American-Lincoln - Wapalto-heine.de

TABLE OF CONTENTSSPECIFICATIONS ............................................................................................................................ 1-6MACHINE DIMENSIONS .................................................................................................................. 1-8STANDARD HARDWARE & TORQUE VALUES .............................................................................. 1-9HYDRAULIC TORQUE REQUIREMENTS ........................................................................................ 1-10DECIMAL - METRIC CONVERSION TABLE ..................................................................................... 1-11MACHINE OPERATION ................................................................................................................... 1-12SAFETY INSTRUCTIONS ................................................................................................................ 1-13OPERATION OF CONTROLS AND GAUGES .................................................................................. 1-14IGNITION SWITCH ................................................................................................................... 1-14LIGHT SWITCH ........................................................................................................................ 1-14GLOW PLUG SWITCH ............................................................................................................ 1-15HORN PUSH BUTTON ............................................................................................................. 1-15SIDE BROOM LIFT .................................................................................................................. 1-15MAIN BROOM SWITCH ........................................................................................................... 1-16SIDE BROOM SWITCH ........................................................................................................... 1-16DUST CONTROL SWITCH ....................................................................................................... 1-16FILTER SHAKER SWITCH ....................................................................................................... 1-16WATER TEMPERATURE GAUGE ........................................................................................... 1-17HOUR METER ......................................................................................................................... 1-17FUEL GAUGE .......................................................................................................................... 1-17OIL PRESSURE GAUGE ......................................................................................................... 1-17VOLT METER .......................................................................................................................... 1-17SCRUB BRUSHES SWITCH .................................................................................................... 1-17BRUSH ROTATION SWITCH .................................................................................................... 1-18BRUSH PRESSURE SWITCH ................................................................................................. 1-18SQUEEGEE BLADE SWITCH ................................................................................................. 1-18HIGH RECOVERY WARNING LIGHT ....................................................................................... 1-18LOW SOLUTION WARNING LIGHT ......................................................................................... 1-18HOPPER LIFT .......................................................................................................................... 1-19HOPPER DUMP DOOR ........................................................................................................... 1-19MANUAL DUMP HOPPER....................................................................................................... 1-19SOLUTION CONTROL .............................................................................................................. 1-19SWEEPING BROOM LIFT CONTROL ...................................................................................... 1-19TURN SIGNAL (OPTION) ......................................................................................................... 1-19THROTTLE ............................................................................................................................... 1-20CHECK ENGINE LIGHT ........................................................................................................... 1-20PARKING BRAKE .................................................................................................................... 1-20FOOT BRAKE .......................................................................................................................... 1-20ACCELERATOR & DIRECTIONAL CONTROL PEDAL .............................................................. 1-21BACKUP ALARM SWITCH ...................................................................................................... 1-21SEAT ADJUSTMENT ................................................................................................................ 1-21ESP SYSTEM OPERATING INSTRUCTIONS .................................................................................. 1-22ESP RECYCLING CONTROL PANEL ...................................................................................... 1-22ESP RECYCLING SYSTEM ON/OFF SWITCH ........................................................................ 1-22SOLUTION HIGH WARNING LIGHT ......................................................................................... 1-22DETERGENT LOW WARNING LIGHT ...................................................................................... 1-22DETERGENT FLOW KNOB ..................................................................................................... 1-22HOPPER SAFETY LOCK ARM ................................................................................................ 1-22THE SCRUBBING SYSTEM - HOW IT WORKS ...................................................................... 1-23NON-RECYCLING SCRUBBING SYSTEM - HOW IT WORKS ................................................. 1-23RECOVERY OR ESP SYSTEM - HOW IT WORKS................................................................. 1-24THE SWEEPING & DUST CONTROL SYSTEM - HOW IT WORKS ......................................... 1-26OPERATING INSTRUCTIONS .......................................................................................................... 1-28FILLING THE SOLUTION TANK - NON-RECYCLING (STANDARD) .......................................... 1-28FILLING THE SOLUTION TANK - ESP ..................................................................................... 1-28PRE-START CHECKLIST ......................................................................................................... 1-28BEFORE STARTING THE ENGINE .......................................................................................... 1-28STARTING THE ENGINE.......................................................................................................... 1-28POST-START CHECKLIST ....................................................................................................... 1-29TRANSPORTING THE MACHINE ............................................................................................. 1-291-2 AMERICAN-LINCOLN7760

TABLE OF CONTENTSBEGINNING THE CLEANING OPERATION .............................................................................. 1-29ENDING THE CLEANING OPERATION .................................................................................... 1-29POST-OPERATION CHECKLIST .............................................................................................. 1-30DRAINING THE SOLUTION TANK - ESP ................................................................................. 1-30CLEANING THE SOLUTION TANK - ESP ................................................................................ 1-30DRAINING THE RECOVERY TANK ......................................................................................... 1-30CLEANING THE RECOVERY TANK ........................................................................................ 1-30DOUBLE LID RECOVERY TANK ............................................................................................. 1-31OIL COOLER ........................................................................................................................... 1-31EMPTYING THE DEBRIS HOPPER - VARIABLE DUMP ......................................................... 1-31TOWING INSTRUCTIONS ........................................................................................................ 1-31SERVICE CHART ............................................................................................................................ 1-32HELPFUL HINTS FOR CLEANING OPERATION .............................................................................. 1-34GENERAL MACHINE MAINTENANCE ............................................................................................. 1-35LUBRICATION .......................................................................................................................... 1-35OPENING THE ENGINE COVER ............................................................................................. 1-35HYDRAULICS .......................................................................................................................... 1-36FILLING THE HYDRAULIC RESERVOIR .................................................................................. 1-36CLEANING THE HYDRAULIC SYSTEM ................................................................................... 1-36REPLACING THE RETURN FILTER ELEMENT ........................................................................ 1-36ENGINE ................................................................................................................................... 1-37MAIN BROOM REMOVAL ....................................................................................................... 1-37MAIN BROOM LEVEL ADJUSTMENT ...................................................................................... 1-38ADJUSTING THE MAIN BROOM WEAR PATTERN ................................................................. 1-38SIDE BROOM LEVEL ADJUSTMENT ...................................................................................... 1-38SIDE BROOM REPLACEMENT ............................................................................................... 1-38FLAPS ..................................................................................................................................... 1-39SCRUB BRUSH REPLACEMENT ............................................................................................ 1-40COVERS AND LATCHES ......................................................................................................... 1-40SOLUTION WARNING LIGHT ................................................................................................... 1-40RECOVERY WARNING LIGHT ................................................................................................ 1-40SOLUTION CONTROL - STANDARD ........................................................................................ 1-40SOLUTION CONTROL - ESP ................................................................................................... 1-40RECYCLING PUMP ESP SYSTEM ......................................................................................... 1-41ESP SYSTEM STORAGE ....................................................................................................... 1-41REAR SQUEEGEE .................................................................................................................. 1-41SQUEEGEE CASTER WHEELS ............................................................................................. 1-41CASTER WHEEL ADJUSTMENT ............................................................................................. 1-41RECOVERY TANK LID ACCESS ............................................................................................. 1-42BRAKE ADJUSTMENT ............................................................................................................ 1-42AIR INTAKE SYSTEM .............................................................................................................. 1-43AIR FILTER .............................................................................................................................. 1-43REPLACING THE AIR FILTER .................................................................................................. 1-43COOLING SYSTEM ................................................................................................................. 1-45COOLANT LEVEL .................................................................................................................... 1-45RADIATOR ............................................................................................................................... 1-45DRIVE BELTS .......................................................................................................................... 1-46BATTERY ................................................................................................................................. 1-46GAS TANK ............................................................................................................................... 1-46LP FUEL SYSTEM .................................................................................................................. 1-47LP VAPORIZER-REGULATOR QUICK CHECK ........................................................................ 1-47LP FUEL TANK ........................................................................................................................ 1-47NEUTRAL ADJUSTMENT ......................................................................................................... 1-49PARTS LIST LEGEND ...................................................................................................................... 1-50GENERAL TROUBLESHOOTING .................................................................................................... 1-51CHECK ENGINE (”MIL”) LIGHT CODES ........................................................................................... 1-53ORDERING PARTS .......................................................................................................................... 1-56TABLE OF CONTENTS - CHAPTER TWO....................................................................................... 2-1MAIN BROOM ......................................................................................................................... 2-2MAIN BROOM LIFT LINKAGE ................................................................................................. 2-4AMERICAN-LINCOLN 1-37760

TABLE OF CONTENTSSIDE BROOM (VARIABLE DUMP)........................................................................................... 2-6BROOM AND BRUSH CHAMBER DOOR ................................................................................ 2-8HOPPER SYSTEM (MANUAL DUMP) ..................................................................................... 2-10HOPPER AND FLAPS (VARIABLE DUMP) .............................................................................. 2-12HOPPER FILTER AND IMPELLER ........................................................................................... 2-14HOPPER CONTROL VALVE & HOPPER DUMP LINKAGE (VARIABLE DUMP) ..................... 2-16SCRUB DECK AND BRUSHES ............................................................................................... 2-18REAR AND SIDE SQUEEGEES .............................................................................................. 2-20SQUEEGEE LIFT..................................................................................................................... 2-22SWING SQUEEGEE SUPPORT .............................................................................................. 2-24SOLUTION TANK ..................................................................................................................... 2-26SOLUTION FEED LINKAGE .................................................................................................... 2-28RECOVERY TANK ................................................................................................................... 2-30RECOVERY TANK LID ............................................................................................................ 2-32VACUUM MOTOR & FLOAT .................................................................................................... 2-34FRONT WHEEL AND BRAKE .................................................................................................. 2-36REAR WHEEL ......................................................................................................................... 2-38BRAKE LINKAGE .................................................................................................................... 2-40FORWARD/REVERSE CONTROL - FORD .............................................................................. 2-42FORWARD/REVERSE CONTROL - MITSUBISHI .................................................................... 2-44MAIN FRAME .......................................................................................................................... 2-46DRIVER COMPARTMENT ........................................................................................................ 2-48HYDRAULIC HOSE SYSTEM (VARIABLE DUMP) ................................................................... 2-50HYDRAULIC HOSE SYSTEM (MANUAL DUMP) ..................................................................... 2-52SUCTION & RETURN HOSES (VARIABLE DUMP) .................................................................. 2-54SUCTION & RETURN HOSES (MANUAL DUMP) .................................................................... 2-56MAIN BROOM AND FITTINGS ................................................................................................. 2-58SIDE BROOM AND FITTINGS .................................................................................................. 2-59SCRUB MOTORS & FITTINGS ................................................................................................ 2-60SQUEEGEE AND SCRUB DECK CYLINDERS & FITTINGS .................................................... 2-61POWER STEERING, HOPPER DUMP & HOPPER LIFT CYL’S. & FITTINGS .......................... 2-62REAR WHEEL MOTOR & FITTINGS ........................................................................................ 2-64HYDRAULIC RESERVOIR, FILTER & FITTINGS ...................................................................... 2-66DRIVE PUMP & FITTINGS ....................................................................................................... 2-68VACUUM MOTOR & FITTINGS ................................................................................................ 2-69DUST CONTROL IMPELLER AND FITTINGS ........................................................................... 2-70POWER STEERING UNIT AND FITTINGS ................................................................................ 2-71MAIN CONTROL VALVE AND FITTINGS .................................................................................. 2-72CYLINDER CONTROL VALVE AND FITTINGS ......................................................................... 2-73RETURN MANIFOLD AND FITTINGS ....................................................................................... 2-74OIL COOLER & FITTINGS ........................................................................................................ 2-75AUXILIARY PUMP AND FITTINGS (FORD) .............................................................................. 2-76AUXILIARY PUMP AND FITTINGS (MITSUBISHI) ..................................................................... 2-77BATTERY ................................................................................................................................. 2-78ENGINE COVER ...................................................................................................................... 2-80FUEL TANK ............................................................................................................................. 2-82FORD 425EFI GAS ENGINEFAN, EXHAUST, HOSES .................................................................................................... 2-84AIR INTAKE/FILTRATION...................................................................................................... 2-86FUEL SYSTEM ................................................................................................................... 2-88FORD 425EFI LP ENGINEFAN, EXHAUST, HOSES .................................................................................................... 2-90AIR INTAKE/FILTRATION...................................................................................................... 2-92FUEL SYSTEM ................................................................................................................... 2-94LP TANK .............................................................................................................................. 2-98MITSUBISHI S4Q2 DIESEL ENGINEFAN, EXHAUST, HOSES ..................................................................................................... 2-102SUPPORTS, THROTTLE ..................................................................................................... 2-104FUEL SYSTEM ................................................................................................................... 2-106AIR INTAKE/FILTRATION...................................................................................................... 2-108RADIATOR ........................................................................................................................... 2-1101-4 AMERICAN-LINCOLN7760

CERTIFIED EXPORT (CE) KIT ................................................................................................. 2-112STEERING ............................................................................................................................... 2-114DECALS .................................................................................................................................. 2-116INSTRUMENT PANEL .............................................................................................................. 2-118MACHINE HARNESS WIRING DIAGRAM ................................................................................ 2-120ELECTRICAL SCHEMATIC, GAS/LP/DIESEL .......................................................................... 2-122CONNECTION DIAGRAM, GAS/LP/DIESEL ............................................................................ 2-123ENGINE FRAME SIDE CONNECTION DIAGRAM, GAS/LP ..................................................... 2-124ENGINE FRAME SIDE CONNECTION DIAGRAM, DIESEL ..................................................... 2-125HYDRAULIC SCHEMATIC (VARIABLE DUMP) ........................................................................ 2-126HYDRAULIC SCHEMATIC (MANUAL DUMP) ........................................................................... 2-127TABLE OF CONTENTS - CHAPTER THREE .................................................................................... 3-1OVERHEAD GUARD OPTION ................................................................................................. 3-2BRUSH OPTIONS .................................................................................................................... 3-4SIDE BROOM OPTION (MANUAL DUMP) ............................................................................... 3-6BROOM OPTIONS ................................................................................................................... 3-8BACK-UP ALARM OPTION ...................................................................................................... 3-9LIGHTS OPTIONS .................................................................................................................... 3-10TURN SIGNAL OPTIONS ......................................................................................................... 3-12WARNING LIGHTS (STANDARD) ............................................................................................. 3-14WARNING LIGHTS w/OVERHEAD GUARD ............................................................................. 3-16FIRE EXTIGUISHER OPTION ................................................................................................... 3-18FLAME-ARRESTING GAS CAP OPTION ................................................................................. 3-19DEBRIS BASKET OPTION ...................................................................................................... 3-20SUSPENSION SEAT OPTION ................................................................................................. 3-21SEAT BELT OPTION FOR SUSPENSION SEAT ...................................................................... 3-22SEAT BELT OPTION FOR STANDARD SEAT .......................................................................... 3-23DETERGENT & SOLUTION TANK, ESP OPTION .................................................................... 3-24RECOVERY TANK & DETERGENT PUMP, ESP OPTION ....................................................... 3-26INSTRUMENT PANEL, ESP OPTION....................................................................................... 3-28WIRING, ESP OPTION ............................................................................................................ 3-30TIRE OPTIONS ........................................................................................................................ 3-32VACUUM WAND OPTION ........................................................................................................ 3-33WET SWEEP BYPASS ........................................................................................................... 3-34CABS ...................................................................................................................................... 3-36SPARE PARTS KIT, GAS/LP VARIABLE ................................................................................. 3-52SPARE PARTS KIT, DIESEL VARIABLE .................................................................................. 3-53SPARE PARTS KIT, GAS/LP MANUAL.................................................................................... 3-54SPARE PARTS KIT, DIESEL MANUAL .................................................................................... 3-55ENGINE SERVICE PARTS - FORD 425EFI GAS/LP ............................................................... 3-56ENGINE SERVICE PARTS - MITSUBISHI S4Q2 DIESEL......................................................... 3-57AMERICAN-LINCOLN 1-57760

SPECIFICATIONSDIMENSIONSLengthWidthHeightWheel BaseHeight with GuardDRIVESPropellingSweepingScrubbingVacuum - Water Pick Up107.0” - 271.8 cm59.0” - 149.9 cm61.5” - 156.2 cm56.4” - 143.2 cm85.5” - 217.2 cmVariable Displacement Pump - Hydraulic Drive Motor(1) Hydraulic Motor(3) Hydraulic Motors(1) Hydraulic MotorHYDRAULIC CONTROLSingle Foot Pedal Controls Forward, Neutral, Reverse & Dynamic Braking.All Electro-Hydraulic Controls To Both Sweeping And Scrubbing Functions.MECHANICAL SYSTEMSteeringBrakesBroomsSWEEPING SYSTEMTypeHopperMain BroomBRUSHES & SQUEEGEEBrushesSqueegeesTANK CAPACITY (Standard)TANK CAPACITY (ESP System)FUEL SYSTEMEngine Cooling SystemGas/LP System TotalDiesel System TotalGas, Diesel Fuel TankLPG TankEngine Oil SystemGas and LPGDieselHydraulic SystemTotal SystemPower Steering with Rack and Pinion GearParking/Foot Operated and Locked Disc BrakesLift and Height AdjustmentDirect Throw1200 lb. (545 kg) capacity (Variable Dump)400 lb. (181 kg) capacity (Manual Dump)50” Long x 14” Diameter (127 cm x 35.6 cm)3.25” (8.3 cm) Bristle LengthFeatures broom lift & adjustable broom height for wearcompensation, standard poly-fiber broom, Quick-ChangeSystem.(3) 17.88” (45.4 cm) Diameter Poly-Fiber Discs(1) 62” (157.48 cm) Wide Contoured Rear Swing Squeegee(2) 29” (73.7 cm) Floating Side Squeegees, One On EitherSide Of the Scrubbing Compartment100 Gallon (378.5 Liters) Solution Tank100 Gallon (375.5 Liters) Recovery TankInterconnected Tanks Provide A Total Camel System CapacityOf 190 Gallons (719 Liters) Along With 5 Gallons (18.9 Liters) OfDetergent.Radiator and Hoses (Approximately) 3 Quarts (2.8 Liters)6.75 Quarts - 6.4 Liters6.6 Quarts - 6.2 Liters9.7 Gallons - 36.71 Liters33 Pounds4 Quarts - 3.8 Liters5 Quarts - 4.7 Liters11 Gallons - 41.6 Liters1-6 AMERICAN-LINCOLN7760

SPECIFICATIONSSWEEPING WIDTHSCRUBBING WIDTH50” (125.0 cm) Sweeping60” (152.4 cm) Sweeping With Side Broom54" (137 cm) Provided By (3) 17.88” (45.4 cm)Diameter Disc BrushesSPEEDSMaximum TravelRecommended MaximumSweeping AndScrubbing Speed7 mph - 11.3 km/hr.4 mph - 6.4 km/hr.TURNING RADIUSLeftRightMinimum Aisle Widthfor 180° Turn82” - 208.3 cm82” - 208.3 cm120” - 305 cmWEIGHTS7760 Variable Dump Manual DumpNet 4150 lb. - 1882 kg 3700 lb. - 1678 kgShipping w/Crate 4600 lb. - 2087 kg 4150 lb. - 1882 kgENGINE DATAFord LRG 425EFIBore and StrokeOil CapacityDisplacementFuel3.78” x 3.40” (96.0 mm x 86.3 mm)4.5 quarts (4.3 liters) (including filter)4 cylinders (2.5 liters) (153 CID)87 A.K.I. (Standard Unleaded Gasoline)HD-5 for LP versionsMitsubishi S4Q2 DieselBore and Stroke3.46" x 4.06” (88 mm x 103 mm)Oil Capacity7.2 quarts (7 liters) -Oil pan / 8.4 quarts (8 liters) - Complete systemDisplacement4 cylinders (2.5 Liters) (153 cu. in.) (122 CID)Fuel ASTM No. 2-DHigh temperature/low pressure sensors with engine shutdown are standard on both the Ford 425 andMitsubishi S4Q2.AMERICAN-LINCOLN 1-77760

MACHINE DIMENSIONS85.5"217.2 cm.61.5"156.2 cm.54.5"138.4 cm.60.0"157.5 cm.92.0"233.7 cm.56.4"143.2 cm.107"271.8 cm.27.0"68.6 cm.27.4"69.5 cm.59.0"149.9 cm.27.4"69.5 cm.1-8 AMERICAN-LINCOLN7760

STANDARD HARDWARE & TORQUE VALUESSAE - Grade 5 SAE - Grade 8ScrewSize*6*8*10*1/45/163/87/161/29/165/83/47/81Grade5PlatedGrade8Plated410HStainlessBrassTypeF&T&BTC F C F C F C F14273986152844689813523938757915284310817314976110153267-----13022406395138191338545818---151244470108155216378--18334711419345585-----20355413222396295-----59133261016------203749120---------234164156---------C = Coarse ThreadF = Fine Thread* = Torque values for #6 through 1/4 are lb./in. All others are lb./ft.NOTETypeB, AB213449120---------C2000/9905Decrease the torque by 20% when using thread lubricantThe torque tolerance is ± on torque values.AMERICAN-LINCOLN 1-97760

HYDRAULIC TORQUE REQUIREMENTSHYDRAULIC TORQUE REQUIREMENTSRefer to the following chart for torque values on all hydraulic hoses and fittings.Nominal O-Ring Face Seal End SAE O-Ring Boss EndSAE Thread Swivel Thread Str. FittingDash Size Nut Size or LocknutSize Inch Torque Inch TorqueLB-FTLB-FT-3 * * 3/8-24 8-10-4 9/16-18 10-12 7-16-20 14-16-5 * * 1/2-20 18-20-6 11/16-16 18-20 9/16-18 24-25-8 13/16-16 32-35 3/4-16 50-60-10 1-14 46-50 7/8-14 72-80-12 1 3/16-12 65-70 1 1/16-12 125-135-14 1 3/16-12 65-70 1 3/16-12 160-180-16 1 7-16-12 92-100 1 5/16-12 200-220-20 1 11/16-12 125-140 1 5/8-12 210-280-24 2-12 150-165 1 7/8-12 270-360* O-Ring face seal type end not defined for this tube size.NOTEParts must be lightly oiled with hydraulic fluid.C-20021-10 AMERICAN-LINCOLN7760

AMERICAN-LINCOLN 1-117760DECIMAL-METRIC CONVERSION TABLEFRACTIONFRACTIONDECIMALDECIMALMILLIMETERMILLIMETER16413231 91113153575357911171921232527293113156416 16161616161616643232323232323232323232323232326464646464646464646464646464646464646464646464646464646471133353739414345474951535557596163131517192123252729311 51 3738 84 488964120.0156250.031250.0468750.06250.0781250.093750.1093750.1250.1406250.156250.1718750.18750.2031250.218750.2343750.250.2656250.281250.2968750.31250.3281250.343750.3593750.3750.3906250.406250.4218750.43750.4531250.468750.484375.050.5156250.531250.5468750.56250.5781250.593750.6093750.6250.6406250.656250.6718750.68750.7031250.718750.7343750.750.7656250.781250.7968750.81250.8281250.843750.8593750.8750.8906250.906250.9218750.93750.9531250.968750.9843751.000.39690.79381.19061.58751.98442.38132.77813.17503.57193.96884.36564.76255.15945.55635.95316.35006.74697.14387.54067.93758.33448.73139.12819.52509.921910.318810.715611.112511.509411.906312.303112.700013.096913.493813.890614.287514.684415.081315.478115.875016.271916.668817.065617.462517.859418.256318.653119.050019.446919.843820.240620.637521.034421.431321.828122.225022.621923.018823.415623.812524.209424.606325.003125.40001C2001/9905

MACHINE OPERATIONFIGURE 1YOUR 7760 MACHINE HAS BEEN SHIPPED COMPLETE, BUT DO NOT ATTEMPT TO OPERATE WITHOUTFOLLOWING THESE INSTRUCTIONS.PREPARING THE MACHINE FOR OPERATION1. Connect and tighten battery cables.2. Fill the tank with REGULAR GRADE unleaded gasoline. (Diesel fuel if equipped with diesel engine.)WARNINGNever fill tank while engine is running. Always be sure gasoline container and sweeper areelectrically connected before pouring gasoline. This can easily be done by providing an insulatedwire (permanently attached to container) with battery clip on the other end.3. Check engine crankcase oil level. Although properly lubricated at factory, check before starting engine. Nospecial break in oil is used and recommended number of operating hours before the initial oil change is thesame as normal. See Maintenance.4. Check radiator coolant level. Permanent type antifreeze is added at the factory to provide protection toapproximately -35° F (37° C). To retain this protection level, always add 1/2 part water to 1/2 part antifreeze.5. Check oil level in the hydraulic reservoir located at center of machine beside the engine. Oil fill level shouldbe two (2) inches (5 cm.) below filler neck assembly. If oil is required, add HYDRAULIC FLUID ONLY,automatic transmission fluid FORD type “F”. After the first 50 operating hours, service must be performedon your engine to insure future high performance and trouble-free operation. See Maintenance.1-12 AMERICAN-LINCOLN7760

