons, duly proved;d) Passengers holding diplomatic passport;e) Passengers holding a travel document issued by the People’s Republic of China to:- Government officials at the level of vice-minister or above;- Director and sub-directors of the Liaison Office of the People’s CentralGovernment at the Macao Special Administrative Region;- Commissioner and adjunct-commissioner of the Foreign Affairs Ministry ofthe People’s Republic of China at the Macao Special Administrative Region;- Commander, political commissioner and vice-commander of the People’sLiberation Army Macau Garrison;f) Aircraft using the airport for purposes that might justify the exemption, whenapproved by the concessionaire on a case-by-case basis.4 Maximum refueling fee (in MOP): 0.10 per gallon5 Airport fee (in MOP):For each passenger, older than 2 years of age, boarded to any destination MOP 20For each passenger in transfer MOP 105.1 Airport fee exemptionsa) Infants under 2 years of age;b) Passengers in direct transit, i.e. those who will proceed on the same aircraft or inanother aircraft under the same flight number, with or without going throughcustoms and immigration control;c) Passengers of aircraft landing in cases of forced return to the airport due to technicaldeficiencies, weather conditions or other force majeure reasons, duly proved;d) Passengers of aircraft using the airport for purposes that might justify the exemption,when approved by the concessionaire on a case-by-case basis.Civil Aviation Authority – Macao, China AMDT 14

GEN 4.1 - 401 FEB 2007AIP MACAO6 Currencies exchange rates:a) Hong Kong and Macau1 HKD = 1.03 MOPb) United States of America and Macau1 USD = 7.97 MOP**With along the year oscillations which that do not goes beyond ± 1%AMDT 14Civil Aviation Authority – Macao, China

AIP MACAU GEN 4.2 -102 JAN 97GEN 4.2 AIR NAVIGATION SERVICES CHARGESNIL.Civil Aviation Authority of Macau

INTENTIONALLYLEFTBLANK