Bioinformatics Slides (PDF) - Genomics & Medicine - Stanford ...

More documents

Recommendations

Info

Central Paradigm of <strong>Bioinformatics</strong>GeneticInformationMolecularStructureBiochemicalFunctionPhenotype(Symptoms)MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Page 1 and 2: BioinformaticsGenomics& Medicinehtt
Page 3 and 4: Computational Goals of Bioinformati
Page 5: Central Paradigm of MedicineDNA RNA
Page 10 and 11: Challenges Understanding Genetic In
Page 12 and 13: Discovering Function from Protein S
Page 16 and 17: Protein Motifs fromMultiple Sequenc
Page 20 and 21: Protein Motifs fromMultiple Sequenc
Page 22 and 23: Blocks or Finger Prints fromMultipl
Page 26 and 27: Data Mining:The Seach for Buried Tr
Page 28 and 29: Data Mining:The Seach for Buried Tr
Page 30 and 31: Swiss Institute of Bioinformaticsht
Page 32 and 33: Expasy Bioinformatics Resource Port
Page 34 and 35: UniProt Opsin Entrieshttp://www.uni
Page 36 and 37: UniProt Human Opsin Entries Reviewe
Page 38 and 39: Blast UniProt Human Opsin OPN1MW En
Page 40 and 41: NCBI BLAST Home Pagehttp://blast.nc
Page 42 and 43: NCBI BLAST Parametershttp://blast.n
Page 44 and 45: Entrez Gene search for Colorblindne
Page 46 and 47: Entrez Gene search for Colorblindne
Page 48 and 49: Entrez Gene search for Opsins
Page 50 and 51: Choose Standard Protein-Protein BLA
Page 52 and 53: Optional Parameters
Page 54 and 55: Sequence Aligned with Domain
Page 56 and 57:
Most Signifcant Similarity Hits
Page 58 and 59:
Discovering Function from Protein S
Page 60 and 61:
Evaluation of ProflesSpecificity=TN
Page 62 and 63:
MyHits Local Motifs Queryhttp://myh
Page 64 and 65:
MyHits Local Motifs Summaryhttp://m
Page 66 and 67:
MyHits Local Motifs Hist (Cont.)htt
Page 68 and 69:
MyHits Local Motifs Hist (Cont.)
Page 70 and 71:
InterProScanhttp://www.ebi.ac.uk/in
Page 72 and 73:
InterPro Scan HourGlasshttp://www.e
Page 74 and 75:
InterPro Scan Resultshttp://www.ebi
Page 76 and 77:
GO: Gene Ontology for Opsin OPN1MWh
Page 78 and 79:
GO: Sequence Information for OPN1MW
Page 80 and 81:
GO: Gene Ontology Databasehttp://ww
Page 82 and 83:
GO: Gene Ontology Term GCRPhttp://w
Page 84 and 85:
GO: Gene Ontology GCPR Termhttp://w
Page 86 and 87:
Statistical vs. Biological Signifca
Page 88 and 89:
Statistical vs. Biological Signifca
Page 90 and 91:
Multiple Enhancer Sequences
Page 92 and 93:
PolyAdenylation of mRNAs© Michael
Page 94 and 95:
Splicing, Capping & polyAdenylation
Page 96 and 97:
Alternative Splicing Generates Dist
Page 98 and 99:
Alternative SplicingDetected in EST
Page 100 and 101:
Gene Locihttp://www.ncbi.nlm.nih.go
Page 102 and 103:
Genomics, Bioinformatics &Computati
Page 104 and 105:
Redundancy in Genomic& Protein Sequ
Page 106 and 107:
pFAM at Sanger Center (UK)http://ww
Page 108 and 109:
pFAM at Sanger Center (UK)http://pf
Page 110 and 111:
pFAM at Sanger Center (UK)http://pf
show all

Bioinformatics Slides (PDF) - Genomics & Medicine - Stanford ...

Create successful ePaper yourself

Delete template?

Save as template?