SAFETY INSTRUCTIONSWARNINGFOR SAFETY, OBSERVE THE FOLLOWING WARNINGS. FAILURE TO COMPLY MAY CREATE A SERIOUSRISK OF INJURY TO YOU AND OTHERS. THIS MACHINE SHOULD NOT BE USED IN HAZARDOUSLOCATIONS INCLUDING AREAS OF VOLATILE DUST OR VAPOR CONCENTRATIONS.Operators must be trained and qualified to operate this machine. They must also understand theoperator’s manual before starting.Use caution when mounting or dismounting the machine particularly on wet, slippery surfaces.Operate only from the designated operator’s position. Stay inside the body of the machine. Keephands and feet on the designated controls. Always operate in well-lighted areas.Do not dump the hopper over an open pit or dock. Do not dump the hopper when positioned on agrade (ramp). The machine must be level (horizontal).Exhibit extreme caution when negotiating, turning and traveling across grades or ramps.Start, stop, change direction, travel and brake smoothly. Slow down when turning.Avoid uneven surfaces and loose materials.Watch out for obstructions, especially overhead.Do not carry passengers on the machine.Set parking brake when leaving the machine. Chock (block) the wheels if the machine is to be parkedon a grade (ramp), or when working on it.Never leave the operator’s seat with the engine running.Report damage or faulty operation immediately.Do not operate the machine until repairs have been completed.AMERICAN-LINCOLN 1-137760

OPERATIONS OF CONTROLS AND GAUGESBRUSH ROTATION SWITCHSQUEEGEE SWITCHSCRUB BRUSH LIFT SWITCHBRUSH PRESSURE SWITCHHIGH RECOVERYWARNING LIGHTLOW SOLUTIONWARNING LIGHTHOPPER LIFTHOPPER DUMP DOORSOLUTION HIGH LIGHTRECYCLING SYSTEM SWITCHDETERGENT LOW LIGHTDETERGENT FLOW KNOBSWEEPING BROOMLIFT CONTROLSOLUTION CONTROLTHROTTLEGAS/LPDIESELTURN SIGNALCHECK ENGINE LIGHT (GAS/LP)PARKING BRAKEWATER TEMPERATURE GAUGEHOUR METERFUEL GAUGEOIL PRESSURE GAUGEVOLT METER MAIN BROOM SWITCHSIDE BROOM SWITCHDUST CONTROL SWITCHFILTER SHAKER SWITCHIGNITION SWITCHLIGHT SWITCHGLOW PLUG SWITCH(DIESEL ONLY)SIDE BROOM LIFTHORN PUSH BUTTONFOOT BRAKEBACKUP ALARM SWITCHACCELERATOR &DIRECTIONALCONTROL PEDALSEATADJUSTMENTP-5101ecp FIGURE 2IGNITION SWITCHThe keyed ignition switch is located to the right of the steering column on the front face of the instrument console.It has four positions.1. The key turned to the center “OFF” position will shut off the engine. The following items can be activated inthe “OFF” position.(A.) Horn(B.) Light Options2. The key turned to the left “ACCESSORY” position will allow the following additional items to be activated:(A.) Turn Signals(B.) Instrument Gauges3. The key turned to the right “IGN/ON” position will allow all the items listed above to be activated.This position will not start the engine.4. The key turned to the far right “START” position will start the engine. This position is a momentary position.The key will revert to the “IGN/ON” position when it is released.LIGHT SWITCHThe light switch is located above the horn button to the right of the steering wheel. It will work various light optionsthat are available for this machine, such as:* HEAD LIGHTS* TAIL LIGHTS* INSTRUMENT LIGHTSAll gauges, with the exception of the hour meter can have an optional internal instrument light.1-14 AMERICAN-LINCOLN7760

OPERATIONS OF CONTROLS AND GAUGESGLOW PLUG SWITCH (Diesel)Under no circumstances should any other unauthorized starting aids be used at the same time as Glow Plugs.The Glow Plug Switch is located to the right of the steering column on the front face of the instrument console.Use the following procedure to operate.1. Before operating the starter motor, press the “GLOW PLUG” button for 20 to 30 seconds.2. With the “GLOW PLUG” button still depressed, engage the starter motor until the engine starts.3. Continue to press the “GLOW PLUG” button for a few seconds after the engine has started until evenrunning has been obtained.4. If the engine does not start, disengage the starter motor, but keep the “GLOW PLUG” button depressedfor an additional 10 to 15 seconds. Keep the Glow Plugs energized while starting the engine and for a fewseconds after the engine has been running smoothly.HORN PUSH BUTTONThe horn button is located to the right of the steering column on the front face of instrument console. The hornbutton is always active. Push the horn button to sound the horn.SIDE BROOM LIFT (OPTIONAL FOR MANUAL DUMP)The Side Broom Lift Lever is located to the right of the instrument console. The handle pulled back and turned tothe right will raise the side broom and lock it into position.IGNITIONACCOFFIGN/ONLIGHTSLIGHTSSTARTGLOWPLUGHORNHORNGLOWSWITCH(DIESEL ONLY)PLUGSIDEBROOMLIFTP-4853ecp FIGURE 3AMERICAN-LINCOLN 1-157760

OPERATIONS OF CONTROLS AND GAUGESMAIN BROOM SWITCHThe Main Broom Switch is located on the console to the right of the steering wheel in the SWEEPING section. Thisswitch will activate the Main Broom. This switch has two positions “ON” and “OFF”. See Sweeping Broom LiftControl.SIDE BROOM SWITCH (Option For Manual Dump Machines)The Side Broom Switch is located on the console to the right of the steering wheel in the SWEEPING section. Thisswitch will activate the Side Broom. This switch has two positions “ON” and “OFF”. See Side Broom Lift Control.DUST CONTROL SWITCH (Wet Sweep Bypass Option - Option for Manual Dump Machine)The Dust Control Switch is located on the console to the right of the steering wheel in the SWEEPING section. Thisswitch will activate the dust control system.FILTER SHAKER SWITCH (Variable Dump Machines Only)The Filter Shaker Switch is located on the console to the right of the steering wheel in the SWEEPING section.NOTE - (Variable Dump Machines Only)THE MAIN BROOM SWITCH MUST ALWAYS BE PLACED IN THE OFF POSITION BEFORE SHAKING THEFILTER. FAILURE TO DO SO WILL RESULT IN DUST REMAINING ON THE SURFACE OF THE FILTERENVELOPES INSTEAD OF DROPPING INTO THE HOPPER.The button can be used when the ignition key is in the “ignition” position. The filter shaker control button is usedduring the sweeping cycle and the hopper unloading cycle. Use the filter shaker control switch to remove dust fromthe filter. Use the following procedures to operate the filter shaker control switch.1. After the machine has made a long sweeping run, turn the broom switch to the “OFF” position.2. Push the filter shaker control switch for 5 to 15 seconds to allow the filter to unload.3. Turn the broom switch to the “ON” position. Repeat this procedure after each long sweeping run.SWEEPINGMAINBROOMMAINBROOMONSIDEBROOMSIDEBROOMDUSTCONTROLDUSTCONTROLOFFONFILTERSHAKERFILTERSHAKEROFFP-4862 FIGURE 4NOTE - (Variable Machines Only)The main broom, side broom, dust control and filter shaker turn off automatically when the hopper isdumping and/or the dump door is in a closed position. SEE HOPPER LIFT and HOPPER DUMP DOOR.1-16 AMERICAN-LINCOLN7760

OPERATIONS OF CONTROLS AND GAUGESWATER TEMPERATURE GAUGEThe Water Temperature Gauge is located on the console panel above the steering wheel in the gauge cluster. Thegauge is mechanical and activated by a sender in the engine. It displays the engine coolant temperature in farenheight.HOUR METERThe Hour Meter is located on the console panel above the steering wheel in the gauge cluster. This meter isactivated when theengine begins running. The meter indicates actual “run” time of the machine. The meter is usedto indicate when maintenance should be done to the machine.FUEL GAUGEThe Fuel Gauge is located on the console panel above the steering wheel in the gauge cluster. This gauge indicatesthe level of fuel contained in the fuel tank.OIL PRESSURE GAUGEThe Oil Pressure Gauge is located on the console panel above the steering wheel in the gauge cluster. The gaugeis mechanical and activated by a sender in the engine. It displays the engine oil pressure in PSI.VOLT METERThe Volt Meter is located on the console panel above the steering wheel in the gauge cluster. The gauge indicatesthe charging or discharging of the battery.WATER TEMPERATUREFUEL GAUGEVOLTMETER°F 195170 22010077 91 2800104°C 1381/41/21012 1416WATERTEMPFUEL- +BATTERYHOURS0 0 0 0 11/100PSI4020 6080278kPa 553OILPRESSHOURMETERP-4865 FIGURE 5OIL PRESSURESCRUB BRUSHES SWITCHThe Brushes Switch is located on the console to the left of the steering wheel in the “SCRUBBING” section. Thisswitch in the position marked “LOWER” will lower the scrub brush deck and activate the three scrub brushes. TheBrush Rotation Switch and The Brush Pressure switch can not be activated unless this switch is in the “LOWER”position. This switch in the “RAISE” position will stop the brushes from rotating and raise the scrub brush deck.AMERICAN-LINCOLN 1-177760

OPERATIONS OF CONTROLS AND GAUGESBRUSH ROTATION SWITCHThe Brush Rotation Switch is located on the console to the left of the steering wheel in the “SCRUBBING” section.This switch reverses the rotation of the scrub brushes. This switch has two positions “NORMAL” and “REVERSED”.This switch can not be activated unless the Scrub Brush Lift Switch is in the “LOWER” position, the switch will lightwhen activated.BRUSH PRESSURE SWITCHThe Brush Pressure Switch is located on the console to the left of the steering wheel in the “SCRUBBING” section.This switch applies additional downward pressure to the scrub brushes. This switch has two positions “NORMAL”and “HEAVY”. This switch can not be activated unless the Scrub Brush Lift Switch is in the “LOWER” position, theswitch will light when the switch can be activated.SQUEEGEE BLADE SWITCHThe Squeegee Blade Switch is located on the console to the left of the steering wheel in the “SCRUBBING” section.This switch in the position marked “LOWER” will lower the squeegee and activate the squeegee vacuum. Thisswitch in the “RAISE” position will stop the squeegee vacuum and raise the squeegee. A switch activated by theforward-reverse foot pedal will automatically raise the squeegee if it is in the lowered position and the machine is inreverse.HIGH RECOVERY WARNING LIGHTThe High Recovery Warning Light is located on the console to the left of the steering wheel beside the “SCRUB-BING” section. The recovery warning light will illuminate approximately 5 minutes before the recovery tank is full,giving ample time to complete the scrubbing cycle before the mechanical float shuts off the vacuum to the recoverytank.LOW SOLUTION WARNING LIGHTThe Low Solution Warning Light is located on the console to the left of the steering wheel beside the “SCRUBBING”section. The Solution Warning Light will illuminate when the solution tank is empty, marking the end of thescrubbing cycle.RECOVERY HIGHWARNING LIGHTHIGHRECOVERYSCRUBBINGSCRUBBRUSHESSQUEEGEEBLADESQUEEGEEBLADE LIFTLOW SOLUTIONWARNING LIGHTLOWSOLUTIONBRUSHPRESSURELOWERRAISENORMALBRUSHROTATIONSCRUB BRUSHLIFTBRUSHROTATIONHEAVYREVERSEDBRUSHPRESSUREP-4854 FIGURE 61-18 AMERICAN-LINCOLN7760

OPERATIONS OF CONTROLS AND GAUGESHOPPER LIFT - (Variable Machines Only)The Hopper Lift Lever is located to the left of the steering wheel on the left side of the drivers compartment. Thislever, which is marked “HOPPER”, raises and lowers the debris hopper to ease unloading.WARNINGThe hopper may drop unexpectedly and cause injury, always engage the safety arm before workingunder the hopper.HOPPER DUMP DOOR - (Variable Machines Only)The Hopper Dump Door Lever is located to the left of the steering wheel on the left of the driver compartment. Thislever opens and closes the hopper door. This lever is located below the Hopper Lift Door and is marked “DUMPDOOR”.MANUAL DUMP HOPPER - (Manual Dump Hopper Only)The Manual Dump Hopper Lever is located under the front bumper. To Dump debris, pull the Manual dump lever allthe way to the position marked open. Leave the handle in the dump position and back the machine off the pile ofdebris. When clear of the debris, pull the manual dump lever to the position marked closed.SOLUTION CONTROLTo apply solution to the scrubbing brushes, push the solution control lever forward until the desired setting isreached. The solution rate is continuously variable from off to approximately 1-3/4 GPM at low and 3-1/2 GPM athigh. To stop application of solution, pull back on the lever until it stops at the “off” position. The solution warninglight will illuminate when the solution tank is empty, marking the end of the scrubbing cycle.NOTEFor best results, discontinue application of solution 10 feet beforestopping or making a 90° or 180° turn.SWEEPING BROOM LIFT CONTROLThe main broom lift control is located to the left of the driver seat. To lower the main broom, grasp the lever andpull back to clear the locking notch. Move the lever forward to the first or second notch in the elongated slot. Thefirst notch, “SWEEP”, is for normal sweeping (2 to 3 inch [5 to 8cm.] broom pattern). The second notch, “FLOAT”, is for heavysweeping (4 to 5 inch [10 to 13 cm.] broom pattern).HOPPERLIFTTo raise the main broom, pull the lever back and slide into thelocking notch. You may operate the main broom in either the“SWEEP” or “FLOAT” position. However, the “SWEEP” positionshould be used for normal sweeping and will result in increasedbroom life. The “FLOAT” position should be used only whensweeping extremely uneven areas.NOTE - (Variable Dump Machines Only)DUMP DOOROPENLOWERRAISEHOPPERDUMPDOOROPENCLOSEFLOATHIGHSOLUTIONCONTROLA switch triggered by the hopper and dump door’sposition controls the sweeping functions, main broom,side broom, dust control, and filter shaker. The hoppermust be down and the dump door open before thesefunctions will work.MAIN BROOMLIFT4-WAY TURN SIGNAL (Option)SWEEPING SOLUTIONCONTROLThe turn signal option is located on the steering column andP-4851 FIGURE 7works as automotive turn signals work, forward on the lever forright and back on the lever for left. The 4-way flasher will activate when the turn signal lever is pulled out.UPEEPLOWOFFAMERICAN-LINCOLN 1-197760

OPERATIONS OF CONTROLS AND GAUGESTHROTTLE CONTROLThe throttle control is located on the left side console. Gas and LP equipment have a throttle switch. Dieselversions have a lever. To operate the diesel: For full throttle, grasp the lever and push and right to the lockingnotch. To reduce to idle, grasp the lever and push it up and to the left (away from the locking notch). Let thelever lower until it rests at the bottom of the slot. “Load” (brooms and/or brushes and/or dust control operating)and “No Load” (brooms, brushes & dust control off) RPMs are the same for gas and LP equipment; The will be aslight drop between “Load” and “No Load” RPMs with diesels. Always return the throttle switch/lever to theidle position before turning off the key to stop the engine.MACHINE RPMsIDLE “NO LOAD”SWEEPER/ Gas/LP 950 2050SCRUBBER (1 speed) Diesel 950 2150SWEEPER Gas/LP 1st 950 2050(2 speed levels) 2nd 950 2450Diesel 1st 950 21502nd 950 2550CHECK ENGINE LIGHT (Gas, LP Only)The check engine light is located on the left side console. If the light comes on, it indicates a problem with theengine. Flip the switch located on/near the air cleaner bracket in the engine compartment and count the numberof times the panel light flashes, then go to the “Check Engine Light Codes” page at the end of this chapter todetermine the problem.PARKING BRAKEThe parking brake lever is located in the left side of the driver compartment floor. This lever when raised to theupright position will “lock” the foot brake pedal in the down position.FOOT BRAKEThe foot brake pedal is located to the right of the steering column on the floor of the driver compartment. The footbrake on front wheels is a mechanical system actuated by the brake pedal.LOCKEDPOSITIONPARKINGBRAKEP-4888 FIGURE 8 P-4887 FIGURE 91-20 AMERICAN-LINCOLN7760

OPERATIONS OF CONTROLS AND GAUGESFORWARDREVERSEP-4690 FIGURE 10ACCELERATOR & DIRECTIONAL CONTROL PEDALThe accelerator and directional control pedal is located on the floor of the driver compartment, to the right of thebrake pedal. The accelerator and directional control pedal controls the machine direction and travel speed.1. Put foot pressure on the upper portion of the pedal. The machine will move forward.2. Increase the foot pressure on the upper portion of the pedal to increase the forward speed.3. Put foot pressure on the lower portion of the pedal. The machine will move in reverse.4. Increase the foot pressure on the lower portion of the pedal to increase the reverse speed.5. To stop the machine, put light foot pressure on the opposite end of the accelerator and directional controlpedal. If the machine is moving forward put light foot pressure on the lower portion of the pedal. If themachine is moving in reverse put light foot pressure on the upper portion of the pedal.BACKUP ALARM SWITCHA switch that is located under the lower section of the Accelerator and directional control pedal operates the backup alarm. The alarm makes a loud audible noise when the machine is being driven in reverse.SEAT ADJUSTMENTThis lever is located on the right of the seat. This lever allows the seat to be adjusted forward or back when the leveris moved.AMERICAN-LINCOLN 1-217760

ESP SYSTEM OPERATING INSTRUCTIONSSOLUTION HIGHWARNING LIGHTONDETERGENTFLOW KNOBOFFRECYCLING SYSTEMON/OFF SWITCHP-4895 FIGURE 11THE ESP RECYCLING CONTROL PANELTHE ESP RECYCLING SYSTEM ON/OFF SWITCHThis switch turns the ESP recycling system on and off.DETERGENT LOWWARNING LIGHTSOLUTION HIGH WARNING LIGHTThe solution high warning light will come on if the solution tank is too full of water from the recycling system.DETERGENT LOW WARNING LIGHTThe detergent light will illuminate when the detergent tank is low, warning the operator to add detergent.DETERGENT FLOW KNOBThis rotary knob controls the detergent flow into the scrubbing solution. The operator may choose from anydetergent setting, for light to heavy cleaning applications. The detergent light will illuminate when the detergenttank is low, warning the operator to add detergent.HOPPER SAFETY LOCK ARM (Variable Dump Only)WARNINGWhen the hopper is raised the safety arm must beengaged before ANY work is done under thehopper.The Hopper Safety Lock Arm is located under the hopperassembly. After the work is complete the safety armmust be disengaged.HOPPERLIFT LEVERHOPPERDOOR LEVERP-5104 FIGURE 121-22 AMERICAN-LINCOLN7760

ESP SYSTEM OPERATING INSTRUCTIONSRECOVERYTANKSOLUTIONTANKRECOVERYTANKDETERGENTTANKSOLUTIONTANKBAFFLENON-RECYCLINGP-4795 FIGURE 13RECYCLINGTHE SCRUBBING SYSTEM - HOW IT WORKSThere are two scrubbing systems available for the 7760 machine, the non-recycling or standard scrubbing systemand the recycling or ESP scrubbing system.THE NON-RECYCLING OR STANDARD SCRUBBING SYSTEM - HOW IT WORKSDuring the scrubbing process (shown in Figure 14), detergent solution water from the solution tank is fed to thesolution line. There it is fed to the floor where three disc scrubbing brushes work to dislodge soil.After scrubbing, the dirty solution is vacuumed from the floor and discharged into the containment chamber in theforward portion of the recovery tank, where a system of baffles helps to clarify the solution. Sensors in each tank willindicate by lights on the control panel when the water in the solution tank is too low or when the water in therecovery tank is too high.CHECKVALVEORIFICEDETERGENTTANKSOLUTIONTANKSOLUTIONPUMPRECOVERYTANKDETERGENTPUMPP4759aFILTERFLOW VALVESCRUBBRUSHFLOORSEPARATORCONTACTFILTERAUTOFILFILLVALVECOUPLINGSQUEEGEESOLUTIONLINESOLTUIONTANKRECOVERYTANKVACUUMSCRUBBINGBRUSHESP-4759a FIGURE 14P-5103 FIGURE 15AMERICAN-LINCOLN 1-237760

ESP SYSTEM OPERATING INSTRUCTIONSTHE RECOVERY OR ESP SYSTEM - HOW IT WORKSDuring the scrubbing process (shown in Figure 16), filtered water from the solution tank is fed to the solution line,where it combines with detergent from the metering pump. This mixture is then fed to the floor where three discscrubbing brushes work to dislodge soil.After scrubbing, the dirty solution is vacuumed from the floor and discharged into the containment chamber in theforward portion of the recovery tank, where a system of baffles helps to clarify the solution on its way to thepumping chamber in the rear of the recovery tank. At intervals, a system of sensors activates the recycling pump,which sends filtered solution from the pumping chamber on its way to the solution tank. Here, it is ready to bemixed with fresh, metered detergent and repeat the cycle.RECOVERYTANKSOLUTIONTANKRECOVERYTANKDETERGENTTANKSOLUTIONTANKBAFFLENON-RECYCLINGRECYCLINGP-4795-1 FIGURE 161-24 AMERICAN-LINCOLN7760

ESP SYSTEM OPERATING INSTRUCTIONSSOLUTIONLINEVACUUMSOLTUIONTANKSCRUBBINGBRUSHESRECOVERYTANKP-5103 FIGURE 17AMERICAN-LINCOLN 1-257760

ESP SYSTEM OPERATING INSTRUCTIONSTHE VARIABLE DUMP SWEEPING AND DUST CONTROL SYSTEMS - HOW THEY WORKVariable Dump 7760 machines are equipped with a sweeping and dust control system. Figure 18 shows thehighest position for the variable dump.HOPPERLIFT LEVERHOPPERDOOR LEVERP-5104 FIGURE 181-26 AMERICAN-LINCOLN7760

DUST CONTROL OPERATING INSTRUCTIONSP-5105 FIGURE 19The debris from sweeping is thrown into the hopper (Figure 19). The baffle system that is built into the variable dumpdebris hopper is designed to minimize dust in the air while the machine is sweeping. The impeller vacuum fan pullsthe lighter dust up and through a baffle system. The Pre-Clean Flap separates the heavier dust particles to an areabelow the filters. The dust filters capture the lighter dust particles. This allows the dust filters to remain cleaner andneed less shaking to remove dust. When the dust filters become clogged the filter shaker switch should be pushedto start the dust shaker cycle. This will extend the life of the filters.NOTETURN MAIN BROOM OFF FIRSTAMERICAN-LINCOLN 1-277760

OPERATING INSTRUCTIONSFILLING THE SOLUTION TANKNON-RECYCLING or Standard Scrubbing System1. Make sure the solution control lever is in the “Off” (rear) position.2. Open the solution tank cover (right hand side).3. Fill the tank with 100 gallons of water and the correct mixture of American-Lincoln #100 IndustrialCleaner for the job on hand.4. Close the solution tank cover (right hand side).RECYCLING or ESP System1. Make sure the solution control lever is in the “Off” (rear) position.2. Open the solution tank cover (right hand side).3. Fill the solution tank as outlined above with 100 gallons of pure water.4. Fill the detergent tank with 5 gallons of American-Lincoln #100 Industrial Cleaner.5. Close the solution tank cover (right hand side).NOTE:Fill recovery tank ½ way with water for the ESP systemWARNINGTo prevent over-sudsing and machine damage, use only AMERICAN-LINCOLN Industrial CleaningSolution # 100.WARNINGDO NOT put gasoline, combustible or flammable material in the solution, recovery or detergent tanks.NOTEBefore starting the engine, perform the pre-start checklist.PRE-START CHECKLIST1. Clean engine air filter element2. Check engine oil level3. Check radiator coolant level4. Check hydraulic fluid level5. Check fuel level6. Check all systems for leaks7. Check brakes and controls for proper operationBEFORE STARTING ENGINE1. Set parking brake2. Make sure all controls are in the “Off” positionTO START ENGINE1. Be sure accelerator and directional control pedal is in neutral.2. Turn key to “On” position and hold it until the engine starts.3. If engine fails to start after following the above procedures, refer to Engine Manual Section.1-28 AMERICAN-LINCOLN7760

WARNINGIt is not advised to store the machine in below-freezing temperatures unless all fluids have beendrained from the detergent solution and recovery tanks and associated systems. When machine hasbeen stored in below-freezing temperatures, run engine at lowest possible settings and let machinesit 5-10 minutes to warm engine and hydraulic oil.POST START CHECKLIST (Engine Running)1. Check broom pattern.2. Check squeegee deflection.OPERATING INSTRUCTIONSTO TRANSPORT MACHINE (No scrubbing or sweeping)1. Be sure the sweeping broom, brushes and squeegee are in the “Up” position with all other controls in the“Off” position.2. Release parking brake.3. Push throttle control up.4. Push forward on the directional control pedal to place the machine in motion.5. Vary your foot pressure on the directional control pedal to obtain desired travel speed.6. To stop, allow directional control pedal to return to neutral (centered) position. (Pedal will automaticallyreturn to neutral when foot pressure is released). FOR NORMAL OPERATION, DEPRESS DIRECTIONALCONTROL PEDAL WITH HEEL INTO NEUTRAL.7. Push engine throttle down. Turn key to “Off”.8. Set parking brake.TO BEGIN THE CLEANING OPERATION1. Choose the mode of operation (recycling ESP or non-recycling STANDARD) as dictated by the machine fillor machine type.2. Bring engine to full RPM.3. Lower the main broom.4. Lower the side broom.5. Turn on the main and side brooms.6. Sweep for the length of the machine.7. Move recovery switch to the “On” position.8. Lower the scrub brushes.9. Lower squeegee to the “Lower” position.10. Move solution control lever to the desired setting.11. Turn on the Recovery Switch for the ESP Recycling system, if applicable.12. Begin scrubbing operation.Single sweep and scrub the average floor with light to medium soil. In this operation the cleaning is accomplishedin one pass, with simultaneous solution feed, sweeping, scrubbing and dirty water pick up. The rate of solution feedand the speed of travel required will vary with floor condition. This knowledge will come with operator experience.TO STOP THE CLEANING OPERATIONDiscontinue the cleaning operation whenever a solution or recovery warning or stop light is illuminated.The solution light will illuminate when the solution tank is empty. At this time, discontinue the scrubbing cycle, putall controls in position for transport and drive to the drain area. See pages 30-32 for instructions on how to drain andclean the recovery tank, solution tank, and debris hopper.The recovery warning light will illuminate approximately 5 minutes before loss of vacuum to the recovery tank. Thiswarning period should give ample time to complete the scrubbing cycle and transport or scrub to the drain area.AMERICAN-LINCOLN 1-297760

OPERATING INSTRUCTIONSNOTEAfter stopping the engine, perform this post operation checklist.POST OPERATION CHECKLIST1. Clean debris hopper. 2. Check sweeping broom for wear or damage.3. Check all flaps for wear, damage and adjustment. 4. Drain and clean solution tank (ESP system)5. Clean solution filter screen (ESP system) 6. Drain and clean recovery tank.7. Clean recovery tank screens and floats. 8. Check manifold and vacuum hoses for debris orobstructions, backflush if necessary.9. Check scrub brushes for wear or damage. 10. Check rear and side squeegees for wear, damage andadjustment.11. Fill fuel tank. 12. Check all systems for leaks.TO DRAIN SOLUTION TANK (RECYCLING OPERATION) (ESP System)Draining the solution tank is accomplished by a 4-foot (92 cm.) long drain hose located under the frame channel. Todrain the tank, lower the hose, remove the plug and drain. When the draining operation is completed, clean thesolution tank as outlined below.TO CLEAN SOLUTION TANK (RECYCLING OPERATION) (ESP System)Cleaning the solution tank is simplified by the large access cover. Flush all deposits from the tank, also flush allprobes and the solution line strainer to remove any deposits, remove strainer if necessary. When the cleaningoperation is completed, plug and replace the hose. Close and secure covers.TO DRAIN RECOVERY TANKA 4-foot long drain hose for the recovery tank is located under the frame channel. To drain the tank, lower the hose,remove the plug and drain. Open the recovery tank and remove the drain plug. When the draining operation iscompleted, flush and clean the recovery tank as outlined below.P-4766 FIGURE 20TO CLEAN RECOVERY TANKThe large access cover on the recovery tank simplifies the cleaning process. Once the recovery tank lid is opened,tip out the tank. With the recovery tank in the tipped out position (figure 20), flush all sand, sludge, debris, etc. outof the tank with a water hose, then replace the tank and flush the manifold, ball float screen and level switch toremove any deposits. The tank lid should be removed and cleaned approximately every 50 running hours.WARNINGDo not attempt to flush large amounts of tank debris through the drain hose, this will cause cloggingand hamper future drainage. Always flush the recovery tank with clean water at the end of eachcleaning cycle. Never let debris accumulate, settle and harden in the tank or on associated hardware.1-30 AMERICAN-LINCOLN7760

OPERATING INSTRUCTIONSHOPPERLIFT LEVERHOPPERDOOR LEVERTOW CONTROLSHAFTP-5104 FIGURE 21 P-4183 FIGURE 22DOUBLE LID RECOVERY TANKThe Recovery Lid is a double lid. Removing the two hex head bolts, located on the side of the lid can open the lid.The oil cooler and recovery tank vacuum pump are located in the lid.OIL COOLERThe oil cooler is located in the recovery tank double lid.TO EMPTY DEBRIS HOPPER1. Transport or sweep and scrub to the dump site.2. Close the hopper dump door with the hopper dump lever.3. Raise the hopper with the hopper lift lever to the desired level.4. Move the machine forward, over the dumpster, if necessary.5. Open the hopper dump door with the hopper dump lever.6. Lower the hopper with the hopper lift lever to the normal operation position.NOTE (Variable Dump Only)The sweep functions - main broom, side broom, dust fan, and filter shakers - only work when thehopper is down and the dump door is open.TOWING INSTRUCTIONS (See Figure 22)1. Locate tow control shaft extension as shown in Figure 22. (See arrow)2. To open hydraulic circuit to wheel drive motor, turn shaft 90° so that the flats on the shaft are parallel to thefront axle.3. After towing, turn shaft 90° so that the flats on the shaft are parallel to the pump centerline.AMERICAN-LINCOLN 1-317760

SERVICE CHARTFor service assistance, consult the yellow pages under power sweepers and scrubbers. For best performance, replaceworn parts with genuine American-Lincoln parts.EVERY 8 HOURS or DAILY operation check and clean/adjust if necessary:1. Inspect panel filters for damage and clean.2. Check engine oil level.3. Check hydraulic fluid level.4. Check radiator core for blockage.5. Check all flaps for wear or damage.6. Check brooms for wear or damage, adjust as required.7. Check panel filters (clean side) for leakage.8. Check brake pedal and parking brake.9. Check for LP/Diesel odor at connections.10. Check water separator (Diesel).11. Check engine air cleaner.12. Check hydraulic oil filter.13. Check coolant level.50 HOUR (WEEKLY) MAINTENANCE CHECKLIST14. Solution tank (recycling or ESP system).15. Solution filter screen (recycling or ESP system).16. Recovery tank. (Include cleaning of tank lid.)17. Recovery tank screens and filters.18. Scrub brushes for wear or damage.19. Rear and side squeegees for wear or damage.20. Check tension on all belts.21. Check battery electrolyte level. (Unless Maintenance-Free Battery)22. Check all hydraulic hoses for wear or cuts.23. Rotate main broom (end-to-end).24. Clean or replace panel filters.Perform recommended engine maintenance (see engine manual if applicable).100 HOUR MAINTENANCE CHECKLIST25. Change crankcase oil.26. Change engine oil filter.27. Lubricate drive wheel, l swivel wheel bearings, and steering rack guide (engine side above rear wheel).MAKE SURE TO GREASE ZERK LOCATED ABOVE PINION RACK (See Rear Wheel Assy., Chapter 2)28. Lubricate front wheel bearings.29. Lubricate all moving joints.30. Check brake pads for wear and adjust accordingly.31. Lubricate all 6 (Diesel)/4 (Gas/LP) DANHOUSER Bushings with NAPA #765-1363 or equivalent anti-seizelubricant. The bushings are located on the steering, scrub deck lift, squeegee lift, main broom lift, both threadedends of the throttle cable and variable dump door cylinders. Perform recommended engine maintenance (seeengine manual if applicable).250 HOUR MAINTENANCE CHECKLIST32. Lubricate squeegee casters.33. Clean solution tank and filter screen.34. Replace engine air filter element.35. Flush radiator coolant system.36. Remove spark plug - clean or replace (Gas/LP).37. Check distributor and points - service or replace (Gas/LP).38. Clean and lubricate governor linkage (Diesel).39. Replace fuel filter.40. Replace hydraulic filter element.Perform recommended engine maintenance (see engine manual if applicable).400 HOUR MAINTENANCE CHECKLIST41. Clean hydraulic reservoir.42. Clean hydraulic intake strainer.43. Change hydraulic fluid.Perform recommended engine maintenance (see engine manual if applicable).1-32 AMERICAN-LINCOLN7760

SERVICE CHART20 2, 25 39 36, 3711, 34 17 16413, 35382621319318 15, 33 1441, 42, 433 29 1, 7, 2412, 40312728, 3032191829 5 31 6, 23AMERICAN-LINCOLN 1-337760

HELPFUL HINTS FOR CLEANING OPERATIONSIDE AISLESMAIN AISLEP4134/0001SIDE AISLESP-4134 FIGURE 23WARNINGDo not turn the steering wheel sharply when the machine is in motion. The sweeper is very responsiveto movement of the steering wheel. Do not make sudden turns.Scrub in straight paths. Do not bump posts. Do not scrape the sides of the machine.When the machine is in motion, do not push the directional/speed control pedal all the way forward.This is the same as starting in “High” and will put a strain on the motor and drive system.1. Plan your sweeping and scrubbing in advance. Try to arrange long runs with minimum stopping and starting.Sweep debris from narrow aisles out into main aisle ahead of time. Do an entire floor, or section at one time.2. Pick up oversize debris before sweeping.3. Allow a few inches of overlap of sweep and scrub paths. This will eliminate leaving dirty patches.4. Don’t turn steering wheel too sharply when machine is in motion. The machine is very responsive tomovement of the steering wheel - so avoid sudden turns.5. Try to follow as straight a path as possible. Avoid bumping into posts or scraping the sides of the machine.6. When placing the machine in motion, avoid slamming the directional control pedal all the way forwardquickly. This is equivalent to starting out in “HIGH” and puts needless strain on the engine and drive system.7. Always allow the machine to warm up before operating in cold temperatures.8. Periodically turn the sweeping broom end for end to prevent the bristles from “setting” in one direction.NOTEReplace sweeping broom when bristles are worn to 3-inch (8-cm.) length. Replace disc brushes whenbristles are reduced to 1/2 inch (1.3 cm) in length. Replace squeegee rubbers when all usable edgeshave become rounded with wear, impairing the wiping action.1-34 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCEHYDRAULICSFILLHYDRAULICRESERVOIRHOW TO FILL THE HYDRAULIC RESERVOIR1. Access to the hydraulic reservoir is locatedbeneath the driver’s seat.2. Open the hydraulic reservoir breather filter cap.3. Remove any debris that is in the breather filtercap screen.4. Fill the reservoir until the fluid is at the “FULL” lineon the hydraulic fluid sight gauge. The sightgauge is located on the front of the hydraulicreservoir.5. Close the hydraulic reservoir breather filler cap.6. Put the driver’s seat back into position.P5089P-5089 FIGURE 26HOW TO CLEAN THE HYDRAULIC SYSTEM1. Put a drop cloth on the floor.2. Drive the machine onto the drop cloth.3. Set the parking brake.4. Tip the seat to the side.5. Put a container under the reservoir drain to catch the reservoir fluid.6. Remove the drain plug. The reservoir fluid will drain. Do not use the drained reservoir fluid to refill thehydraulic reservoir. Dispose of the used fluid.7. Flush the interior of the hydraulic reservoir with clean fluid.8. Put the reservoir plug, removed in step six back in the hydraulic tank drain and tighten. A pipe thread sealeris required on the plug.9. Open the breather filter cap.10. Fill the reservoir with new FORD type “F” automotive transmission fluid. The capacity of the tank is 10gallons. Fill to the “FULL” line on hydraulic fluid sight gauge.11. Close the breather filter cap.12. Tip the seat back to its original position.P-5091/9907COVERSPRINGO-RINGFILTERELEMENTFILTERBODYP-5091 FIGURE 27HOW TO REPLACE THE RETURN FILTERELEMENT1. Replace the return filter after 250 hours ofmachine run time.2. Unscrew the fasteners from the filter assemblycover and retain.3. Remove the cover and the compression springand retain.4. Discard old filter element.5. Position new filter element inside the filter body.6. Put the compression spring in position. Wipe thecover magnet free of any metal filings or debris.7. Place O-ring (Moisten with clean hydraulic fluid)and cover into position.8. Reattach fasteners to filter cover.9. Wipe clean any hydraulic reservoir fluid spills.The fluid can damage painted surfaces of themachine.1-36 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCEENGINERead and follow all the instructions in the Engine Manual Section. Due to the nature of work being done by themachine, extra care must be taken to protect the engine from these elements. Check the oil each day beforestarting operations. Be sure to check the air filter cap’s dust collector and empty as necessary. Also check theair cleaner and replace as conditions demand. Do not let the engine become coated with dust and dirt.MAINBROOMRIGHT,BROOMCHAMBER DOORDRIVEHUBIDLERARMRETAININGBOLTP-5116 FIGURE 28TO REMOVE MAIN SWEEPING BROOM1. Open the left broom chamber door.2. Put the main broom control in the “SWEEP” position.3. Remove the retaining bolt.4. Remove the idler arm assembly.5. Remove the main broom and discard.6. Put a new main broom in the broom chamber.7. Rotate the new broom to the right on the drive hub until it engages the drive hub broom tabs.8. Put the idler arm assembly in place.9. Put the retaining bolt in place and tighten.10. Close the broom chamber door.11. Start the engine.12. Put the broom lever in the “SWEEP” position.13. Let the broom sweep in place for 30 seconds.14. Put the broom lever in the “UP” position.15. Back the machine off the test spot.16. Inspect the polished area where the broom swept, for broom bristle contact with the floor. The area of broombristle contact with the floor should be 2 to 3 inches (5 to 8 cm.) wide.AMERICAN-LINCOLN 1-377760

GENERAL MACHINE MAINTENANCEMAIN BROOM LEVEL ADJUSTMENTThe main broom level is factory set and shouldn’t need adjustment, if the level gets out of adjustment and the broombristle contact pattern is not an even 2" to 3" (5 to 8 cm.) wide. Adjust the broom arm lift frame. The frame issupported by two flange bearings. These bearings are located inside the broom doors. The carriage bolts on the twoend flanges must be loosened. The frame can then be leveled and the bolts tightened.HOW TO ADJUST MAIN BROOM WEAR PATTERNWhen the bristles of the broom begin to wear out the following adjustments may be made to keep a 2-inch (5-cm.) broom pattern.1. Loosen the nut located in the engine compartment.2. Set the broom lever to the “Sweep” position and adjust the lock nut to obtain a 2-inch (5 cm) broom pattern.The lock nut will move the adjusting rod that adjusts the sweeping pattern of the broom for wear.RAISE ORLOWER FORWEAR ADJUSTMENTFLOORCONTACTAREAFORWARD3SIDEBROOMP-5117 FIGURE 29SIDE BROOM LEVEL ADJUSTMENTAs the side broom wears, loosen the two wear adjusting bolts and slide the broom-motor assembly into a positionso that the broom contacts the floor at a 3 degree angle when lowered as shown in Figure 29.SIDE BROOM REPLACEMENTPut the side broom lift control in the “UP” position. Remove the retaining screw in the bottom middle of the sidebroom. Remove the side broom. Transfer the side broom flange spacer and screws to the replacement side broom.Put the replacement side broom on the shaft. Put the retaining screw in position and tighten.1-38 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCE1/16"SET FLAPEVEN WITH FLOORP-4793 FIGURE 30FLAPSThe urethane and rubber flaps are susceptible to damage and should be inspected regularly and maintained in goodcondition. The side flaps are adjustable and should be maintained at approximately 1/16" (16 mm.) above the floor.The front and rear flaps have no provision for adjustment.All flaps should be replaced when worn or damaged to such an extent that they couldn’t perform their function.AMERICAN-LINCOLN 1-397760

GENERAL MACHINE MAINTENANCEBRUSHLATCHP-4762 FIGURE 31SCRUB BRUSH REPLACEMENT1. Raise the scrub brush deck by pressing the “Scrub Brush” Switch on the instrument panel.2. Press the brush latches in to release the scrub brush.3. Remove old scrub brush.4. Snap new brush into place.COVERS AND LATCHESThe covers have been designed to allow access, either by hinge or removal, to all areas of the machine. Nomaintenance is required. For lubrication of latches see Lubrication Section.SOLUTION WARNING LIGHTThe solution warning light will illuminate when the solution tank is empty. This part of the level control systemrequires no maintenance. If the system fails to operate, consult the Electrical Troubleshooting Guide.RECOVERY WARNING LIGHTThe recovery warning will illuminate approximately 5 minutes before loss of vacuum to the recovery tank. This partof the level control system requires no maintenance, except for daily cleaning of the tank level switch. If the systemfails to operate, consult the Electrical Troubleshooting Guide.SOLUTION CONTROL (Non-Recycling or Standard)The solution control lever controls the amount of solution applied to the scrubbing brushes. Except for a few dropsof oil applied to the lever pivot every 100 hours, the system should require no major maintenance.The solution control should shut off completely with the lever in the (rear) “off” position. If complete shut off does notoccur, the control cable should be adjusted.SOLUTION CONTROL (RECYCLING or ESP System)In the recycling mode, the solution control lever is also used to activate the detergent pump. If the detergent pumpfails to operate (engine running) when the solution control lever is moved into the low to high range, first check thecircuit by manually activating the switch. If the detergent pump does not operate at this time, a further electrical ormechanical check is indicated. (See Electrical Troubleshooting Guide or Detergent Pump Troubleshooting).1-40 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCERECYCLING PUMP ESP SystemThe recycling pump is located directly behind and under the recovery tank. The pump is electric and except fordaily cleaning of the pump intake screens, it requires no regular maintenance.NOTEDo not run pump dry. The unit depends on the liquid pumped for lubrication.RECYCLING (ESP) PUMP STORAGEAlways drain pump for extended storage, especially when freezing temperatures may be encountered.REAR SQUEEGEEThe squeegee will require service when the inner edges of the blades become round with wear, impairing the wipingaction or water pickup. To service the rear squeegee use the following steps:1. Loosen the four aluminum knobs (item 10, these hold the squeegee tool to the squeegee support)2. Remove the squeegee tool and turn upside down to service the blades or caster wheels. The squeegeeblades are designed to flip over and use another unworn edge (item 5 & 6).To service the blades:1. Loosen the clamp bolts, which clamp items 8 & 9 together.2. Loosen far enough to slip the end clamp brackets off the squeegee tool. This will allow flipping the blades orinstalling new blades.3. Install blades so that outer blade is 3/16” longer than inner blades, this is achieved by assembling the topedge of the blade against the squeegee tool weldment.4. Reinstall squeegee clamp band and tighten clamp bolt tight.1056APPLY NEVERSEIZE89P5165/9907SQUEEGEE CASTER WHEELSGrease caster wheel zerks (2) on each caster should be greased each time the blades are serviced for a total of 3caster wheels.ADJUSTING CASTERSLower squeegee on a flat surface, making sure the rear squeegee blade is perpendicular to the surface. Adjustcaster 3/16" above the flat surface, Lock jam nuts.AMERICAN-LINCOLN 1-417760

GENERAL MACHINE MAINTENANCEHOLD DOWN STRAPRECOVERYTANK LIDREMOVE 2SCREWS TOEXPOSE INTERIOROF RECOVERYTANK LIDP-4898 FIGURE 32RECOVERY TANK LID AND TANK ACCESSRemove the two hex head screws to access the inside of the recovery tank lid. The hydraulic oil cooler is locatedinside the lid. See figure 34. To gain access to the Recovery Tank, open the engine cover and loosen the hold downstrap located on the side of the recovery tank.TENSIONKNOBBRAKEPEDALBRAKELEVER SPRINGPARKINGBRAKEPULL RODP-4886 FIGURE 33BRAKE ADJUSTMENT1. Connect pull rod, preset to 44.5 inch (113 cm) clevis centerlines, to brake lever then adjust to fit with brakepedal full up and the spring attached.2. Adjust tension knob on parking brake lever to hold machine on an 8-degree incline.1-42 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCEAIR INTAKE SYSTEMNOTEMonitor the air filter indicator dailyThe importance of replacing the air filter at the appropriate time cannot be overemphasized. Even a small amountof dirt ingested through the air intake system will wear out a set of piston rings in just a few hours.Always cover the air intake when removing the air filter for replacement. Keep all other air intake components,such as hoses and clamps, secure and in good condition to prevent intake of unfiltered air.AIR FILTERThe elements contained within this air filter are NOT reusable. There is no interim cleaning involvedother than a daily emptying of the dust collector housed in the filter cap. Squeeze and release therubber valve on the filter cap several times to expel any dust or dirt that has accumulated. ReplaceBOTH the safety and main filter elements when the filter service indicator reaches the red band. Theindicator will remain at the red band level even after the engine has been shut down. Reset theindicator by depressing the black button at the bottom.P-4713 FIGURE 34TO REPLACE AIR FILTER ELEMENTS1. Stop the engine and engage the machine parking brake.WARNINGAlways park on a level surface, stop the engine, and engage parking brake before working on themachine to keep it from creeping or rolling.2. Unhook the two latches on the filter housing3. Remove the cap4. Clean dust collector (housed in cap) by squeezing and releasing the rubber valve several times5. Remove both filter elements and discard6. Insert new safety and main filter elements7. Replace cap and close latchesAMERICAN-LINCOLN 1-437760

GENERAL MACHINE MAINTENANCESAFETY AIR CLEANERDUST COLLECTORRUBBER VALVEAIR FILTER CAPw/DUST COLLECTORMAIN FILTER ELEMENTSAFETY FILTER ELEMENTAIR FILTER HOUSINGFIGURE 351-44 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCECOOLING SYSTEMCOOLANT LEVELCheck the coolant level in the radiator daily, only when the engine is cool.Maintain the coolant level at approximately 3/4 inches (1.9 cm.) below the filler neck seat on the radiator when thecoolant is cold.COOLANT LEVEL3/4 TO 1-1/2 INCHESBELOW CAP SEALWhenever coolant level checks are made, check conditionof radiator cap rubber seal. Make sure it isclean and free of any dirt particles. Rinse off withclean water if necessary. When replacing cap onradiator, also make sure radiator filler neck is clean.P-4404 FIGURE 39WARNINGNever remove the radiator cap under anyconditions while the engine is operating.Failure to follow these instructions couldresult in damage to the cooling system orengine and/or personal injury. To avoidhaving scalding hot coolant or steam blow outof the radiator, use extreme care whenremoving the cap from a hot radiator, ifpossible, wait until the engine has cooled,then wrap a thick cloth around the radiatorcap and turn it slowly to the first stop. Stepback while the pressure is released from thecooling system. When you are sure all thepressure has been released, press down on the cap (still with a cloth), turn and remove it. Do not addcoolant to an engine that has become overheated until the engine cools. Adding coolant to anextremely hot engine can result in a cracked block or cylinder head.Use only a permanent type coolant that meets FORD specification ESE-M97B44-A such as FORD CoolingSystem Fluid. Refer to the coolant chart on the container for additional antifreeze protection information. Do not usealcohol or methanol antifreeze, or mix them with the specified coolant. Plain water may be used in an emergency,but replace it with the specified coolant as quickly as possible to avoid damage to the system. With only water inthe system, do not let engine run hot.RADIATORInspect the exterior of the radiator for obstructions. Remove all bugs, dirt or foreign material with a soft brush orcloth. Use care to avoid damaging the fins. If available, use compressed air or a stream of water in the oppositedirection to normal airflow. Open door for access.Check all hoses and connections for leaks. If any of the hoses are cracked, frayed, or feel spongy, they should bereplaced.AMERICAN-LINCOLN 1-457760

GENERAL MACHINE MAINTENANCEDRIVE BELTSThe drive belt(s) should be properly adjusted at all times. Loose drive belts cause improper alternator, fan and waterpump operation, and overheating. Overtightening the belt may result in excessive wear on the alternator and waterpump bearings, as well as premature wear on the belt itself. Therefore, it is recommended that proper belt tensionbe maintained.BATTERY1. Access the battery through the door locatedbeside the driver’s seat.2. Open the seat cover and unscrew the accessbolt to the battery door.3. Swing the battery door out.4. Keep the top of the battery clean and dry.Keep the terminals and connectors clean. Toclean the tops of the batteries, use a dampcloth with a weak solution of ammoniaor bicarbonate of soda solution. To clean theterminals and connectors, use a terminal andconnector-cleaning tool.5. Swing the battery door closed and fasten theaccess bolt.6. Put the seat into position.P-5090P-5090 FIGURE 40WARNINGNEVER allow the soda solution to enter thecells. This will permanently discharge thebattery.GAS TANKThe gas tank is located under the driver’s seat. Itmay be filled from the rear of the machine.P-4890 FIGURE 411-46 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCELP FUEL SYSTEMThe LP fuel system consists of several components not found on the gasoline system. The LP fuel system alsocontains the associated mounting hardware and plumbing for the LP components. The major LP components areas follows (these components are factory set, adjustments to these components should only be made by authorizedservice personnel):1. Throttle plate & mixer2. Combination water-heated vaporizer & regulator3. Megajector4. LP fuel tank, valves & fittingsMIXERFUEL LOCKTANK VALVETANK RELIEF VALVELP FUEL TANKREGULATOR/VAPORIZERPRESSURE RELIEF VALVEMEGAJECTORP4502ecpTHROTTLE PLATEP4502ecpLP VAPOR WITHDRAWAL SYSTEMThe liquid fuel flows from the tank under its own pressure to the pressure relief valve. This valve is normallyclosed, which prevents fuel from escaping into the atmosphere. When the engine is running, LP then flowsthrough the open fuel lock (lock automatically closes when engine is shut down) and into the vaporizer/regulatorwhere it is converted to a gaseous state. (The regulator reduces the tank pressure and makes the flow moreconstant.) As the vaporized LP moves through the Megajector, the Megajector meters the amount of LP necessaryto be piped into the mixer where it is then introduced into the air flow and sent to the combustion chamber.LP FUEL VAPORIZER-REGULATOR QUICK CHECKTurn on the ignition switch and open the radiator cap. Check the coolant for bubbles. If bubbles are present, thevaporizer may have a leaking gasket or may have developed a pinhole leak, allowing fuel into the cooling system.LP FUEL TANKThe LP tank is located under the driver’s seat. Use only the proper size and type of LP tank. The 7760 LP-poweredsweeper uses 33.5 lb. liquid withdraw tank. The DOT designation of the tank is DOT 4BW-240. The liquid volumepermitted in the container is less than the total volume of the cylinder. This provides for expansion of the LP fuelshould be temperature increase above the normal amounts. Excessive heat may cause the fuel to expand toomuch causing the safety relief valve to vent some LP fuel, relieving internal tank pressure.Each tank is marked showing the type of construction (liquid or vapor), the manufacturer, the date of manufacture,the capacity, the weight, and the date of re-qualification. D.O.T. fuel tanks must be re-qualified (checked)periodically. This re-qualification must be recorded and maintained for the life of the container.AMERICAN-LINCOLN 1-477760

GENERAL MACHINE MAINTENANCELP fuel tanks are equipped with the following approved valves and fittings:WATERVAPOROUTLETP-4563ALPGINLETPLUGMOUNTING HOLESSafety Relief Valve - This is a spring loaded valvethat relieves excessive pressures which may develop inthe tank due to unusual conditions.Liquid Service Valve - Liquid is withdrawn from thetank through this valve. The LP tank may be filledthrough this valve if the tank is not equipped with a fillervalve.Excessive Flow Valve - This valve is part of the LiquidService Valve. It is mounted inside the tank andprevents LP fuel from leaving the LP tank in the eventof accidental breakage of external fittings or hoses. Itpermits flow in either direction but stops outward flow ifthat flow becomes excessive.Filler Valve - This valve is optional. If this valve is notpresent, the tank if filled through the service valve.Liquid Level Gauge - This gauge is optional.P-4563AUSE AND CARE OF LP TANKSIf an LP tank is damaged or leaking, it should be immediately removed to a designated safe area and the properpersonnel should be notified. Do not attempt to make repairs to the cylinder regardless of its conditions.Repairs must be made by qualified personnel.The care of an LP tank receives has a direct bearing on how long the tank can be used safely. LP tanks mustnot be dropped, dragged, or slid across any surface. To move the LP tank, use a hand truck or roll the tank onits foot ring while it is being held in a position slightly off the vertical.CHANGING LP TANKSReplacing the empty LP tank with a full one is an important operation because it presents an opportunity for themachine operator to carefully inspect the tank, tank fittings, the fuel lines and fuel line fittings. If abnormal wearis detected, the operator should report these findings to the appropriate personnel for immediate action.TO BEGIN CHANGING THE LP TANK- Park the machine in a designated safe area and set the parking brake.- Close the tank valve.- Remove the quick-disconnect coupling from the tank valve.- Inspect the machine’s fuel lines and the quick disconnect coupling for damage or abnormal wear.- Remove the empty tank from the holding device.- Inspect the tank and tank fittings for damage or abnormal wear. Handle the tank carefully. It must not bedropped or mishandled.- Store the LP tank in a designated safe area.- Select a filled LP tank and observe for damage or leaks.- Carefully install the filled tank in the machine so that the tank centering pin enters the aligning hole in thetank collar. This assures that the tank is positioned properly and allows for proper operation of the safetyrelief valve, liquid level gauge, and service valves.- Fasten the tank retaining bracket so that the tank is locked into position.- Reconnect the fuel line to the tank servicing coupling.- Open the service valve slowly and check for leaks. If a leak is found, close the valve immediately andnotify the appropriate personnel.- If no leaks are detected, the engine is ready to start. Do not start the engine unless the operator is inposition with the directional control pedal in the neutral position.1-48 AMERICAN-LINCOLN7760

GENERAL MACHINE MAINTENANCESTORAGE OF LP FUEL TANKSWhether the storage is inside or outside, the LP tanks should not be in the vicinity of combustible materials orhigh temperature sources such as ovens or furnaces. This may cause the heat to raise the pressure of the fuelto a point where the safety relief valves would begin operation. Care should be taken to ensure that the cylindersare stored in such a manner that if the safety relief valves are triggered, the vapor will be relieved rather thanany liquid. Valves on empty tanks must be closed during storage and transportation.Similar precautions should be taken in storing machines fitted with LP fuel tanks. They may be stored orserviced inside buildings provided there are no leaks in the fuel system and the tanks have not been overfilled. Ifmachines are being repaired inside a building, the shutoff valve on the tanks must be closed except when theengine must be on during servicing.NEUTRAL ADJUSTMENTNOTEOrientation of the transmission arm assembly depends upon which engine is installed in the 7760.Adjustment directions given are as seen from the operator’s position in the driver’s seat.1. Check Gas/LP engine RPM (2050); or Diesel engine RPM (2150). Check hydraulic reservoir oil level.2. Raise rear of machine onto jack stands so rear wheel is off the ground.3. Loosen the jam nut away from the adjustment nut.4. If the rear drive wheel is turning forward, turn the adjustment nut clockwise (this will shorten the threadedshaft). If the rear drive wheel is turning in reverse, turn the adjustment nut counter-clockwise (this willlengthen the threaded shaft).5. Tighten the jam nut against the adjustment nut.6. Test operation of neutral with engine at full throttle. If the rear drive wheel turns, repeat steps 3, 4 and 5.SPERCO ROD END1/4 - 28 JAM NUTTHREADED RODTRANSMISSIONARMCENTERING CONTROLADJUSTMENT NUT1/4 - 28 JAM NUTP-5093 FIGURE 42AMERICAN-LINCOLN 1-497760

PARTS LIST LEGENDABBREVIATIONS - SCREWSADJADJ.SPBHMBHSCAPT.SLCAPT.WGFHMFIL.HMHHCHHMHIHDHSHCHSFHCKNHMHHCPHMRHDRHMRHWSHCSHTBSQTBTHMWELDWG= Adjusting Screw= Adjusting Plunger Screw= Binding Head Machine Screw= Button Head Socket Screw= Captivated Slotted Screw= Captivated Wing Screw= Flat Head Machine Screw= Filister Head Machine Screw= Hexagon Head Cap Screw= Hexagon Head Machine Screw= 1/2 High Head Screw= Hexagonal Socket Head Cap Screw= Hexagonal Socket Flat Head Cap Screw= Knurled Head Screw= Metric Hexagon Head Cap Screw= Pan Head Machine Screw= Round Head Drive Screw= Round Head Machine Screw= Round Head Wood Screw= Shiny Crown Cap Screw= Shoulder Thumb Screw= Square Head Screw= Thumb Screw= Truss Head Machine Screw= Weld Stud= Wing ScrewABBREVIATIONS - SETSCREWSHSSSH-KCP-CP-OP-FDP-HDP-FP-COP= Hexagonal Socket Setscrew= Slotted Setscrew= Square Head Setscrew= Knurled Cup Point Setscrew= Cup Point Setscrew= Oval Point Setscrew= Full Dog Point Setscrew= Half Dog Point Setscrew= Flat Point Setscrew= Cone Point SetscrewC-20041-50 AMERICAN-LINCOLN7760

GENERAL TROUBLESHOOTINGPROBLEM PROBABLE CAUSE REMEDYSweeping does notfunction1. Dump door closed2. Hopper is raised1. Open dump door2. Lower hopperPoor water pick up atsqueegeeWater spill from squeegeeLack or suction at rear3. Hopper switch out of adjustment1. Side or rear squeegee are worn or damaged2. Clogging in water pick up3. Air leaks in suction hose and connection4. Air leaks at recovery tank cover and/ormanifold gaskets5. Poor vacuum6. Drain hose or drain plug leakage or notclosed properly..1. Side squeegee blades, poor contact withfloor2. Squeegee blades worn or damages3. Too much solution being applied beforemaking turns4. Brushes rotating opposite direction1. Clogged suction hose or pick up tool2. Loose connections between suction hoseand squeegee or between hoses ormanifold inlet.3. Vacuum motor not operating4. Vacuum float cage clogged5. Vacuum float shut off3. Adjust hopper switch1. Examine squeegee rubber blade forcuts or worn spots.2. Repair or replace hose and connection3. Repair or replace gaskets4. Check vacuum motor5. Check seal on recovery tank6. Close, repair or replace drain plug inrecovery tank.1. Readjust blades for proper contact2. Replace or adjust3. Shut off solution flow 5' to 10'4. Check position of switches.1. Disconnect suction hose fromsqueegee; flush squeegee & hoses.2. Check all hose connections forlooseness or damage.3. Check hydraulic motor in recovery4. Clean perforated metal thoroughly5. Excessive solution in recovery draintank. Excessive foam build up,change cleaning chemical mixture.Use A-L approved materials.AMERICAN-LINCOLN 1-517760

GENERAL TROUBLESHOOTINGPROBLEM PROBABLE CAUSE REMEDYPoor scrubbingEngine runs, but machinewill not move on levelgroundMachine moves slowlyHydraulic pump makingexcessive noise1. Worn scrubbing brushes2. Incorrect method of operation3. Wrong cleaning agent or mixture4. Poor solution distribution1. Foot pedal and/or linkage jammed or notadjusted2. Front wheels jammed or brakes locked3. Hydraulic pump trouble4. Rear wheel hydraulic motor, broken shaftkey, broken shaft, ect.1. Low hydraulic oil level2. Brake dragging3. Hydraulic oil temp, too high4. Worn hydraulic pump or drive wheel motor1. Clogged inlet strainer or suction line2. Air bubbles in hydraulic fluid3. Hydraulic pump is worn or damaged1. Inspect brushes. If worn to ½”(1.3cm) or less, replace all 3 brushes2. Check scrubbing procedures, brushpressure, type of brush, solution flow,& cleaning chemical used. Forextreme conditions double scrubbingmay be necessary.3. Use A-L recommended materials4. Clean out distribution tube & meteringholes to brushes. Check feed hose& clean if necessary. Check valve &cable control system.1. Check pedal linkage2. Check wheels and brakes3. Check & repair pump, check tow valve.See CESSNA information.4. Check & repair. See Char-Lynninformation1. Add oil to reservoir2. Check brakes3. Check oil level, add SAE 5 (FORDType F) ATF, if required4. See hydraulic CESSNA1. Clean inlet strainer. Drain & flushreservoir, if oil is dirty. Refill with cleanSAE 5 (FORD Type F) ATF.2. Check for low hydraulic fluid level,leaking fittings or hoses3. See CESSNA Pump Section1-52 AMERICAN-LINCOLN7760

CHECK ENGINE LIGHT CODESCATEGORY DESCRIPTION CODE NUMBERMAP MAP high pressure 231MAP low voltage 232TIP TIP high voltage 1111TIP low voltage 1111FP FP high voltage 1111FP low voltage 1111ECT/CHT ECT/CHT high voltage 221ECT/CHT low voltage 222ECT higher than expected 1 223ECT higher than expected 2 224CHT higher than expected 1 223CHT higher than expected 2 224IAT IAT high voltage 211IAT low voltage 212IAT higher than expected 1 213IAT higher than expected 2 214BP BP high pressure 234BP low pressure 235Knock Knock sensor open 253Excessive knock signal 254Battery Voltage Voltage high 162Voltage low 1615V External 5VE high voltage 6325VE low voltage 631TPS TPS1 high voltage 531TPS1 low voltage 532TPS2 high voltage 533TPS2 low voltage 534TPS1 higher than TPS2 535TPS1 lower than TPS2 536Unable to reach higher TPS 537Unable to reach lower TPS 538FPP FPP1 high voltage 511FPP1 low voltage 512FPP2 high voltage 521FPP2 low voltage 522FPP1 higher than IVS limit 513FPP1 lower than IVS limit 514FPP2 higher than IVS limit 523FPP2 lower than IVS limit 524FPP1 higher than FPP2 515FPP1 lower than FPP2 516Governor Interlock IVS/Brake interlock failure 545AMERICAN-LINCOLN 1-537760

CHECK ENGINE LIGHT CODESCATEGORY DESCRIPTION DESCRIPTION CODE NUMBERAuxiliary Analog Inputs AUX analog PD1 high 163AUX analog PD1 low 164AUX analog PU1 high 541AUX analog PU1 low 542AUX analog PU2 high 543AUX analog PU2 low 544Engine Speed Max govern speed override 551Fuel rev limit 552Spark rev limit 553Oil Pressure Oil pressure low 215Adaptive Learn AL high gasoline bank1 141AL high gasoline bank2 151AL low gasoline bank1 142AL low gasoline bank2 152AL high LPG 143AL low LPG 144AL high NG 145AL low NG 146Closed Loop CL high gasoline bank1 121CL high gasoline bank2 131CL low gasoline bank1 122CL low gasoline bank2 132CL high LPG 111CL low LPG 124CL high NG 125CL low NG 126Catalyst Monitor Gasoline cat monitor 133LPG cat monitor 134NG cat monitor 135EGO Sensors EGO open/lazy bank1 112EGO open/lazy bank2/post-cat 113EGO open/lazy post-cat 114Injectors Injector Loop Open or Injector 1 311Low-Side Short to Ground Injector 2 313Injector 3 315Injector 4 321Injector Coil Shorted Injector 1 312Injector 2 314Injector 3 316Injector 4 3221-54 AMERICAN-LINCOLN7760

CHECK ENGINE LIGHT CODESCATEGORY DESCRIPTION DESCRIPTION CODE NUMBERSpark Coil Primary Primary Loop Open or Coil 1 411Low-Side Short to Ground Coil 2 413Coil 3 415Coil 4 421Primary Coil Shorted Coil 1 412Coil 2 414Coil 3 416Coil 4 422Fuel Pump Feedback F Pump Loop Open or 351High-Side Short to GroundF Pump High-Side 352Shorted to PowerMegaJector Diagnostics MegaJector delivery pressure 353higher than expectedMegaJector delivery pressure 354lower than expectedMegaJector comm lost 355MegaJector voltage supply high 361MegaJector voltage supply low 362MegaJector internal actuator 363fault detectionMegaJector internal circuitry 364fault detectionMegaJector internal comm 365fault detectionCrank/Cam Sensors Cam loss 244Cam sync noise 245Crank sync noise 242Never crank synced at start 243Internal Processor Diagnostics COP failure 611RTI 1 loss 614RTI 2 loss 655RTI 3 loss 656A/D loss 613Invalid interrupt 612Flash checksum invalid 615RAM failure 616RS-485 Network Rx Inactive 641Rx Noise 642Invalid Packet Format 643Shutdown Request 644AMERICAN-LINCOLN 1-557760

ORDERING PARTSParts may be ordered from American-Lincoln authorized distributors.Record the information from the American-Lincoln serial plate to avoiddelays in filling your order:MODEL NO.SERIAL NO.Manufactured ByAMERICAN LINCOLNTECHNOLOGYBOWLING GREEN, OHIO®1. Use the model number, catalog number, and serial number when ordering.2. Give the part number, description, and quantity of parts needed.3. Give shipping instructions for either freight, UPS, or parcel post.Parts and supplies listed in this manual can be ordered from the following address:American-LincolnAmerican-Lincolnauthorized distributor1100 Haskins RoadBowling Green, Ohio 43021-800-331-7692MACHINE CATALOG NUMBERS505-244 Gas Variable Dump (North America)505-244EXGas Variable Dump (Export)505-244CEGas Variable Dump (Export w/CE Kit)505-245 LP Variable Dump (North America)505-245EXLPVariable Dump (Export)505-245CE LPVariable Dump (Export w/ CE Kit)505-246 Diesel Variable Dump (North America & Export)505-246CE505-247 Diesel Variable Dump (Export w/ CE Kit)Gas Manual Dump (North America)505-247EX Gas Manual Dump (Export)505-247CE Gas Manual Dump (Export w/ CE Kit)505-248 LP Manual Dump (North America)505-248EX LP Manual Dump (Export)505-248CE LP Manual Dump (Export w/ CE Kit)505-249 Diesel Manual Dump (North America & Export)505-249CE Diesel Manual Dump (Export w/ CE Kit)1-56 AMERICAN-LINCOLN7760

TABLE OF CONTENTS - CHAPTER 2Main Broom........................................................................................................................................................................... 2-2Main Broom Lift Linkage ....................................................................................................................................................... 2-4Side Broom (Variable Dump) ................................................................................................................................................ 2-6Broom and Brush Chamber Door ......................................................................................................................................... 2-8Hopper System (Manual Dump) ........................................................................................................................................... 2-10Hopper and Flaps (Variable Dump) ...................................................................................................................................... 2-12Hopper Filter and Impeller .................................................................................................................................................... 2-14Hopper Control Valve & Hopper Dump Linkage (Variable Dump) ........................................................................................ 2-16Scrub Deck and Brushes ...................................................................................................................................................... 2-18Rear and Side Squeegees ................................................................................................................................................... 2-20Squeegee Lift ........................................................................................................................................................................ 2-22Swing Squeegee Support ..................................................................................................................................................... 2-24Solution Tank ........................................................................................................................................................................ 2-26Solution Feed Linkage .......................................................................................................................................................... 2-28Recovery Tank ...................................................................................................................................................................... 2-30Recovery Tank Lid ................................................................................................................................................................ 2-32Vacuum Motor & Float .......................................................................................................................................................... 2-34Front Wheel and Brake ......................................................................................................................................................... 2-36Rear Wheel ........................................................................................................................................................................... 2-38Brake Linkage ....................................................................................................................................................................... 2-40For/Rev Control – Ford ......................................................................................................................................................... 2-42For/Rev Control – Mitsubishi ................................................................................................................................................ 2-44Main Frame ........................................................................................................................................................................... 2-46Driver Compartment ............................................................................................................................................................. 2-48Hydraulic Hose (Variable Dump) .......................................................................................................................................... 2-50Hydraulic Hose (Manual Dump) ........................................................................................................................................... 2-52Suction & Return Hoses Variable Dump) ............................................................................................................................. 2-54Suction & Return Hoses (Manual Dump) ............................................................................................................................. 2-56Main Broom and Fittings ....................................................................................................................................................... 2-58Side Broom and Fittings ....................................................................................................................................................... 2-59Scrub Motors and Fittings ..................................................................................................................................................... 2-60Squeegee and Scrub Deck Cylinders and Fittings ............................................................................................................... 2-61Power Steering, Hopper Dump & Hopper Lift Cyl’s and Fittings .......................................................................................... 2-62Rear Wheel Motors and Fittings ........................................................................................................................................... 2-64Hydraulic Reservoir, Filter, and Fittings ................................................................................................................................ 2-66Drive Pump and Fittings ....................................................................................................................................................... 2-68Vacuum Motor and Fittings ................................................................................................................................................... 2-69Dust Control Impeller and Fittings ........................................................................................................................................ 2-70Power Steering Unit and Fittings .......................................................................................................................................... 2-71Main Control Valve and Fittings ............................................................................................................................................ 2-72Cylinder Control Valve and Fittings ....................................................................................................................................... 2-73Return Manifold and Fittings ................................................................................................................................................. 2-74Oil Cooler & Fittings .............................................................................................................................................................. 2-75Auxiliary Pump and Fittings - Ford ....................................................................................................................................... 2-76Auxiliary Pump and Fittings – Mitsubishi .............................................................................................................................. 2-77Battery ............................................................................................................................................................................... 2-78Engine Cover ........................................................................................................................................................................ 2-80Fuel Tank (Gas & Diesel) ...................................................................................................................................................... 2-82Ford 425EFI Gas Engine ...................................................................................................................................................... 2-84Ford 425EFI LP Engine ........................................................................................................................................................ 2-90Mitsubishi S4Q2 Diesel Engine ............................................................................................................................................ 2-102Radiator Group ..................................................................................................................................................................... 2-110Certified Export (CE) Kit ....................................................................................................................................................... 2-112Steering and Instrument Panel ............................................................................................................................................. 2-114Decals ............................................................................................................................................................................... 2-116Instrument Panel ................................................................................................................................................................... 2-118Machine Harness Wiring Diagram ........................................................................................................................................ 2-120Electrical Schematic ............................................................................................................................................................. 2-122Connection Diagram ............................................................................................................................................................. 2-123Ford 425EFI Frame Side Connection Diagram .................................................................................................................... 2-124Mitsubishi S4Q2 Frame Side Connection Diagram .............................................................................................................. 2-125Hydraulics Schematic (Variable Dump) ................................................................................................................................ 2-126Hydraulics Schematic (Manual Dump) ................................................................................................................................. 2-127American-Lincoln 2-17760

MAIN BROOM - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 0882-040 Hydraulic Motor, Broom Drive 12 2-00-03838 Key, .250 x 1.000 (#15) W 13 8-16-00041 Drive Broom Arm 14 2-00-02310 Lock Washer, Helical Spring 3/8 Med 65 2-00-00232 Screw, 3/8 - 14 x .750 HHC 66 8-33-09046-1 Broom Driver Hub 17 8-58-05160 Hub Locking Plate 18 2-00-00518 Lock Washer, Helical Spring 1/4 Med 79 2-00-03039 Screw, 1/4 - 20 x .625 HSHC 310 See Broom Options11 2-00-00522 Lock Washer, Helical Spring 3/4 Light 11213 2-00-04889 Bearing 114 2-00-04886 Screw, 3/8 - 16 x .500 HSHC 215 8-33-09090 Idler 116 8-16-00039 Idler Arm 117 7-15-01035 Pivot Collar Weldment 218 2-00-04943 Spring Pin, 3/8 x 1 1/2 219 2-00-00221 Screw, 1/4 - 20 x .750 HHC 820 7-16-07274 Cover Plate Gasket 221 7-29-00148 Broom Arm Gasket 322 7-70-05137 Shaft 123 7-55-08119 Lift Pin, with Cotter Pin 224 7-03-04151 RH Arm Assembly 17-03-04152 LH Arm Assembly 125 7-13-07103 End Clamp 226 2-00-02587 Screw, 1/4 - 20 x 1.250 HHC 427 2-00-00586 Nut, Hex Jam 5/16 - 18 .500 x .187 428 2-00-00530 Lock Washer, Helical Spring 5/16 Med 429 2-00-05103 Flat Washer SS, .750 x .343 x .050 430 2-00-03997 Flange Bearing, 3.750 x 1.000 231 2-00-00196 Carriage Bolt, 5/16 - 18 x 1.000 432 7-70-05138 Broom Chamber Shaft Weldment 133 8-55-08098 Dowel Pin 434 2-00-04887 Screw, 3/4 - 10 x 1.250 HHC 135 2-00-04890 Retaining Ring, 3.341 Int. 136 2-00-02558 Lubrication Fitting, 45° 1/8 NPT 237 8-75-01157 Flat Washer, 3/4 138 2-00-00432 Screw, 1/4-20 x .50 4P-4738/95102-2 American-Lincoln7760

MAIN BROOM - EXPLODED VIEW12 3 45 6 7 8 9105 417 183411373513 14 15 162138222336262425212019SEELIFTBROOMLINKAGE23827283029311817333245P4738/9606American-Lincoln 2-37760

MAIN BROOM LIFT LINKAGE - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-39-00003 Knob 22 7-41-05082 Main Broom Lever 13 7-66-00142 Adjusting Rod 14 2-00-00207 Screw, 5/16-18 x 1-1/4 15 7-09-01057 Spacer 26 2-00-01255 Screw, 5/16 - 18 x .875 HHC 27 7-17-00012 Crank 18 2-00-02369 Nut, Hex Jam 3/8 - 16 x .562 x .218 29 7-08-00493 Broom Lever Bracket 110 2-00-00530 Lock Washer, Helical Spring 5/16 Med 211 2-00-00208 Screw, 5/16 - 18 x .750 HHC 112 2-00-00585 Nut, Hex 5/16 - 18 x .500 x .265 113 7-89-06700 Hopper Valve Bracket 114 2-00-02589 Screw, 1/4 - 20 x 2.0 HHC 215 2-00-00518 Lock Washer, Helical Spring 1/4 Med 216 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 217 7-42-05086 Broom Lift Link 118 2-00-03589 Setscrew Collar, 1.000 x .5000 x .437 119 7-15-01022 Setscrew Collar, .750 x .378 x .375 120 2-00-04936 Nut, Hex Fiber Insert 1/2 - 13 121 2-00-00566 Lubrication Fitting, Straight 1/8 NPT 122 7-21-04030 Edging 123 2-00-05059 Screw, 1/2-13 x 3.750 HHC 224 7-42-05084 Link 225 2-00-00605 Nut, #10-24 Fiber Lock 226 2-00-00056 Screw, #10-24 x 3/4 RHM 227 8-88-00053 Control Valve 1P-5151/96082-4 American-Lincoln7760

MAIN BROOM LIFT LINKAGE - EXPLODED VIEW1242258 9 5 10 11 19 10 12 13271615261423682234514207182117P-5151/9606American-Lincoln 2-57760

SIDE BROOM (VARIABLE DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-08-03107 Side Broom 12 0885-061 Hydraulic Broom Drive Motor 13 2-00-00585 Nut, Hex 5/16 - 18 x .500 x .265 34 2-00-00530 Lock Washer, Helical Spring 5/16 Med 35 2-00-00409 Washer, Flat 5/16 26 2-00-01676 Flat Washer, 1.063 x .266 x .063 17 2-00-00518 Lock Washer, Helical Spring 1/4 Med 58 2-00-05976 Screw, 1/4 - 28 x 1.50 HHC 19 2-00-00221 Screw, 1/4-20 x .75 210 2-00-00232 Screw, 3/8 - 16 x .750 HHC 111 8-15-01003 Setscrew Collar, 1.250 x .750 x .562 112 2-00-04210 Clamp 213 2-00-00049 Screw, #10 - 24 x .500 RHM 314 2-00-00605 Nut, Hex MS #10-24 x .375 x .12 315 2-00-00512 Lock Washer, #10 Int. 316 7-25-06038 Flange 117 2-00-00218 Screw, 5/16 - 18 x 2.000 HHC 3NS 0880-293 Seal Kit- 0885-061 (Up to Serial No. 750056) 1NS 0780-144 Seal Kit- 0885-061 (Serial No. 750056 & Above) 118 7-08-00841 Bracket, Side Broom 119 7-79-00092 Strap 120 7-03-04153 Side Broom Arm Weldment 121 7-09-01134 Bushing 122 7-10-00029 Cable 123 8-21-04030 Edging 124 2-00-02310 Lock Washer, Helical Spring 3/8 Med 125 2-00-03702 Washer, Flat .625 x .281 x .063 126 2-00-00641 Nut, 1/4-20 Hex Fiber Lock 127 2-00-02303 Lock Washer, 5/16 Int. Tooth 228 2-00-00585 Nut, Hex 5/16-18 229 2-00-03569 Carriage Bolt, 5/16-18 230 2-00-05350 Screw, 1/4-28 x .63 331 2-00-03979 Washer, 1.00 x .391 x .06 132 2-00-03808 Washer, 1.50 x .750 x .06 133 2-00-00594 Nut, Hex MS 1/4-20 x .125 134 2-00-04603 Clamp 135 2-00-04378 Clamp 1P-5149/1-042-6 American-Lincoln7760

934SIDE BROOM (VARIABLE DUMP) - EXPLODED VIEW3371514221335131523141211102432312625192021730217291816928 271P5149/9609678American-Lincoln 2-7776034 5

BROOM & BRUSH CHAMBER DOOR - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY12 7-29-00226 Main Broom Door Gasket 234 2-00-00407 Flat Washer, .687 x .343 x .062 85 2-00-00518 Lock Washer, Helical Spring 1/4 Med 336 2-00-04880 Screw, 1/4 - 20 x .750 BHS 87 8-41-00032 Flush Mount Latch 28 7-19-08052 Left Hand Broom Chamber Door 19 2-00-00529 Lock Washer, Helical Spring #8 Med 810 2-00-01081 Screw, #8 - 32 x .500 T/C RH 81112 7-79-00056 Door Flap Strap 213 7-25-08033 Broom Chamber Door Flap 214 2-00-00221 Screw, 1/4 - 20 x .750 HHC 25151617 7-25-08036 Front Broom Chamber Flap 118 7-29-00147 Gasket 119 7-79-00055 Broom Chamber Strap 420 7-25-08034 Broom Chamber Flap 221 7-79-00054 Broom Chamber Flap Strap 122 7-25-08032 Broom Chamber Flap 123 7-08-00487 Flap Bracket Weldment 12425 7-19-08053 Right Hand Broom Chamber Door 126 2-00-04190 Carriage Bolt, 1/4 - 20 x .63 827 2-00-01490 Screw, 1/4 - 20 x .875 HHC 1328 2-00-00589 Nut, 1/4-20 Hex 829 2-00-00501 Washer, 1/4 Lock 8P-4603/96062-8 American-Lincoln7760

BROOM & BRUSH CHAMBER DOOR - EXPLODED VIEW10 9 8 7 6 5 4 214519201951418252752829121326P4603/960617232221514American-Lincoln 2-97760

HOPPER SYSTEM (MANUAL DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-79-00091 Hopper Flap Strap 42 2-00-00205 Screw, 1/4-20 x 1.000 HHC 153 7-13-07169 Hopper Flap Clamp 44 7-25-08050 Hopper Flap 45 7-30-08013 Cable Guide 26 7-10-00027 Hopper Lift Cable 17 7-08-00860 Pulley Mounting Bracket 18 7-13-07170 Cable Retainer Clip 49 7-60-00160 Cable Pulley 410 7-41-00029 Hopper Latch 111 7-27-07174 Main Frame 112 8-76-00045 Spring 113 7-25-08051 Baffle Flap 114 7-13-07131 Baffle Clamp 115 7-08-00861 Hopper Pivot Plate 216 7-32-06019 Hopper 117 2-00-03589 Collar 118 7-31-06073 Hopper Dump Handle 119 7-16-07340 Right Hand Cover 120 7-16-07341 Center Cover 121 7-16-07339 Left Hand Cover 122 2-00-00518 Lock Washer, 1/4 Helical Spring 1723 2-00-00594 Nut, Hex 1/4-20 1924 2-00-01255 Screw, 5/16-18 x .875 HHC 1125 2-00-00530 Lock Washer, 5/16 Helical Spring 1126 2-00-00209 Screw, 3/8-16 x 1.250 HHC 827 2-00-00402 Flat Washer, 3/8 Bs 1028 2-00-02310 Lock Washer, 3/8 Helical Spring 829 2-00-02360 Nut, Hex 3/8-16 1430 2-00-02711 Screw, 3/8-16 x2.750 HHM 131 2-00-00240 Screw, 1/2-13 x 1.250 HHC 432 2-00-02312 Lock Washer, 1/2 Helical Spring 433 7-41-00031 Handle Latch 134 2-00-00235 Screw, 3/8-16 x 1.750 HHC 135 2-00-00409 Flat Washer, 5/16 BS 836 2-00-00585 Nut, Hex 5/16-18 937 7-25-08052 Lower Baffle Flap 138 7-13-07136 Lower Baffle Clamp 139 2-00-00198 Carriage Bolt, 1/4-20 x 2.000 140 2-00-00641 Nut, Fiber Lock 1/4-20 141 2-00-00405 Flat Washer 1/2 B.S 4C-0355/96062-10 American-Lincoln7760

HOPPER SYSTEM (MANUAL DUMP) - EXPLODED VIEW26282435253616192029 28 2731 32 152223230 2928291412133837OPEN341736 2941 18282523 392923332222 406 28 292423102225 2724 26233 4 5 6 2 7 8 9 26 201 2CLOSED821116 15 12 11 137C-0355/9606American-Lincoln 2-117760

HOPPER SYSTEM (VARIABLE DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-32-06017 Hopper 12 7-08-00840 Bracket, Impellor Mounting and Guard 13 0882-041 Vac Fan Motor 14 8-23-00012 Impellor 15 7-17-05013 Cylinder Ref.6 7-55-08117 Pin 37 8-15-01003 Collar 68 7-17-05020 Cylinder Ref.9 8-14-01010 Rod End 110 7-55-08127 Rod 111 7-29-00233 Gasket, Dump Door 213 7-13-07162 Clamp, Hopper 114 7-25-08068 Flap, Hopper 115 7-19-08054 Dump Door, Hopper 116 2-00-00641 Nut, 1/4-20 Insert Fiber 3117 7-55-08121 Pin 118 7-68-05019 Seal, Outer Door 119 7-79-00090 Strap, Inner Seal 120 7-79-00089 Strap, Outer Seal 121 7-68-05014 Seal, Door Side 222 7-13-07160 Clamp, Door Side Seal 224 7-68-05018 Seal, Dump Door 141 2-00-00776 Cotter Pin 242 2-00-02558 Lube Fitting 143 2-00-04378 Clamp 144 2-00-00566 Lube Fitting 450 8-82-00058 Switch 254 2-00-00594 Nut, Hex 1/4-20 x .437 x .218 655 7-21-04041 Edging, Hopper 156 2-00-02227 Key 157 2-00-04603 Clamp 258 7-08-00869 Bracket, Safety Arm Stop 160 2-00-03702 Washer, .625 x .281 x .063 1761 2-00-00221 Screw, 1/4-20 x .750 HHC 3365 2-00-00518 Lock Washer, Helical Spring 1666 2-00-03575 Carriage Bolt, 1/4-20 x .750 1270 2-00-00585 Hex Nut, .13-18 Finished 471 2-00-00530 Lock Washer, 5/16 Med. 872 2-00-00409 Flat Washer, .688 x .344 x .063 873 2-00-00208 Screw, .313-18 x .75 HHC 474 2-00-02655 Screw, .313-18 x 4.50 HHC 475 2-00-00402 Flat Washer, .750 x .391 x .093 276 2-00-03412 Lock Nut, .38-24 (1-piece) 177 2-00-00484 Spacer, .625 x .375 x .047 178 2-00-01372 Nut, 8-32 Fiber Insert 479 2-00-00498 Lock Washer 580 2-00-00090 Screw, 8-32 x 1.50 PH RHM 481 2-00-00432 Flat Washer, 1.125 x .766 x .063 282 2-00-03170 Spacer, .75-1.50 x .125 283 2-00-04841 Nut, .75-16 Slotted Hex 284 2-00-05277 Screw, .50-13 x .75 HSHC 285 2-00-00460 Flat Washer, .438 x .192 x .031 4P5146ecp/1-042-12 American-Lincoln7760

HOPPER SYSTEM (VARIABLE DUMP) - EXPLODED VIEW61606554757672 747154 65 607316728182837170776184616560616079806665795485167816POSITION CARRIAGEBOLT AS SHOWN(2 PLACES)617880P5146ecp/1-048579American-Lincoln 2-137760

HOPPER SYSTEM (FILTER & IMPELLER) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY12 2-00-00491 Grommet 116 2-00-00641 Nut, 1/4-20 Insert Fiber 623 7-18-03031 Air Deflector, Top 125 7-13-07159 Rear Clamp 226 7-19-08055 Filter Access Door 127 7-08-00843 Bracket, Door Filter Access (RH) 128 7-08-00844 Bracket, Door Filter Access (LH) 129 7-24-04046 Filter Panel 17-24-04046-2 POLY Filter Panel Option30 7-13-07158 Filter Clamp, Weldment 131 7-39-00027 Knob Assembly 232 7-03-04150 Shaker Arm 133 7-58-05279 Plate, Shaker Motor 134* 0860-623 Motor, Shaker 135* 8-16-07406 Cover, Filter Shaker Motor 136* 8-89-04019 Weight, Filter Shaker 137 8-10-00036 Cable 138 8-41-00040 Latch 239 7-29-00234 Gasket, Hopper Access Door 140 7-29-00235 Gasket, Hopper Access Door 145 7-55-08146 Pin, Shaker Pivot 146 2-00-03589 Collar 447 7-08-00643 Bracket 148 7-08-07053 Bumper 149 7-89-07423 Stud 251 25201A Knob 252 2-00-04345 Tye-Rap 153 8-09-01082 Bushing 254 2-00-00594 Nut, Hex 1/4-20 x .437 x .218 259 2-00-02587 Screw, 1/4-20 x 1.250 HHC 260 2-00-03702 Washer, .625 x .281 x .063 1261 2-00-00221 Screw, 1/4-20 x .750 HHC 862 2-00-00240 Screw, 1/2-13 x 1.250 HHC 463 2-00-02312 Lock Washer, 1/2 HS Med. 664 2-00-04159 Washer, 9/16 x 1 3/8 x .109 465 2-00-00518 Lock Washer, Helical Spring 866 2-00-03575 Carriage Bolt, 1/4-20 x .750 1267 2-00-02676 Screw, 1/2-13 x .75 268 2-00-00263 Setscrew, 1/4-20 x .250 HSKCP 169 2-00-00643 Nut, 3/8-16 Stop 2*Contained in Kit 0880-705P5148A-ecp/1-042-14 American-Lincoln7760

HOPPER SYSTEM (FILTER & IMPELLER) - EXPLODED VIEW16545969166068606561666660656160166367626364165459P5148a-ecp/1-04American-Lincoln 2-157760

HOPPER SYSTEM (VALVE, DUMP LINKAGE) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-88-00053 Hopper Control Valve 12 2-00-04917 ORFS Boss Reducer, 9/16-18 to 7/16-20 23 2-00-04895 ORFS Connector, 7/16-20 to 9/16-18 24 2-00-04926 ORFS 90° Elbow, 9/16-18 25 2-00-04970 Fitting - Straight 26 2-00-00056 Screw, #10 - 24 x .750 RHM 27 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 28 7-41-05084 Lever 29 7-42-05089 Link 210 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 411 2-00-00518 Lock Washer, Helical Spring 1/4 Med 412 2-00-00205 Screw, 1/4-20 x 1.000 HHM 413 2-00-03702 Flat Washer, .625 x .281 x .062 414 7-31-06059 Handle 215 2-00-00498 Lock Washer, .250 Ext 216 7-33-02195 Hose Ref.17 8-33-02328 Hose Ref.18 7-33-02225 Hose Ref.19 8-33-02178 Hose Ref.20 8-33-02201 Hose Ref.21 7-33-02187 Hose Ref.P-4877b/06032-16 American-Lincoln7760

13 1112HOPPER SYSTEM (VALVE, DUMP LINKAGE) - EXPLODED VIEW141013158 10 11 12697CDAB2341617191SEE MAIN BROOM LIFTLINKAGE FOR MOUNTINGBRACKET AND FASTENERS185TO UPPER PORT OFHOPPER DUMP DOORCYLINDER - 8-33-02328TO REAR PORT OFHOPPER LIFT CYLINDER - 8-33-02178TO LOWER PORT OFDUMP DOOR CYLINDER - 7-33-02194TO FRONT PORT OFHOPPER LIFT CYLINDER - 7-33-022252120FROM "T" PORT OFMAIN CONTROL VALVE - 8-33-02201TO RETURN MANIFOLD - 7-33-02187American-Lincoln 2-177760

SCRUB DECK & BRUSHES - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-27-07172 53” Scrub Deck 12* 0702-069 Drive Brush Assembly 33 0782-111 Hyd. Scrub Motor 34 2-00-03407 Clamp-Hose 65 2-00-03725 Fitting, Tee 16 7-25-02038 90° Nipple 17 8-13-07003 “U” Bolt - ¼” 18 2-00-04487 Fitting, Tee 19 2-00-05342 Nipple 310 7-33-02323 Hose-Water Feed - 15” 111 7-33-02322 Hose-Water Feed - 12” 112 7-33-02324 Hose-Water Feed - 12.5” 213 2-00-00596 Nut, ½ - 13 614 2-00-02312 Washer, .50 Split 615 2-00-00405 Flat Washer, 1.063 x .531 x .094-s 616 2-00-05244 Carriage Bolt, Zinc 617 2-00-00530 Lockwasher, 5/16 318 2-00-05087 Screw, 5/16 with Nylok 319 2-00-00594 Nut, Finish Hex, .25-20 220 2-00-00518 Washer, Helical Spring 2P-5158/9608*0702-069 SERVICE PARTS1821011KEY NO. PART NUMBER DESCRIPTION QTY1 7-33-09013 Drive Hub 12 7-58-05181 Hub Plate 13 7-03-04070 Brush Drive Arm 14 7-09-01062 Spacer 25 7-76-00089 Latch Spring 26 7-41-00007 Brush Latch 27 2-00-04663 Roll Pin 28 2-00-00530 5/16 Lock Washer 29 2-00-00224 Screw 210 2-00-02587 Screw 211 2-00-00518 1/4 Lock Washer 212 2-00-04045 Washer 2931245672-18 American-Lincoln7760

SCRUB DECK & BRUSHES - EXPLODED VIEW1314113TO SOLUTIONCONTROL VALVE87549104112162019APPLY NEVER SEIZE21718P5158/9608American-Lincoln 2-197760

REAR & SIDE SQUEEGEE - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-86-08032 Squeegee - Weldment 12 7-20-06009 Duct - Squeegee Inlet 13 7-75-01164 Spacer - Bushing 24 7-75-01191 Spacer - Squeegee 25 7-77-00107 Squeegee - Rubber, Inlet 16 7-77-00105 Squeegee - Rubber, Outlet 17 7-79-00085 Strap - Squeegee Clamp 18 7-13-07157 Clamp - End Squeegee 29 7-13-07156 Clamp - Nut 210 7-39-00026 Knob - Squeegee 411 7-89-08073 Wheel - Caster 212 2-14-00184 Wheel 213 2-00-04962 O-Ring 214 2-00-00216 Screw, 3/8-16 x 2.000 HHC 215 2-00-00402 Flat Washer, .750 x .390 x .094 416 2-00-00615 Nut, Finish Hex 217 2-00-02360 Nut, 3/8 -16 Hex 218 2-00-05302 Screw, 3/8-16 x 1.25 HHC SS 219 2-00-05344 Bolt, Hex Tap 5/16-18 x 1.75 SS 220 2-00-05343 Bolt, Carriage, .38-16 x 3.50 221 7-86-08034 Weldment - RH Bracket 122 7-77-00108 Squeegee - Rubber, Side 123 7-79-00086 Strap 124 7-55-08145 Pin - Lift 125 2-00-05320 Hair Pin 126 7-55-08121 Pin - Lock Up 128 2-00-05361 Washer, .563 x .281 x .063 SS 1427 2-00-04690 Screw, 1/4-20 x 1.00 HHC SS #304 1429 2-00-02312 Lock Washer, 1/2 HS Med. 230 2-00-04687 Lock Washer, Helical Spring 1/4 Med. 1431 2-00-04688 Nut, 1/4-20 Hex 1432 2-00-00598 Nut, .50-13 Hex 233 7-86-08033 Weldment - LH Bracket 1P-5160/04032-20 American-Lincoln7760

REAR & SIDE SQUEEGEE - EXPLODED VIEW2425323130332922232824273132252622293021232827P5160/0403261141512161054171363112018219897American-Lincoln 2-217760

SQUEEGEE LIFT - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY12 7-75-01166 Spacer 13 7-17-05019 Lift Cylinder Ref.4 2-00-04892 Fitting, 90° 25 2-00-05320 Hair Pin 1- 6 7-55-08147 Pin Assembly 17 7-17-00013 Squeegee Lift Arm 18 2-00-04886 Set Screw, 3/8-16 x .500 29 7-13-05074 Chain - Squeegee Lift 11011 7-08-00845 Bracket 112 7-32-00022 Hinge Ref.13 2-95-04182 Nut, Fiber 1014 7-08-00928 Bracket - Squeegee Lift 115 7-87-02185 Tube - Squeegee Lift 216 2-00-00644 Nut - 5/16-18, Insert Fiber 217 2-00-02708 Screw, 5/16-18 x 1.000 HHM 218 2-00-05354 Screw, Hex Head Cap 119 2-00-00410 Flat Washer, .875 x .375 x .060 1220 2-00-00209 Screw, 3/8-16 x 1.250 HHC 721 2-00-00522 Lock Washer ¾ Helical Spring 122 2-00-03293 Nut, Hex Finish, .75-10 123 2-00-05356 Screw - HHC .313-18 x 1.25 Grade 8 224 2-00-05103 Flat Washer .750 x .343 x .50 8P-5154/99072-22 American-Lincoln7760

SQUEEGEE LIFT - EXPLODED VIEW12 19 201813 2 3 21 22817141546513112072524 23169P5154/990724 23American-Lincoln 2-237760

SWING SQUEEGEE SUPPORT - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-86-08039 Weldment - Squeegee Support 12 7-55-08144 Weldment - Pin Assembly 23 7-08-00839 Bracket - Angle 24 7-03-04149 Arm - Squeegee 45 7-81-00185 Support - Squeegee 26 7-70-05174 Shaft 27 8-15-01002 Locking Collar 68 7-08-00838 Weldment - Bracket RH 19 7-08-00837 Weldment - Bracket LH 110 7-76-00114 Spring 211 7-89-08073 Wheel - Caster 112 7-33-02380* Hose - Vacuum - 78.50” 113 7-13-07104* Clamp - Hose 414 7-76-00050-1 Spring - Extension 115 2-00-04937 Hose Tie w/Eyelet 216 2-95-04182 Nut 1217 7-09-01057 Bushing 818 7-33-02381* Hose Vacuum - 23.50” 119 7-08-00916* Bracket, Squeegee Lift Ref.*Part of Kit 0780-467P-5159/99072-24 American-Lincoln7760

SWING SQUEEGEE SUPPORT - EXPLODED VIEW13 14 15 12REF MAIN FRAMEH50 8APPLY LOCTITE TOSETSCREWS, TTP9APPLY NEVER SEIZE166H237135H493H2371913H457H46H26018H3810H4641721P5159/9907161113American-Lincoln 2-257760

SOLUTION TANK - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1~ 7-83-04168 Solution Tank, Stainless Steel (Standard) 17-83-04167 Solution Tank, Mild Steel (Option)2 7-25-02046 Fitting, Drain 13 7-29-00100 Gasket, Tank Drain 14 2-00-04693 Screw, 5/16-18 x .875 SS 45 2-00-04691 Lock Washer, Helical Spring 5/16 Med SS 46 2-00-04692 Nut, Hex 5/16 - 18 x .50 x .265 SS 47 7-75-01088 Spacer 48 2-00-01254 Screw, 1/2 - 13 x 1.50 HHC 49 2-00-02371 Nut, 1/2-13 Hex Jam 410 2-00-02312 Lock Washer, Helical Spring 1/2 Med 411 2-00-00405 Flat Washer, 1.062 x .531 x .093 412 7-25-02095 Drain Plug Assembly 113 7-82-00017 Switch, Float 114 7-24-04022 Strainer, Pump Inlet 115 2-00-05132 Fitting, 3/4 NPT, 3/4 Barb 90° 116 2-00-02220 Hose Clamp, .812 - 1.500 217 7-33-02178 Hose 118 7-29-00176 Gasket, Solution Tank 119 7-32-03020 Holder, Hose 120 2-00-06529 Elbow, 90° 1/4 NPT 121 2-00-05724 Plug, 3/4 NPT Nylon 122 7-33-02335 Drain Hose, 44" 123 2-00-02216 Clamp, Hose 124 2-00-00234 Screw, 3/8-16 x 1.50 HHC 125 2-00-05686 Fitting, 3/4 NPT x 2” Nylon Nipple 126 2-00-04590 Washer, SS Sealing 427 2-00-06528 Reducer, 1/4 NPT - 1/8 NPT Brass 128 2-00-04687 Lock Washer, 1/4 SS 429 2-00-04688 Nut, 1/4-20 SS Hex 430 2-00-04685 Screw, 1/4 - 20 x .500 HHC SS 431 2-00-05940 Plug, 1/4 NPT Nylon 232 2-00-03979 Flat Washer, 3/8 333 2-00-02360 Nut, 3/8-16 Hex 134 2-00-04182 Nut, 3/8-16 Fiber Lock 135* 7-16-07275 Cover, Solution Tank 1P4735b/11-04*Solution Tank Cover Hinge Assembly only: 7-89-06693~If you are ordering a replacement tank, you should also order:1 of 8-18-00541 (7760 decal-provides 2)1 of 8-18-00525 (American-Lincoln logo) or 1 of 8-18-00549 (A-L Tech for Export)2-26 American-Lincoln7760

SOLUTION TANK - EXPLODED VIEWSEE RECOVERY TANK LIDFOR HINGE ASSEMBLY34323518213133321424191124312027292830262515161713223232TO SOLUTIONBRACKET5679P4735b/11-0411108American-Lincoln 2-277760

SOLUTION FEED LINKAGE - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-00585 Nut, Hex 5/16 - 18 x .500 x .265 32 2-00-00530 Lock Washer, Helical Spring 5/16 Med 33 7-41-05086 Solution Control Lever 14 7-09-01057 Bushing 35 2-00-00207 Screw, 5/16 - 18 x 1.250 HHC 26 7-42-05090 Solution Control Link 17 2-00-03407 Hose Clamp 18 7-25-02052 Hose Fitting, 3/4 Barbed, 14 NPT Nylon 19 2-00-03586 Pipe Nipple, 3/4 NPT x 2.00 short 210 2-00-03702 Flat Washer, .625 x .281 x .062 211 2-00-00518 Lock Washer, Helical Spring 1/4 Med 212 2-00-00221 Screw, 1/4 - 20 x .750 HHC 213 2-00-05132 Fitting, 3/4 NPT, 3/4 Barbed, 90°, Nylon 114 7-08-00437 Bracket, Solution Pipe 115 7-88-00027 Ball Valve 116 2-00-03382 Spring Washer, .875 x .500 x .015 117 2-00-00409 Flat Washer, .687 x .343 x .0623 218 7-41-05085 Solution Valve Lever 119 2-00-00600 Nut, Hex Hvy. 3/8 - 16 x .687 x .359 220 2-00-00211 Screw, 5/16 - 18 x 1.750 HHC 121 8-39-00002 Knob 122 2-00-05724 Plug, Pipe, 3/4 NPT, Nylon 123 2-00-05131 Nipple, Closed 3/4 NPT x 1.38 1P-4750/2-042-28 American-Lincoln7760

SOLUTION FEED LINKAGE - EXPLODED VIEW2116CONTROLPANEL12420543211961718421TO SCRUB BRUSHES(7-33-02322 HOSE REF.)5171514891323221011128P-4750/0703TO SOLUTION TANK(7-33-02178 HOSE REF.)American-Lincoln 2-2977607

RECOVERY TANK - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1* 7-83-04218 Recovery Tank - Stainless Steel (Standard) 17-83-04224 Recovery Tank - Mild Steel (Option)2 7-56-05023 Fitting Weldment 13 7-81-00126 Support 14 7-71-00009 Shim 45 7-08-00486 Bracket Weldment 16 7-29-00146 Gasket 17 7-25-02095 Drain Plug Assembly 18 2-00-00209 Screw, 3/8 - 16 x 1.250 HHC 49 2-00-02360 Nut, Hex, 3/8 - 16 x .562 x .328 110 2-00-04801 Washer, Flat, 1.000 x .390 x .062 711 2-00-02310 Washer, Lock, Helical Spring 3/8 Med 512 2-00-03569 Bolt, Carraige, 5/16 - 18 x .75 213 2-00-00183 Screw, PH THM 1/4-20 x .75 114 2-00-00409 Washer, 5/16 Flat SS 415 2-00-00530 Washer, Lock, Helical Spring 5/16 Med 416 7-78-05009 Stop 217 8-80-05014 Stud, 1/2-13 UNF-2A x 2.50 218 2-00-02371 Nut, Hex Jam, 1/2 - 13 x .750 x .312 219 2-00-00206 Screw, .313-18 x 1.00 120 7-80-05067 Stud, Gas Spring 221 7-13-07102 Safety Clip, Gas Spring 222 7-76-00103 Gas Spring, Recovery Tank Tilt 123 2-00-00518 Washer, 1/4 Med. Lock 124 7-82-00021 Switch, Float 125 8-09-01083 Connector, Float Switch 126 2-00-00644 Nut, Insert Fiber, .313-18 627 2-00-04685 Screw 1/4-20 x .75 HHC S.S. 928 2-00-04590 Washer, Sealing 1/4 1229 2-00-04687 Washer, 1/4 Lock Split S.S. 1330 2-00-04688 Nut, 1/4-20 Hex S.S. 1331 7-13-05058 Chain 132 2-00-00207 Screw, 5/16-18 X 1.250 HHC 233 7-34-09018 Sleeve 134 7-75-01130 Spacer, .500 X .370 X .375 135 2-00-04602 Clamp, Float Switch 336 2-00-04689 Washer, 1/4 Flat S.S. 137 2-00-02216 Clamp 138 7-33-02336 Hose, 50.00 139 7-32-03020 Holder, Hose 140 8-08-07038 Hose 141 2-00-04690 Screw, 1/4 - 20 X 1.000 HHC 342 2-00-05028 Washer, Rubber 643 2-00-05236 Washer, Flat, 2.000 X .28 X .08 SS 644 8-43-00002 Loom, Wire 145 2-00-00234 Screw, HHC 3/8 - 16 X 1.500 146 2-00-00410 Washer, Flat, 3/8 347 2-00-02360 Nut, Hex, 3/8 - 16 148 2-00-00432 Washer, Flat, 1.125 x .766 x .063 249 2-00-00594 Nut, Hex, STD FIN 1/4-20 150 2-00-00643 Nut, Fiber, 3/8 - 16 1*If you are ordering a replacement tank, you should also order: 1 of 8-18-00541 (7760 decal-provides 2)1 of 8-18-00525 (American-Lincoln logo)or 1 of 8-18-00549 (A-L Tech for Export)P-4734/03032-30 American-Lincoln7760

RECOVERY TANK - EXPLODED VIEW2835 27442529243035362940727130482232142119331315201617184813 15 14122614234913623738DRAINAGE HOSE39345046474645101131822634NOTE: OPEN LINK TOACCOMMODATESPACER201513 111081110459P-4734/03038American-Lincoln 2-317760

RECOVERY TANK LID - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07380 Recovery Tank Lower Cover 12 7-16-07295 Recovery Tank Upper Cover 13 7-16-07275 Solution Tank Cover 14 2-00-03702 Flat Washer, 1/4 25 3-73-00076 Edging 2.33’6 2-00-01255 Screw, 5-16-18 x .88 HHC 27 2-00-01803 Flat Washer, 5/16 68 2-00-00644 Nut, Hex Fiber Insert 5/16-18 19 7-79-00057 Strap 210 7-08-00490 Bracket 111 7-34-09020 Lower Cover Insulation 112 7-34-09019 Lower Cover Insulation 113 7-34-09021 Lower Cover Insulation 114 7-29-00229 Gasket, Center Section 115 7-66-00145 Cover Support Rod 116 7-29-00228 Gasket, Perimeter 117 7-76-00104 Gas Spring 218 7-80-05067 Stud (13 mm) 419 7-13-07102 Clip 420 2-00-01254 Screw, 1/2-13 x 1.500 HHC Ref.21 2-00-00518 Lock Washer, 1/4 622 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 223 2-00-04876 Screw, 1/4 - 20 x .500 BHS 824 2-00-00221 Screw, 1/4 - 20 x .750 HHC 1425 2-00-00596 Nut, Hex 1/2 - 13 x .750 x .437 Ref.26 2-00-00530 Lock Washer, Helical Spring 5/16 med 827 2-00-00585 Nut, 5/16-18 628 8-41-00033 Latch Assembly 129 2-00-00118 Screw, #10 - 24 x .625 RHM 430 2-00-01974 Sealing Washer, .562 x #10 x .065 231 2-00-00519 Lock Washer, Helical Spring #10 Med 432 2-00-00605 Nut, Hex MS #10-24 x .375 x .125 433 2-00-00208 Screw, 5/16-18 x .750 HHC 234 7-23-03048 Spring Washer, .750 x .312 x .013 135 2-00-00409 Flat Washer, .687 x .343 x .062 336 2-00-04707 Pop Rivet, .125 Dia. 3137 7-79-00081 Strap, Gasket Retainer 238 7-79-00082 Strap, Gasket Retainer 139 2-00-00455 Flat Washer #6 3140 7-79-00087 Strap, Gasket Retainer 241 0780-467 Vac Hose 1Key No.s 4, 5 and 6 must be ordered together for proper fit.P-4605/9809Lid Gasket Kit: 0880-6442-32 American-Lincoln7760

RECOVERY TANK LID - EXPLODED VIEW151383526272334 UPPER22 2120COVER29 49 4 2418 19 17 24 2627 2 104527 26 1820 2526271718197827 2633292630313212114028SOLUTIONTANK31374014401637393641P4605/9510RECOVERYTANKAmerican-Lincoln 2-337760

VACUUM MOTOR & FLOAT - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-34-04002 Impellor 12 2-00-00402 Flat Washer, .750 x .390 x .093 13 2-00-03412 Nut, Lock 3/8 - 24 x .562 x .281 14 2-00-00251 Screw, 1/4 - 20 x .500 HHCBB 45 2-00-00518 Lock Washer, Helical Spring 1/4 Med 166 2-00-03959 Hose Clamp, 3.562 - 4.500 17 7-79-00061 Strap-Float Ball 28 2-00-04115 Pop Rivet 19 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 1210 7-26-04011 Ball Float 111 2-00-00484 Spacer, .625 x .375 x .046 112 2-00-00585 Nut, Hex 5/16 - 18 x .50 x .265 413 2-00-00530 Lock Washer, Helical Spring 5/16 Med 414 7-68-00025 Screen 115 7-81-00134 Support 216 2-00-00222 Screw, 1/4 - 20 x 1.250 HHC 1217 7-20-06004 Fan Duct 118 2-00-00641 Nut, Hex Fiber Insert 1/4 - 20 1219 7-75-01159 Spacer 620 2-00-02653 Screw, 5/16 - 18 x 3.500 HHC 421 7-16-07276 Fan Cover 122 0782-145 Vacuum Motor 1Seal Kit: 7-70-00020Coil: 7-14-07007Valve: 7-12-0201923 7-21-04029 Edging 124 2-00-04707 Rivet, 1/8 x .312 3125 7-79-00081 Strap, Gasket Retainer 226 7-79-00082 Strap, Gasket Retainer 127 2-00-00455 Flat Washer, #10 Brass 3128 7-79-00087 Strap, Gasket Retainer 2P-4721/96092-34 American-Lincoln7760

VACUUM MOTOR & FLOAT - EXPLODED VIEW1213112223195212019RECOVERYTANK LID231817154561071454168P-5150/9606American-Lincoln 2-357760

FRONT WHEEL & BRAKE - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-02006 Brake Caliper Assembly Weldment 12 2-00-04801 Flat Washer 23 7-89-08098 Molded Wheel 14 7-03-09007 Stub Axle Weldment 15 2-00-02312 Lock Washer, Helical Spring ½ Med. 66 2-00-02689 Screw, 1/2-20 x 1.0 HHC 67 2-00-02079 Roller Bearing, 2.328 x 1.250 x .703 18 2-00-04621 Roller Bearing, Cup Only 29 2-00-03051 Screw, 1/4-20 .750 HSHC 510 7-08-02007 Brake Disc 111 8-80-05036 Stud, 1/2-20 x 1.56 512 7-33-09027 Hub, Front Wheel 113 2-00-04622 Roller Bearing, Cone (Timke n) 114 2-00-05024 Washer, 1 1/16 x 2.0 115 2-00-05026 Nut, 1-14 Fin. Slotted Hex 116 2-00-02436 Cotter Pin, .187 x 1.50 117 8-23-03065 Lug Nut, 1/2-20 x .800 x .620 518 8-11-00030 Dust Cap 171007/5-052-36 American-Lincoln7760

FRONT WHEEL & BRAKE - EXPLODED VIEW121435 67891011128131415 1671007/5-051817American-Lincoln 2-377760

REAR WHEEL - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-81-00225 Support, Rear Wheel 12~ 0885-051-1 Hydraulic Motor 1(Key: 8-70-00026 - one comes w/motor)(Nut: 8-70-00027 - one comes w/motor)(Motor Seal Kit: 0880-586 - Service Part)(Shaft Seal Kit: 0880-238 - Service Part)3 7-58-05229 Bearing Plate 14 2-00-04455 Thrust Bearing (TIMKEN -#T581) 15 2-00-04456 Cup Bearing (TIMKEN - #15245) 16 7-29-05037 Spur Gear 17 7-30-08012 Rack Guide 18 7-62-00006 Rack 19 2-00-04841 Nut, 3/4-16 x 1.125 x .641 Slotted Hex 210 8-75-01157 Flat Washer, 3/4 Series W 211 2-00-03761 Key, .250 x 1.750 SQ. 112 2-00-02436 Cotter Pin, 1/8” dia. x 1.50 213 2-00-00242 Screw, 1/2 - 13 x 2.250 HHC 414 2-00-02312 Lock Washer, Helical Spring 1/2 Med 815 2-00-00596 Nut, Hex 1/2 - 13 x .750 x .437 416 2-00-00518 Lock Washer, Helical Spring 1/4 Med 217 2-00-03051 Screw, 1/4-20 x .750 SHCS 118 2-00-01260 Dowel Pin, .250 x .625 219 2-00-00240 Screw, 1/2 - 13 x 1.250 HHC 420 2-00-00220 Screw, 1/4 - 20 x .625 HHC 121 2-00-00566 Lubrication Fitting, Straight 1/8 NPT 122 7-17-05010 Power Steering Hydraulic Cylinder 123 2-00-00591 Nut, Hex Jam 1/2 - 20 x .750 x .312 124 2-00-02568 Lubrication Fitting, 45° 1/8 NPT 125* 7-33-09063 Hub, Drive Wheel 126* 7-80-05056-1 Studs Only 627* 7-89-08069 Tire & Outer Rim Only 17-85-06008 Tire Only (16 x 16 x 10.5) 128* 8-23-03065 Nut, Wheel 629 2-00-05225 Washer, 1.25 ID x 2.25 OD x .13 1~CE Models only use the following: 0885-083 motor; Seal kits are the same as 0885-051-1*Part of 6” press-on wheel complete assembly 7-89-08068Hub Assembly w/pressed-in studs (Item No.’s 25 & 26): 0780-65671020/12-042-38 American-Lincoln7760

REAR WHEEL - EXPLODED VIEW71020/12-04American-Lincoln 2-397760

BRAKE LINKAGE - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-41-05083 Parking Brake Lever 12 2-00-00585 Nut, Hex 5/16 - 18 x .500 x .265 93 2-00-00530 Lock Washer, Helical Spring 5/16 Med 94 7-75-01096 Lever Mounting Spacer 25 2-00-02708 Screw, 5/16 - 18 x 1.000 HHC 56 2-00-02428 Cotter Pin, .062 x .750 27 7-55-08122 Brake Clevis Pin 28 8-14-01007-1 Brake Pedal Clevis 29 7-66-00143 Brake Rod 210 7-70-05173 Cross Shaft 110 7-70-05145 Cross Shaft (Diesel Only) 111 8-14-01001 Clevis 212 2-00-00234 Screw, 3/8 - 16 x 1.500 HHC 113 8-09-01065 Bushing, Flanged .875 x .390 x .650 114 8-60-00140 Pulley 115 7-10-00019 Parking Brake Cable 116 2-00-04873 Cable Clamp, .500 117 2-00-02310 Lock Washer, Helical Spring 3/8 Med 118 2-00-02360 Nut, Hex 3/8 - 16 x .562 x .328 119 7-08-00502 Brake Cross Shaft Bracket 120 7-55-00009 Brake Pedal 121 7-50-05145 Brake Pedal Pad 122 7-76-00102 Spring 123 2-00-01770 Screw, 5/16 - 18 x 2.750 HHC 124 7-08-00501 Brake Pulley Bracket 125 2-00-00644 Nut, Hex Fiber Insert 5/16 - 18 326 7-15-01014 Setscrew Collar, 1.625 x 1.000 x .750 227 2-00-00207 Screw, 5/16 - 18 x 1.250 HHC 228 2-00-02369 Nut, Hex Jam 3/8-16 x .562 x .218 429 2-00-00208 Screw, 5/16-18 x .750 HHC 230 2-00-02597 Screw, 5/16-18 x 3.250 HHC 131 2-00-00409 Flat Washer, .687 x .343 x .062 132 7-75-01126 Spacer, .500 x .327 x .780 Part of #1) 2P-4737/96092-40 American-Lincoln7760

BRAKE LINKAGE - EXPLODED VIEW67891233230212341520 528FRAME222526 1126782416331 291418 17 328291026 2713 12 2 3252819 5 3 2 1152725P473710(DIESELONLY)American-Lincoln 2-417760

FORWARD/REVERSE CONTROL (FORD 425EFI) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-00594 Nut, 1/4 - 20 x .437 x .218 Hex 132 2-00-00518 Lock Washer, 1/4 Med Helical Spring 33 2-00-00530 Lock Washer, 5/16 Med Helical Spring 54 2-00-00225 Screw, 5/16-18 x 1.500 HHC 15 7-03-04105 Transmission Arm 16 7-75-01089 Isolator 67 2-00-00246 Screw, 1/4-20 x 2.250 HHC 18 7-58-05220 Plate, Transmission Arm 19 7-75-01110 Spacer 110 2-00-00221 Screw, 1/4-20 x .750 HHC 511 2-95-01999 Nut, 1/4-28 x .437 x .156 Hex Jam 612 7-66-00147 Rod, 1/4-28 x 3.000 113 7-25-02050 Rod End, 1/4-28 214 2-00-00633 Nut, RH .25-28 Fiber Insert 215 2-00-02352 Nut, .50-13 Heavy Hex 116 8-16-00025 Centering Control 117 2-00-00501 Lock Washer, 1/4 Int. 2918 2-00-00240 Screw, .50-13 x 1.25 HHC 119 7-08-00917 Bracket, Centering Control 120 2-00-00585 Nut, 5/16-18 x .500 x.265 Hex 421 2-00-00641 Nut, .25-20 Fiber Insert 122 8-08-00327 Bracket, Forward/Reverse Pedal 223 7-55-00010 Forward Reverse Pedal 124 2-00-00402 Flat Washer, .750 x .390 x .093 225 2-00-03569 Carriage Bolt, 5/16 - 18 x .75 426 7-08-01200 Bracket, Foot Pedal Prox. Switch 127 7-82-00047 Proximity Switch 228 2-00-00244 Screw, 1/4-20 x 1.00 HHC 131 2-00-04563 Screw, #10-24 x .625 x .375 132 8-14-01006 Clevis 133 7-16-00009 Cable, Forward/Reverse Cable 134 8-08-00506 Bracket, Cable Mounting 135 2-00-00451 Flat Washer, .750 x .312 x .065 236 2-00-04602 Clamp, .500 Bracket 137 7-03-04183 Arm, Transmission Link 140 2-00-00405 Flat Washer, .750 x .281 x .062 241 2-00-02310 Lock Washer, 3/8 Med Helical Spring 142 2-00-00232 Screw, 3/8 - 16 x .75 HHC 143 2-00-01246 Nut, #10-24 Fiber Insert Hex 144 2-00-00641 Nut, 1/4-20 Fiber Insert Hex 145 2-00-00219 Screw, 1/4-20 x .500 HHC 6P5068ecp/1-042-42 American-Lincoln7760

FORWARD/REVERSE CONTROL (FORD 425EFI) - EXPLODED VIEWTRANS. PUMP1 1734567817459144421101914131111 12184037131125222325242215144016414233INBOARDENGINEMOUNTBRACKET3410312726320FLYWHEELHOUSING43123ENGINESUPPORT352133113210P5068ecp/1-04American-Lincoln 2-437760

FORWARD/REVERSE CONTROL (MITSUBISHI DIESEL) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 112 2-00-00518 Lock Washer, Helical Spring 1/4 Med 33 2-00-00530 Lock Washer, Helical Spring 5/16 Med 54 2-00-00225 Screw, 5/16-18 x 1.500 HHC 15 7-03-04105 Transmission Arm 16 7-75-01089 Isolator, 1/4-20 67 2-00-00246 Screw, 1/4-20 x 2.250 HHC 18 7-58-05220 Transmission Arm Plate 19 7-75-01110 Spacer, Transmission Arm 110 2-00-00221 Screw, 1/4-20 x .750 HHC 511 2-95-01999 Nut, Hex Jam 1/4-28 x .437 x .156 412 7-66-00147 Rod, 1/4-28 x 3.000 113 7-25-02050 Rod End, 1/4-28 214 2-00-02312 Lock Washer, Helical Spring 1/2 Med 115 2-00-02352 Nut, Hex 1/2-13 x .875 x .484 116 8-16-00025 Centering Control 117 2-00-00501 Lock Washer, 1/4 Int. 1618 2-00-00240 Screw, 1/2-13 x 1.250 HHC 119 7-08-00583 Centering Control Bracket 120 2-00-00585 Nut, Hex 5/16-18 x .500 x.265 421 2-00-00208 Screw, 5/16-18 x .750 HHC 222 8-08-00327 Forward Reverse Pedal Bracket 223 7-55-00010 Forward Reverse Pedal 124 2-00-00402 Flat Washer, .750 x .390 x .093 225 2-00-03569 Carriage Bolt, 5/16 - 18 x .75 426 7-08-01200 Bracket, Foot Pedal Prox. Switch 127 7-82-00047 Switch, Proximity 231 2-00-04563 Screw, #10-24 x .625 x .375 SH 132 8-14-01006 Clevis 133 7-16-00009 Forward / Reverse Cable 134 8-08-00506 Cable Mounting Bracket 135 2-00-03702 Flat Washer, .750 x .281 x .062 236 2-00-04602 Hose Clamp, .500 137 2-00-00405 Flat Washer, .500 238 7-03-04106 Transmission Arm 139 2-00-01246 Nut, Hex Fiber Insert #10-24 140 7-34-09018 Insulating Sleeve 141 2-00-00641 Nut, Hex Fiber Insert 1/4-20 142 2-00-00219 Screw, 1/4-20 x .500 HHC 643 7-08-01209 Bracket, Forward/Reverse Cable 144 7-08-00585 Hydroback Bracket 1P5118ecp/1-042-44 American-Lincoln7760

FORWARD/REVERSE CONTROL (MITSUBISHI DIESEL) - EXPLODED VIEW25 22 2423 2524 1022 35 234 1 33 40123626 273201031 1132431131117113842173979414311172183106195171121315 14 3718371611P5118ecp/0401American-Lincoln 2-45776044

MAIN FRAME - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY.1* 7-27-07231 Main Frame 11< 7-27-07232 Main Frame 13* 2-00-00208 Screw, 5/16 - 18 x .750 HHC 44 2-00-00594 Nut, Hex ¼ - 20 x .437 x .218 25 2-00-00518 Lock Washer, Helical Spring ¼ Med. 56* 8-21-04015 Edging 17* 2-00-00409 Flat Washer, .687 x .343 x .062 88* 7-16-07313 Support Wing Cover 19* 7-16-07314 Support Wing Cover 110* 2-00-03702 Flat Washer, .562 x .265 x .062 810< 2-00-03702 Flat Washer, .562 x .265 x .062 411 7-21-04030 Edging 112 7-21-04031 Edging 513 7-16-07386 Steering Gear Cover 114* 2-00-00221 Screw, ¼ - 20 x .750 HHC 414< 2-00-01490 Screw, 1/4-20 x .75 HHC 515 2-00-04378 Clamp, .281 116* 2-00-00221 Screw, ¼ - 20 x .750 HHC 117* 2-00-00530 Lock Washer, 5/16 Med HS 818* 2-00-00225 Screw, 5/16-18 x 1.50 Lg HHC 420* 7-81-00189 Safety Arm 121* 7-75-01167 Spacer 122* 2-00-05187 Carriage Bolt 3/8-16 x 1.25” 123* 2-00-02369 Nut, Hex Jam 3/8-16 124* 8-15-01003 Set Screw Collar - .750 I.D. 1P-5153/1-04*Used on Variable Dump Machines Only

MAIN FRAME - EXPLODED VIEW18 3 17 19 8 7921202223724121110131456P5153/000711615DIESEL FUELLINE54FUEL LINEDIESEL ONLYAmerican-Lincoln 2-477760

DRIVER COMPARTMENT - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1* 2-00-02011 Plastic Plug, .440 Dia. 12* 7-14-07006 Clevis 13* 7-41-05092 Throttle Handle 14 2-95-01999 Nut, Hex Jam 1/4-28 x .437 x .156 25* 7-25-02050 Rod End, 1/4-28 16 2-00-00626 Nut, Hex MS #10-32 x .375 x .125 17* 7-10-00024 Throttle Cable8* 8-13-07094 Clamp 19 2-00-03061 Screw, #10-24 x .500 THM 410 2-00-00221 Screw, 1/4-20 x .75 HHC 611 2-00-00518 Lock Washer, Helical Spring 1/4 Med 1412 2-00-03702 Flat Washer, .625 x .281 x .062 1013 7-70-08005 Driver Compartment Cover 114 2-00-00594 Nut, Hex 1/4-20 x .437 x .218 815 2-00-04514 Plastic Plug, .562 Dia. 416 2-00-00209 Screw, 3/8-16 x 1.000 HHC 117 7-08-00845 Drive Compartment Support Bracket 118 2-00-00620 Nut, Hex 7/16-14 119 2-00-04182 Lock Washer, 7/16 120 2-00-00402 Flat Washer, .750 x .390 x .062 321 2-00-00585 Nut, Hex 5/16-18 x .500 x .265 122 2-00-00530 Lock Washer, Helical Spring 5/16 Med 123 7-55-08116 Striker Pin 124 2-00-04794 Screw, #10-24 x .625 BHS 225 8-41-00037 Rotary Latch 126 7-31-06061 Grip 127 7-31-06076 Handle 128 2-00-00519 Lock Washer, Helical Spring #10 Med 629 2-00-00605 Nut, Hex MS #10-24 x .375 x .125 430 7-16-07281 Cover 131 2-00-00220 Screw, 1/4-20 x .625 HHC 832 7-69-00003 Seat 133< 2-00-06046 Check Engine Light (comes w/engine) 134* 7-39-00017 Knob 135 2-00-00426 Flat Washer, .500 x .218 x .062 236* 7-08-00590 Bracket, Throttle Cable Mounting 137 8-21-04019 Edging 138 2-00-00501 Lock Washer, 1/4 Int 139* 7-08-00589 Bracket, Throttle Control Mounting 141 2-00-05261 Riv-Nut - ¼ - 20 THD 143 7-72-05005 Slide Adjuster Kit 144 7-03-04165 Arm Rest Kit 145* 2-00-05758 Cover, Switch 146 7-52-00149 Panel, Access 147* 2-00-04873 Clamp 148* 2-00-00196 Carriage Bolt, 5/16-18 x 1.00 149 2-00-00409 Flat Washer, .687 x .344 x .062 550< 2-00-05827 Base, Switch 151< 2-00-05988 Actuator, Throttle 1*Diesel Only

DRIVER COMPARTMENT - EXPLODED VIEW9455111 501434331232,43,4431313024272625113149143743839362835294789 2876345142829484749222118192022 202341101112461011121311141716P5145/040115American-Lincoln 2-497760

HYDRAULIC HOSE SYSTEM (VARIABLE DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1^ 8-33-02277 Hydraulic Hose ORS 4-Str. Ends 110" LG. 23^ 8-33-02328 Hydraulic Hose ORS 4-90° to Str. 78.5" LG. 14^ 7-33-02194 Hydraulic Hose ORS 4-90° to Str. 80" LG. 15^ 7-33-02332 Hydraulic Hose ORS 8-90° to Str. 102" 27+ 8-33-02327 Hydraulic Hose ORS 8-Str. Ends 94" 17* 8-33-02195 Hydraulic Hose ORS 8 - Str Ends 69.5” 18+^ 7-33-02225 Hydraulic Hose ORS 4-90° to Str. 38" 19+ 7-33-02189 Hydraulic Hose ORS 4-90° to Str. 26" 210+^ 8-33-02218 Hydraulic Hose ORS 4 Ends 60” 211 8-33-02178 Hydraulic Hose ORS 4-Str. to Str. 15" LG. 112+ 7-33-02223 Hydraulic Hose ORS 8-45° to Str. 87" 212* 7-33-02200 Hydraulic Hose ORS 8-45° to Str 77” 113+ 8-33-02202 Hydraulic Hose ORS 8-90° to Str. 20" 115+ 7-33-02191 Hydraulic Hose ORS 4-90° to Str. 42" 117+ 7-33-02225 Hydraulic Hose ORS 4-Str. to 90° 38" LG. 118+ 8-33-02218 Hydraulic Hose ORS 4-Str. Ends 60" 119 8-33-02320 Hydraulic Hose ORS 4 90°to Str. 64" 220 7-33-02327 Hydraulic Hose ORS 8-90° to Str. 15.25" 121+ 7-33-02334 Hydraulic Hose ORS 4-90° to Str. 52.25" 122+ 7-33-02546 Hydraulic Hose ORS 8-90° to Str. 42.5" 124+ 8-33-02214 Hydraulic Hose ORS 8-Str. Ends 29" 226+ 7-33-02403 Hydraulic Hose, ORS 4-90° to Str. 29" 127^ 8-33-02178 Hydraulic Hose ORS 4-Str. Ends 15" 128^ 8-33-02201 Hydraulic Hose ORS 8-45° to Str, 18" 129+ 7-33-02189 Hydraulic Hose ORS 4 Str. Ends 66" 131 7-33-02201 Hydraulic Hose ORS 8-Str. to JIC Str. 20.5" 132 7-33-02326 Hydraulic Hose ORS 8-90° to Str. 17" 133 2-00-04987 ORFS Union, 13/16-16 138+ 7-33-02190 Hydraulic Hose ORS 4 - 90º to Str. 67” 1*Used on Diesel-Powered Machines Only+Components of 0760-493, 7760 common hydraulic hose kit.^Components of 0760-494, 7760 VD hydraulic hose kit.P-4813nm/07032-50 American-Lincoln7760

HYDRAULIC HOSE SYSTEM (VARIABLE DUMP) - EXPLODED VIEW1119A-TO RETURN MANIFOLDBFROM RESERVOIR31134375827A72124332810PT1P1 1 243TBCAD38TPA B C1C3C2C421313C17341592926321812*122022TO DOUBLE GEAR PUMPPRIORITY PORT - TOPC12TO POWERSTEERINGUNIT4TO DOUBLE GEAR PUMPSECONDARY PORT - BOTTOMTO VAC MOTORRECOVERY TANKP4813-nm/0703American-Lincoln 2-517760

HYDRAULIC HOSE SYSTEM (MANUAL DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-33-02202 Hydraulic Hose ORS 8 Str. to JIC 8 Str. 69" 12 7-33-02201 Hydraulic Hose ORS 8-Str. to JIC 8 Str. 20.5" 13+ 7-33-02224 Hydraulic Hose ORS 4-90° to Str. 155" 14+ 8-33-02327 Hydraulic Hose ORS 8-Str.to 8 Str. 94" 1* 8-33-02195 Hydraulic Hose ORS 8-Str.to 8 Str. 69.5" 15+ 7-33-02186 Hydraulic Hose ORS 4-Str. Ends 30" 16+ 7-33-02225 Hydraulic Hose ORS 4-90° to Str. 38" 17+ 8-33-02200 Hydraulic Hose ORS 4-90° to Str. 55" 28+ 8-33-02214 Hydraulic Hose ORS 4-Str. to 4 Str. 29" 39+ 8-33-02184 Hydraulic Hose ORS 4-Str. to 4 Str. 50.5" 110+ 8-33-02202 Hydraulic Hose ORS 8-90° to 8 Str. 20" 111+ 7-33-02325 Hydraulic Hose ORS 8-45° to 8 Str. 34" 112+ 7-33-02334 Hydraulic Hose ORS 4-90° to 4 Str. 52.25" 113+ 7-33-02205 Hydraulic Hose ORS 8-45° to 8 Str. 16.25" 114+ 7-33-02197 Hydraulic Hose ORS 8-45° to 8 Str. 52.50" 115 7-33-02327 Hydraulic Hose ORS 8-90° to 12 Str. 15.25" 116+ 7-33-02191 Hydraulic Hose ORS 4-90° to Str. 42" 217+ 7-33-02331 Hydraulic Hose ORS 16-Str. Ends 46" 118+ 7-33-02225 Hydraulic Hose ORS 4-90° to Str. 38" 119+ 7-33-02189 Hydraulic Hose ORS 4-90° to Str. 26" 220+ 8-33-02218 Hydraulic Hose ORS 4-Str. Ends 60" 121+ 8-33-02189 Hydraulic Hose ORS 4-Str. Ends 56" 122+ 7-33-02223 Hydraulic Hose ORS 8-45° to Str. 87" 2* 7-33-02200 Hydraulic Hose ORS Str. To 45° 77” 123 7-33-02326 Hydraulic Hose ORS 8-90° to 8 Str.17" 124 8-33-02216 Hydraulic Hose ORS 4-Str. Ends 88" (OPTION) 225 7-33-02244 Hydrulic Hose Raw Ends 1.00 I.D. 126 7-33-02316 Hydraulic Hose, 8-Str. to JIC-8 Str. 69" 127+ 7-33-02180 Hydraulic Hose ORS 4-Str. to 4 Str. 37" 128+ 7-33-02190 Hydraulic Hose ORS 4-90° to Str, 67” 129 7-33-02184 Hydraulic Hose ORS 4-Str. Ends 25.5” (OPTION) 1* Diesel Only+ Hoses are components of 0760-493 7760 common hydraulic hose kit.C-0356i/08032-52 American-Lincoln7760

SUCTION & RETURN HOSES (VARIABLE DUMP) - EXPLODED VIEWDUMPCYLINDER30SIDE BROOM MOTOROILCOOLERDUST CONTROL MOTOR2SQUEEGEEVACUUMMOTOR37LIFTCYLINDER16MAINBROOMMOTOR39366HOPPER CONTROL VALVECYLINDER CONTROL VALVESIDE BROOMVALVEMAINCONTROLVALVE251415POWERUNITSTEERINGDRIVE & AUXILIARYPUMPRETURNMANIFOLD343523STRAINERSCRUB BRUSH MOTORPOWER STEERING CYLINDERDRIVE WHEEL MOTORSQUEEGEE DECK CYLINDERSCRUBDECKCYLINDER8RESERVOIRFILTERP4803g/0703American-Lincoln 2-557760

SUCTION & RETURN HOSES (MANUAL DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-33-02202 Hydraulic Hose ORS 8 Str. to JIC 8 Str. 69" 123 7-33-02224 Hydraulic Hose ORS 4-90° to Str. 155" 145 7-33-02186 Hydraulic Hose ORS 4-Str. Ends 30" 167 8-33-02200 Hydraulic Hose ORS 4-90° to Str. 55" 28 8-33-02214 Hydraulic Hose ORS 4-Str.to 4 Str. 29" 39 8-33-02184 Hydraulic Hose ORS 4-Str. to 4 Str. 50.5" 11011121314 7-33-02197 Hydraulic Hose ORS 8-45° to 8 Str. 52.50" 1151617 7-33-02331 Hydraulic Hose ORS 16-Str. Ends 46" 118 7-33-02225 Hydraulic Hose ORS 4-90° to Str. 38" 119202122232425 7-33-02244 Hydraulic Hose, 1.000 dia. x 33.000" long 12627 7-33-02180 Hydraulic Hose ORS 4-Str. to 4 Str. 37" 12829 7-33-02184 Hydraulic Hose ORS 4-Str. Ends 25.5” (OPTION) 1C-0379f/08032-56 American-Lincoln7760

MAIN BROOM & FITTINGS4TO PRESSURE PORT OFDUST CONTROL MOTOR2 13TO"1" PORT ON MAINCONTROL VALVE6TO UNION FITTING THENTO PRESSURE PORT OFDUST CONTROL MOTORP-4381-2/96075TO RETURN MANIFOLDKEY NO. PART NUMBER DESCRIPTION QTY1 0882-040 Main Broom Motor 12-00-03838 Key (comes w/motor)0880-448 Motor Seal Kit (Service Part)2 2-00-04885 ORFS 90° Elbow, 3/4-16 to 13/16-16 23 8-33-02214 Hose Ref.4 2-00-04895 ORFS Connector, 7/16-20 to 9/16-18 15 8-33-02200 Hose Ref.6 2-00-04987 ORFS Union, 13/16 - 16 Ref.P-4381-2/96092-58 American-Lincoln7760

TO PORT "1" ON SIDEBROOM CONTROL VALVESIDE BROOM & FITTINGSTO PORT "3" ON SIDEBROOM CONTROL VAVLE5 544FROM “P1”MAIN CONTROL BLOCK32 36101117TO “A” PORTSIDE BROOMMOTOR12BATO TOP OFRETURN BLOCK8TO “B” PORTSIDE BROOM MOTOR9P4379A/9809KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04918 ORFS Connector, 9/16-18 22 0885-061 Hydraulic Motor 10880-293 Seal Kit for 0885-061 (Up to Serial No. 750056) 10780-144 Seal Kit for 0885-061 (Serial No. 750056 & Above) 13 7-33-02181 Hose Ref.4 2-00-05373 Fitting, Union 9/16 - 18 ORS 25 7-33-02330 Hose Ref.6 2-00-03702 Washer, Flat 67 2-00-04926 Fitting, 90° 38 7-88-00077 Valve, Housing - 3 way 19 2-00-05162 Fitting, Run tee 110 2-00-02589 Screw 211 2-00-00518 Lock Washer 2P-4379-1/9809American-Lincoln 2-597760

SCRUB MOTORS & FITTING654377127REF SCRUB DECKFRONT OFMACHINEP3810b-0603KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04974 Fitting - 10 SAE - 8 ORS 12 2-00-04921 Fitting - 10 SAE - 90° - 8 ORS 43 2-00-04990 Fitting - 10 SAE - 8 ORS 14 2-00-04970 Fitting - 8 SAE - 8 ORS 15 7-33-02326 Hose - 17" 90° End 16 7-33-02327 Hose - 15.25" 90° End 17 0782-111 Scrub Motor Hyd. 30780-070 Seal Kit for Motor 0782-111P-3810-B/06032-60 American-Lincoln7760

SQUEEGEE, SCRUB DECK CYLINDERS, & FITTINGS163TO "C2" PORT ON CYLINDERCONTROL VALVETO "C1" PORT ONCYLINDER CONTROLVALVE4TO "C3" PORT ON CYLINDERCONTROL VALVE11TO "C4" PORT ON CYLINDERCONTROL VALVE251P1824KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04892 ORFS 90° Elbow, 7/16-20 to 9/16-18 42 7-17-05019 Hydraulic Cylinder (Squeegee) 13 7-17-05011 Hydraulic Cylinder (Scrub Deck) 14 8-33-02189 Hose Ref.5 8-33-02218 Hose Ref.6 7-33-02189 Hose Ref.P-4824/9609American-Lincoln 2-617760

POWER STEERING, HOPPER DUMP, HOPPER LIFT CYLINDERS, & FITTINGSKEY NO. PART NUMBER DESCRIPTION QTYP-48781 7-33-02194 Hose Ref.2 2-00-04892 ORFS 90° Elbow, 7/16-20 to 9/16-18 23 7-33-02195 Hose Ref.4 7-17-05020 Dump Cylinder 15 7-33-02191 Hose Ref.6 7-33-02193 Hose Ref.7 7-17-05010 Steering Cylinder 1NS 7-70-00021 Dump and Steering Cylinders Seal Kit 28 7-17-05013 Lift Cylinder 1NS 0880-506 Lift Cylinder Seal Kit 19 2-00-04895 ORFS Connector, 7/16-20 to 9/16-18 110 8-33-02178 Hose Ref.1112 7-33-02225 Hose Ref.13 2-00-04927 Run Tee Fitting 21415 8-88-00045 Fitting, Check Valve 116 2-00-04997 Fitting Adapter, 9/16-18 ORFS - 1/4-18 NPT17 2-00-04994 Adapter Fitting 118 2-00-05054 Adapter Fitting 119 7-33-02180 Hose Ref.2-62 American-Lincoln7760

POWER STEERING, HOPPER DUMP, HOPPER LIFT CYLINDERS, & FITTINGSTO WORK PORT "C" ON HOPPER PUMP VALVE10TO WORK PORT "D" ONHOPPER DUMP VALVE9TO WORK PORT "A" ONHOPPER DUMP VALVE12TO RETURN MANIFOLD1101313TO WORK PORT "B" ONHOPPER DUMP VALVE34186HOPPER LIFT(VARIABLE DUMP ONLY)817HOPPER DUMP(VARIABLE DUMP ONLY)151610TO PORT "R" ON POWERSTEERING UNIT719TO PORT "L" ON POWERSTEERING UNITPOWERSTEERING2P48785American-Lincoln 2-637760

REAR WHEEL MOTOR & FITTINGS - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-00644 Nut, Fiber Lock 5/16 - 18 THD’s 12 7-23-03048 Spring Washer, .750 x .312 x .013 13* 2-00-00409 Flat Washer, For 5/16 Bolt (.687 x .343 x .062) 14 2-00-00586 Nut, Hex Jam 5/16-18 x .500 x .187 15 7-13-07110 Hose Clamping Unit 16* 7-09-01121 Split Hose Bushing 27 2-00-01770 Screw, 5/16-18 x 2.750 HHC 18 2-00-05358 Fitting 29 8-03-02035 Fitting 110 7-03-00054 Fitting 111 2-00-04620 Seal 212 2-00-04895 Fitting 113 0885-051-1 Rear Wheel Motor 10880-238 Motor Seal Kit0880-237 Shaft Seal for Eaton P/N 110-1085-0040880-586 Shaft Seal for Eaton P/N 110-1085-00614 7-33-02223 Hose 215 8-33-02184 Hose Ref.P-5092/98092-64 American-Lincoln7760

REAR WHEEL MOTOR & FITTINGS - EXPLODED VIEW1TO RETURNMANIFOLD81491011127RESERVOIR234TO RIGHT WORK PORTOF TRANSMISSIONTO LEFT WORK PORTOF TRANSMISSION56 515FRONTREARPORTPORT13P5092American-Lincoln 2-657760

HYDRAULIC RESERVOIR, FILTER, & FITTINGS - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-11-00026 Reservoir Filter Cap 12 2-00-00049 Screw, #10-24 x .500 RHM 143 7-16-07282 Hydraulic Reservoir Cover 14 2-00-00530 Lock Washer, Helical Spring 5/16 Med 25 2-00-00519 Lock Washer, #10 146 7-21-03003 Edging 17 2-00-05354 Fitting, 3/4 NPT x 1 7/16-12 28 8-48-05034 Fluid Level Sight Gauge 19 8-24-04115 Strainer 210 2-00-02474 Pipe Plug, 1/2 NPT 111 2-00-04895 ORFS Connector, 7/16-20 to 9/16-18 312 7-24-04031 Return Filter Assembly 1NS 7-24-04032 Return Filter Replacement Filter 113 2-00-05073 Straight Barbed Stem, 1-11 1/2 to 1.375 x 2.87 114 2-00-02708 Screw, 5/16-18 x 1.000 HHC 215 2-00-02220 Hose Clamp, .812 - 1.500 116 2-00-03940 Screw, #10-24 x .500 TC/HH 617 7-33-02244 Hose 11819 7-33-02331 Hose 120 7-33-02333 Hose 121 7-33-02224 Hose 122 7-33-02225 Hose 123 2-00-00293 Plug, Pipe 124** 2-00-05177 Plug 7/16-20 O Ring 1P-5088/9510** Manual Dump Only2-66 American-Lincoln7760

HYDRAULIC RESERVOIR, FILTER, & FITTINGS - EXPLODED VIEW171613TO RETURN MANIFOLD1441521125319TO DUST CONTROL MOTORCASE DRAINTO SQUEEGEE VAC. MOTORCASE DRAINTO CYLINDERCONTROL VALVE(T-PORT)6TO AUX. PUMPON TRANSMISSION222120*1124**2387P-5088/9607109American-Lincoln 2-677760

DRIVE PUMP & FITTINGSKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04979 ORFS Connector, 1 1/16-12 to 13/16-16 12 2-00-04926 ORFS 90° Elbow, 9/16-18 13 7-60-05026 Drive Pump 14 2-00-04922 ORFS 90° Elbow, 1 1/16-12 to 13/16-16 15 2-00-04978 Tee Fitting 16 7-60-05027 Auxiliary Pump (Double Gear) 17 7-33-02197 Hose Ref.8 7-33-02223 Hose Ref.9 2-00-00209 Screw, .375-16 x 1.25 HHC 210 7-33-02186 Hose Ref.11 0880-685 Kit, Pump Assembly 112 2-00-02310 Lock Washer, Helical Spring 213 7-33-02433 Hose, ORS 8-STR, 74” 114 2-00-00402 Flat Washer, .750 x .391 x .093 2P5070ecp/1-042-68 American-Lincoln7760

VAC MOTOR & FITTINGS7-33-02433 Ref2TO TEE FITTINGON TOP OF DRIVE PUMP7365TO AUXILIARY PUMP DOUBLE GEAR8-33-02327 Ref104819VAC MOTOR(0782-145)CASE DRAIN TO RESERVOIRRECOVERY TANK COVER7-33-02201 Ref7-33-02224 RefP4871e/0603KEY NO. PART NUMBER DESCRIPTION QTY1 7-29-00192 Gasket - Oil Cooler 42 8-62-01010 Oil Cooler 13 8-13-07088 Clip 24 2-00-01980 Screw - 1/4-200 x 1.25 HHC 25 2-00-00641 Nut 0 1/4-20 Fibre Lock Hex 26 7-29-00207 Gasket 27 2-00-04822 Fitting - Elbow 38 2-00-04975 Fitting - 45º Elbow 19 2-00-04976 Fitting - 45º Elbow (Case Drain Port) 110 2-00-04885 Fitting - Elbow 1P-4871e/0603American-Lincoln 2-697760

DUST CONTROL IMPELLER & FITTINGSTO PORT "2" ON MAINCONTROL VALVE4TORESERVOIR5123TO UNION FITTING6P4837/96084KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04892 Fitting, 90° #4 SAE x #4 ORS 12 2-00-04885 Fitting, 90° #8 SAE x #8 ORS 13 0882-041 Dust Control Motor 14 7-33-02332 Hose Ref.5 7-33-02333 Hose Ref.6 2-00-04970 Fitting, STRT #8 SAE x #8 ORS 1P-4837-1/96092-70 American-Lincoln7760

POWER STEERING UNIT & FITTINGS4216TLPR939P4834/9705TO POWER STEERINGCYLINDERTO PRIORITYPORT ON DOUBLEGEAR PUMP8TO POWER STEERINGCYLINDERTO PORT “T” ON CYLINDERCONTROL BLOCKKEY NO. PART NUMBER DESCRIPTION QTY1 7-60-05029 Power Steering Unit 12 2-00-04932 ORFS Boss Reducer, 3/4-16 to 9/16-18 23 2-00-05264 Fitting, Straight 24 2-00-04918 ORFS Connector, 9/16-18 156 7-33-02334 Hose Ref.78 7-33-00225 Hose Ref.9 7-33-02192 Hose, 67” Ref.P-4834/9705American-Lincoln 2-717760

MAIN CONTROL VALVE & FITTINGS1234TO HOPPER DUMP VALVE151416T1P1161 23422254P3TO RETURN MANIFOLD182136TO DUST CONTROLMOTORP4833A/0603TO AUXILIARY PUMPTO MAIN BROOM MOTOR(BOTTOM PORT)TO PORT "2” ON SIDE BROOM VALVEKEY NO. PART NUMBER DESCRIPTION QTY1 7-88-00071 Valve 12 2-00-04970 Fitting - Straight 43 2-00-04885 ORFS 90° Elbow, 3/4-16 to 13/16-16 24 2-00-04892 ORFS 90° Elbow, 7/16-20 to 9/16-18 (Gas Only) 15** 8-33-02326 Hose Ref.# 7-33-02325 Hose Ref.6 7-33-02205 Hose Ref.9** 2-00-04978 Fitting - 90 ° 111** 2-00-04895 Fitting - Straight 113 2-00-04986 Screw, 1/4 - 20 x 4.500 HHC 214 2-00-00518 Lock Washer, 1/4 Split 215 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 216 2-00-03702 Flat Washer For 1/4 Bolt 618 2-00-04895 Fitting - Straight 1# 2-00-04885 ORFS 90° Elbow, 3/4-16 to 13/16-16 1P-4833A/0603** Diesel Only# Gas Only2-72 American-Lincoln7760

CYLINDER CONTROL VALVE & FITTINGS8766 9103C410 924TP12A51C1BC2C311 13TO LOWER PORT OFSQUEEGEE CYLINDERTO UPPER PORT OF SCRUBDECK CYLINDERTO UPPER PORT OFSQUEEGEE CYLINDERTO LOWER PORT OF SCRUBDECK CYLINDERP4831A/9809147TO PORT "T" ON POWERSTEERING UNITTO REAR CASE DRAINPORT ON RESERVOIRKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04596 Screw, 1/4-20 x 3.500 HHC 22 7-88-00069 Valve 13 2-00-04895 Straight Fitting 64 2-00-04892 ORFS 90° Elbow, 7/16-20 to 9/16-18 25 2-00-00518 Lock Washer, 1/4 Split 26 7-12-02032 Cavity Plug 17 8-33-02184 Hose Ref.9 7-33-02189 Hose Ref.10 8-33-02218 Hose Ref.11 2-00-05177 Plug 212 7-12-02031 Cartridge 250 PSI Relief Ref.13 8-33-02189 Hose Ref.14 7-33-02225 Hose Ref.P-4831a/9809American-Lincoln 2-7377608

RETURN MANIFOLD & FITTINGS113FROM OILCOOLER12*FROMRESERVOIRFROM MAINVALVE "T" PORTFROMDRIVE11PUMP1492FROM FRONT PORTOF HOPPER LIFTCYLINDER20876103MAIN FRAMEBACKBONEFROM CASEDRAIN REARWHEEL MOTORFROM CASE DRAINMAIN BROOM MOTOR15164FROM CONTROLVALVE (PORT TI)FROM CASE DRAINON DRIVE PUMP1819P-5087/9607KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04885 ORFS 90° Elbow, 3/4-16 to 13/16-16 32 2-00-02638 Screw, 1/4-20 x 3.000 HHC 23 7-48-00019 Return Manifold 14 2-00-05177 Plug 16 2-00-04895 ORFS Connector, 7/16-20 to 9/16-18 77 2-00-04927 ORFS Run Tee, 7/16-20 to 9/16-18 18 2-00-05073 Straight Barbed Stem, 1-11 1/2 x .50 x 2.57 19 2-00-02220 Hose Clamp, .812 - 1.500 110 2-00-00407 Flat Washer, 1/4 211 7-33-02197 Hose Ref.12* 7-33-02187 Hose Ref.12** 8-33-02214 Hose Ref.13* 8-33-02245 Hose Ref.13** 7-33-02202 Hose Ref.14 7-33-02244 Hose Ref.15 8-33-02184 Hose Ref.16 8-33-02200 Hose Ref.18 7-33-02180 Hose Ref.19 7-33-02186 Hose Ref.* Variable Dump Hopper Only**Manual Dump Hopper OnlyP-5087/97052-74 American-Lincoln7760

OIL COOLER & FITTINGSTO TEE FITTING ON TOP OF DRIVE PUMP167438943523TO VACUUM MOTORP4383b/0603KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04822 Fitting - Elbow 32 2-00-00641 Nut, 1/4 - 20 - Fiber Lock Hex 23 7-29-00192 Gasket, Oil Cooler 44 2-00-01980 Screw, 1/4 - 20 x 1.250 HHC 25 8-13-07088 Clip 26 7-33-02201 Hose Ref.7 7-33-02433 Hose Ref.8 8-62-01010 Oil Cooler 19 7-29-00207 Gasket 2P4383b/0603American-Lincoln 2-757760

AUXILIARY PUMP & FITTINGS (FORD)411 9TO RESERVOIR6TO PORT“P” ON MAINCONTROL VALVE735TO RELIEF VALVE INRECOVERY TANK LID25212TO PORT “P” ON POWERSTEERING UNIT8 10 6KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-05353 Fitting, 90° Elbow 12 2-00-04921 Fitting, 90° Elbow 23 7-60-05027 Auxiliary Pump 14 7-60-05026 Drive Pump Ref.5 2-00-04928 ORFS Run Tee, 13/16 - 16 16 2-00-04957 ORFS Cap, #8 ORS 17 8-33-02202 Hose Ref.8 2-00-04932 Fitting, Reducer 19 7-33-02331 Hose, 16ORS 46" Ref.10 2-00-04926 Fitting, 90° Elbow 111 7-33-02334 Hose, 52.25" Ref.12 8-33-02327 Hose, 94" Ref.P5163\96092-76 American-Lincoln7760

AUXILIARY PUMP & FITTINGS (DIESEL)941TO RESERVOIRTO RELIEF VALVE INRECOVERY TANK LID81031126512TO PORT “P”ON POWERSTEERING UNIT567TO PORT “P” ON MAINCONTROL VALVEKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-05353 Fitting, 90° Elbow 12 2-00-04921 Fitting, 90° Elbow 23 7-60-05027 Auxiliary Pump 14 7-60-05026 Drive Pump Ref.5 2-00-04928 ORFS Run Tee, 13/16 - 16 16 2-00-04957 ORFS Cap, #8 ORS 17 8-33-02202 Hose Ref.8 2-00-04932 Fitting, Reducer 19 7-33-02331 Hose, 16ORS 46" Ref.10 2-00-04926 Fitting, 90° Elbow 111 7-33-02334 Hose, 52.25" Ref.12 8-33-02195 Hose, 69.5” Ref.P5164\0206American-Lincoln 2-777760

BATTERY - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-90-07167 Wire, to Starter 12 0875-008 Battery (Gas & LP) 12 0875-057 Battery (Diesel) 13 8-21-04016 Edging 24 2-00-03569 Carriage Bolt, 5/16 - 18 x .750 35 7-19-08059 Battery Access Door 16 7-23-03113 Screw, #17 (.312) x 1.000 CAPT.SL. 17 7-23-03106 Retainer Washer, .265 x .625 x .025 28 2-00-03575 Carriage Bolt, ¼ - 20 x .750 19 7-13-07109 Battery Clamp 110 2-00-03702 Flat Washer, .625 x .281 x .062 111 2-00-00518 Lock Washer, Helical Spring ¼ Med. 112 2-00-00594 Nut, Hex ¼ - 20 x .437 x .218 11314 7-23-03108 Receptacle Bracket 115 7-23-00023 Hinge 116 2-00-00409 Flat Washer, .687 x .343 x .062 617 2-00-00530 Lock Washer, Helical Spring 5/16 Med. 618 2-00-00585 Nut, Hex 5/16 - 18 x .500 x .265 6192021 7-90-07262 Wire, to Ground (Ford 423) 122 2-00-00196 Screw, 5/16 - 18 x 1.000 Carriage 323 2-00-05253 Cable Clamp, .500 124 2-00-05171 Boot, Protective (Red) 125 2-00-05173 Boot, Protective (Black) 126 7-90-07280 Battery (+) Cable (Diesel Only) 1P-5086a/96112-78 American-Lincoln7760

BATTERY - EXPLODED VIEW18171623 1722GAS & LPTOSTARTERTOGROUND18171,24,2621,251621514331211109476582121110598DIESELENGINEP-5086a/9611American-Lincoln 2-797760

ENGINE COVER - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTYP-51521 7-16-07389 Engine Cover 12 2-95-04182 Nut, Hex 3/8-16 x .562 x .328 Fiber 143 2-00-02303 Lock Washer, 5/16 14 2-00-00410 Flat Washer, .875 x .375 x .062 285 2-00-01490 Screw, 1/4 - 20 x .875 HHC 46 2-00-00221 Screw, 1/4 - 20 x .750 HHC 27 2-00-04794 Screw, #10-24 x .625 HHC 28 8-41-00037 Engine Cover Latch 19 7-31-06062 Handle Cover Latch 110 7-31-06061 Cover Latch Grip 111 2-00-00426 Flat Washer, .500 x .218 x .062 212 2-00-00519 Lock Washer, Helical Spring #10 Med 213 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 214 7-81-00138 Center Support 115 2-00-00518 Lock Washer, Helical Spring 1/4 Med 616 2-00-00594 Nut, 1/4-20 x .437 x .218 417 2-00-03702 Flat Washer, .625 x .281 x .062 318 2-00-00233 Screw, 3/8-16 x 1.000 HHC 619 7-32-00022 Hinge 120 2-00-00209 Screw, 3/8-16 x 1.250 HHC 621 7-29-00157 Gasket 122 7-76-00106 Spring 123 8-32-09013 Horn 124 2-00-00585 Nut, Hex 5/16-18 x .500 x .265 325 2-00-00530 Lock Washer, Helical Spring 5/16 Med 326 2-00-00641 Nut, Hex Fiber Insert 1/4 - 20 227 7-78-05016 Engine Cover Stop 128 2-00-00409 Flat Washer, .687 x .343 x .062 329 2-00-01769 Screw, 1/4-20 x 1.75 HHC 230 2-00-01255 Screw, 5/16-18 x .88 HHC 131 7-55-08116 Striker Pin 232 7-08-00532 Engine Cover Bracket 133 8-08-07045 Edging 134 8-21-04038 Edging 12-80 American-Lincoln7760

ENGINE COVER - EXPLODED VIEW31283228252417155116335 6 7 8 9 10111213 142 3 415345173022329282127262515162423P5152ecp/1-04204 19 4 3 2 4 18312524American-Lincoln 2-817760

FUEL TANK (GAS & DIESEL) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-00221 Screw, 1/4-20 x .750 HHC 82 2-00-00518 Lock Washer, 1/4 Helical Spring 103 7-16-07280 Cover 14 7-08-00479 Bracket 25 8-26-04003 Float 16 2-00-04737 Screw, #10-32 x .44 (Self-Seal) 57 8-29-00131 Gasket 18 8-83-04029 Fuel Tank 19 7-13-07100 Bracket 210 2-00-03702 Flat Washer, 1.062 x .265 x .062 1011 2-00-04494 Fitting, 1/8” 90° Male Elbow Compression 112 7-87-02182 Fuel Line (Gas) 17-87-02160 Fuel Line (Diesel) 113 2-00-03878 Grommet, 1.125 x .625 x .437 x .187 (Gas Only) 114 7-11-00029 Fuel Cap 115 8-08-07050 Bumper, Fuel Line 216 2-00-04618 Fitting, Barbed Female 45° Swivel Hose (Gas Only) 117 8-56-05021 Fitting, Tank (Gas Only) 1REF Plug, Tank (Diesel-comes w/tank) 118 2-00-00594 Nut,1/4-20 Fin. Hex 219 2-00-003829 Star Washer 120 2-00-00512 Star Washer 1P4747ecpPP/6-042-82 American-Lincoln7760

FUEL TANK (GAS & DIESEL) - EXPLODED VIEW10218101210121012341617(Gas)620578(Diesel)Gas (only) return line(7-33-02619) runs downside of tank to hole inplate (see #13)91 2 109102 11914Gas (only)return line13(Gas only)P4747ecp-PP151211American-Lincoln 2-837760

FORD 425EFI GAS ENGINE (FAN, EXHAUST, HOSES) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-02049 Bracket, RF Engine Mount 12 8-75-01210 Spacer, Engine Mount 13 2-00-00505 Lock Washer, 7/16 HS Med. 134 2-00-05005 Screw, M10 x 1.5 x 30mm LG HHC 25 2-00-05328 Screw, M10 x 1.5 x 50mm LG HHC 56 7-08-02050 Bracket, LF Engine Mount 17 2-00-00409 Flat Washer, .687 x .344 x .062 18 2-00-02303 Lock Washer, 5/16 HS Med. 19 2-00-04366 M10 x 1.5 x 25mm HHC 610 2-00-04948 Screw, M8 x 1.25 x 25mm LG HHC 111 2-00-00221 Flat Washer, 1.00 x .39 x .06 412 2-00-04705 Bolt, 3/8-16 x 1.25 LG Fin. Hex Head 713 2-00-02310 Lock Washer, 3/8 Helical Spring 714 2-00-02360 Nut, 3/8-16 Hex 215 2-00-03829 Lock Washer, 3/8 Int/Ext Tooth 116 2-00-00402 Washer, 25/64 ID x 3/4 OD 117 2-00-00233 Bolt, 3/8-16 x 1.00 Fin. Hex Head 118* 7-87-02235 Tube, Exhaust 119* 7-11-04038 Catalytic Converter 120* 7-87-02228 Tube, Exhaust 121* 7-49-00042 Muffler 122 7-31-07033 Hanger, Muffler 2*7-31-07033 Hanger, Muffler 1~23 8-33-02371 Hose, Lower Radiator 124 8-33-02370 Hose, Upper Radiator 125 2-00-03404 Clamp 426 2-00-04040 Clamp, 1.25 Muffler 2*2-00-04040 Clamp, 1.25 Muffler 3~27* 7-56-05030 Tail Pipe 128< 7-75-01245 Spacer, Ford 425 Fan 129 7-23-00024 Fan, Ford 425 Breeza 130< REF Gasket, Exhaust Manifold 131 2-00-02599 Bolt, 3/8-16 x 2.25 LG 132* 2-00-05995 Clamp, 2.75” Muffler 233* 2-00-04400 Clamp 134 2-00-03569 Carriage Bolt 135 2-00-00518 Lock Washer, 1/4 Helical Spring 136 2-00-00594 Nut, 1/4-20 Hex 137~ 7-56-05031 Pipe, Exhaust 138~ 7-49-00031 Muffler 139~ 7-56-04055 Tail Pipe 140* 2-00-05149 Clamp, 1.75” Muffler 141 7-81-00276 Support, Front Engine 1*North American Models Only ~Export Models Only

FORD 425EFI GAS ENGINE (FAN, EXHAUST, HOSES)- EXPLODED VIEWC2185-1revE/6-04American-Lincoln 2-857760

FORD 425EFI GAS ENGINE (AIR INTAKE/FILTRATION) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-81-00273 Support, Engine 12 7-35-00017 Isolator, Engine Mount (Red Dot) 43 2-00-05067 Spacer, Snubbing Washer 84 7-08-01265 Bracket, Outboard Engine Mount 15 7-08-00918 Bracket, Inboard Engine Mount 16 7-75-01187 Spacer, Engine Mount 27 2-00-02312 Lock Washer, 1/2” 68 2-00-02689 Screw, 1/2-13 x 1.00 LG HHC 29 7-33-05098 Housing, Flywheel (Cast Iron) 110 0777-050 Ford 425 EFI Gas Engine Assy. 10777-056 Ford 425 EFI Gas Engine Assy. (Export Only) 111 7-16-05046 Coupling, Engine 112 7-08-01210 Bracket, Air Cleaner 113 2-00-02694 Screw, 1/2-20 x 2.00 LG HHC 214 2-00-02310 Lock Washer, 3/8 Helical Spring 915 2-00-04705 Bolt, 3/8-16 x 1.25 LG Fin. Hex Head 916 2-00-02698 Screw, 1/2-20 x 3.50 LG HHC 417 2-00-00640 Nut, 1/2-20 Fiber Insert 418 2-00-00221 Flat Washer, 1.00 x .39 x .06 219 2-00-02360 Nut, 3/8-16 Hex 220 7-81-00276 Support, Engine Front 121 7-33-02624 Hose, Intake 122 7-13-07231 Band, Air Cleaner Assy. 123 7-24-04083 Filter Assy., Air Cleaner 124 2-00-00409 Flat Washer, .687 x .344 x .062 225 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 226 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 227 7-33-02623 Hose, Air Intake 128 2-00-05004 Fitting, 1/8 NPT Nipple 129 7-24-04087 Filter Service Indicator (20” WC) 130 2-00-02216 Clamp, Hose 431 2-00-00505 Lock Washer, 7/16 HS Med. 232 2-00-04366 Screw, M10 x 1.5 x 25mm LG HHC 233 8-87-02110 Tube, Coupling 134 2-00-05955 Flat Washer, 1.25 ID x 2,0 OD x 1/4 835 7-21-04031 Edging, Brush Drive Support 4C2185-2revE/6-042-86 American-Lincoln7760

FORD 425EFI GAS ENGINE (AIR INTAKE/FILTRATION) - EXPLODED VIEWC2185-2revE/6-04American-Lincoln 2-877760

FORD 425EFI GAS ENGINE (FUEL SYSTEM) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-01201 Bracket, 7760 425EFI ECU 12* 7-11-04042 Fuel Computer 13 7-08-01211 Bracket, Injector Assy. 14* 7-08-01212 Bracket, Fuel Pump 15* 7-08-01213 Bracket, HP Fuel Filter 16* 7-60-05051 Pump, Fuel Injector 17* 7-63-05003 Filter, HP Fuel w/bypass 18* 2-00-05971 Clamp, 1/75” ID Cushioned Strap 19 2-00-00518 Lock Washer, 1/4 Helical Spring 710 2-00-00221 Bolt, 1/4-20 x 3/4 LG Fin. Hex Head 311* 7-24-04080 Filter, Fuel 112* 8-33-02407 Hose, HP Fuel 113 7-33-02619 Hose, Gas Fuel (40” long) 114 7-33-02625 Hose, Gas Fuel (25” long) 115 7-33-02626 Hose, Gas Fuel (20” long) 116 2-00-03589 Collar, Set Screw 217 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 218 2-00-00409 Flat Washer, .687 x .344 x .062 219 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 220 2-00-02587 Screw, 1/4-20 x 1.25 Hex Head Cap 321 2-00-03702 Washer, ,625 x .281 x .063 1122 2-00-00641 Nut, 1/4-20 Fiber Insert 923 2-00-01769 Screw, 1/4-20 x 1.75 HHC 424 8-08-07050 Bumper, Fuel Line 225 7-33-02641 Hose, 5/16” ID x 4” long Fuel 126 2-95-04388 Clamp, Hose 327 8-08-00927 Bracket, Relay Box 128 2-00-00220 Screw, 1/4-20 x .625 HHC 229 2-00-00594 Nut, 1/4-20 Hex 230 2-00-06113 Clamp, Hose 6*Comes w/Engine Assy.C2185revE/7-042-88 American-Lincoln7760

FORD 425EFI GAS ENGINE (FUEL SYSTEM) - EXPLODED VIEWC2185revEAmerican-Lincoln 2-897760

FORD 425EFI LP ENGINE (FAN, EXHAUST, HOSES) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-02049 Bracket, RF Engine Mount 12 8-75-01210 Spacer, Engine Mount 13 2-00-00505 Lock Washer, 7/16 HS Med. 134 2-00-05005 Screw, M10 x 1.5 x 30mm LG HHC 35 2-00-05328 Screw, M10 x 1.5 x 50mm LG HHC 56 7-08-02050 Bracket, LF Engine Mount 17 2-00-00409 Flat Washer, .687 x .344 x .062 18 2-00-02303 Lock Washer, 5/16 HS Med. 19 2-00-04366 M10 x 1.5 x 25mm HHC 510 2-00-04948 Screw, M8 x 1.25 x 25mm LG HHC 111 2-00-00221 Flat Washer, 1.00 x .39 x .06 412 2-00-04705 Bolt, 3/8-16 x 1.25 LG Fin. Hex Head 713 2-00-02310 Lock Washer, 3/8 Helical Spring 714 2-00-02360 Nut, 3/8-16 Hex 215 2-00-03829 Lock Washer, 3/8 Int/Ext Tooth 116 2-00-00402 Washer, 25/64 ID x 3/4 OD 117* 7-87-02235 Tube, Exhaust 118* 7-11-04038 Catalytic Converter 119* 7-87-02228 Tube, Exhaust 120* 7-49-00042 Muffler 121 7-31-07033 Hanger, Muffler 2*7-31-07033 Hanger, Muffler 1~22 8-33-02371 Hose, Lower Radiator 123 8-33-02370 Hose, Upper Radiator 124 2-00-03404 Clamp 425* 2-00-05149 Clamp, 1.75” Muffler 126 2-00-04040 Clamp, 1.25 Muffler 2*2-00-04040 Clamp, 1.25 Muffler 3~27* 7-56-05030 Tail Pipe 128< 7-75-01245 Spacer, Ford 425 Fan 129 7-23-00024 Fan, Ford 425 Breeza 130< REF Gasket, Exhaust Manifold 131 2-00-02599 Bolt, 3/8-16 x 2.25 LG 132* 2-00-05995 Clamp, 2.75” Muffler 233* 2-00-04400 Clamp 134 2-00-03569 Carriage Bolt 135 2-00-00518 Lock Washer, 1/4 Helical Spring 136 2-00-00594 Nut, 1/4-20 Hex 137~ 7-56-05031 Pipe, Exhaust 138~ 7-49-00031 Muffler 139~ 7-56-04055 Tail Pipe 140 2-00-05253 Clamp, 3/4” Double Wire 141 7-81-00276 Support, Front Engine 1*North American Models Only ~”EX” & “CE” Models Only

FORD 425EFI LP ENGINE (FAN, EXHAUST, HOSES) - EXPLODED VIEWC2184revEAmerican-Lincoln 2-917760

FORD 425EFI LP ENGINE (AIR INTAKE/FILTRATION) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-81-00273 Support, Engine 12 7-35-00017 Isolator, Engine Mount (Red Dot) 43 2-00-05067 Spacer, Snubbing Washer 84 7-08-01265 Bracket, Outboard Engine Mount 15 7-08-00918 Bracket, Inboard Engine Mount 16 7-75-01187 Spacer, Engine Mount 27 2-00-02312 Lock Washer, 1/2” 68 2-00-02689 Screw, 1/2-13 x 1.00 LG HHC 29 7-33-05098 Housing, Flywheel (Cast Iron) 110 0777-051 Ford 425 EFI LP Engine Assy. 10777-057 Ford 425 EFI LP Engine Assy. (CE & EX models only) 111 7-16-05046 Coupling, Engine 112 7-08-01210 Bracket, Air Cleaner 113 2-00-02694 Screw, 1/2-20 x 2.00 LG HHC 214 2-00-02310 Lock Washer, 3/8 Helical Spring 615 2-00-04705 Bolt, 3/8-16 x 1.25 LG Fin. Hex Head 516 2-00-02698 Screw, 1/2-20 x 3.50 LG HHC 417 2-00-00640 Nut, 1/2-20 Fiber Insert 418 2-00-04801 Flat Washer, .875 x .38 x .120 219 2-00-02360 Nut, 3/8-16 Hex 220 7-81-00276 Support, Engine Front 121 7-13-07231 Band, Air Cleaner Assy. 122 7-24-04083 Filter Assy., Air Cleaner 123 2-00-00409 Flat Washer, .687 x .344 x .062 224 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 225 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 226 7-33-02623 Hose, Air Intake 127 7-33-02633 Hose, Intake 128 2-00-00505 Lock Washer, 7/16 HS Med. 229 2-00-05005 Screw, M10 x 1.5 x 30mm LG HHC 230 2-00-02216 Clamp, Hose 431 8-87-02110 Tube, Coupling 132 2-00-05004 Fitting, 1/8 NPT Nipple 133 7-24-04087 Filter Service Indicator (20” WC) 134 2-00-05955 Flat Washer, 1.25 ID x 2,0 OD x 1/4 835 7-21-04031 Edging, Brush Drive Support 4C2184-1revE/8-042-92 American-Lincoln7760

FORD 425EFI LP ENGINE (AIR INTAKE/FILTRATION) - EXPLODED VIEWC2184-1revEAmerican-Lincoln 2-937760

FORD 425EFI LP ENGINE (FUEL SYSTEM-N. AMERICA) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1* 7-11-04044 LP Mixer 12 7-08-01201 Bracket, 425EFI ECU 13* 7-11-04047 EPM, Ford 425EFI ECU 14 7-08-01211 Bracket, Injector Assy. 15* 7-11-04045 Megajector 16 7-08-01239 Bracket, LP Regulator 17* 7-11-04043 LP Regulator 18 2-00-05674 Fitting, 1/4 NPT Hex Nipple, Brass 19* 7-88-00110 Valve, LP Safety 110 2-00-05972 Fitting, 3/8 NPT x 5/8 90° Hose 211* 2-00-06000 Fitting, 1/2 NPT x 3/4 Barb Str. 112 2-00-05678 Fitting, 1/4 NPT 90° Brass Street Elbow 113 2-00-05942 Fitting, 1/4 NPT x 1/8 NPT x 3/8 JIC Tee 114 8-82-00046 Switch, Oil Pressure 115 7-33-02620 Hose, 3/4” ID LP Low Pressure (15” long) 116 7-33-02621 Hose, 3/4” ID LP Low Pressure (38” long) 117* 7-33-02622 Hose, 1/4” ID Vapor (38” long) 118 7-33-02616 Hose, 5/8” ID Heater (53” long) 119* 7-33-02617 Hose, 5/8” ID Heater (48” long) 120 2-00-00518 Lock Washer, 1/4 Helical Spring 1121 2-00-00220 Screw, 1/4-20 x .625 HHC 1122 2-00-00641 Nut, 1/4-20 Fiber Insert 823 2-00-00409 Flat Washer, .687 x .344 x .062 224 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 225 2-00-03407 Clamp, Wittek #10P 826 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 227 2-00-01769 Screw, 1/4-20 x 1.75 HHC 428 2-00-03702 Washer, ,625 x .281 x .063 729 2-00-00221 Bolt, 1/4-20 x 3/4 lg Fin. Hex 130 2-00-03589 Collar, Set Screw 231 8-08-00927 Bracket, Relay Box 132 2-00-00594 Nut, 1/4-20 Hex 233 2-00-05363 Clamp, Hose 2C2184-2revE/8-04*Comes with Engine Assembly2-94 American-Lincoln7760

FORD 425EFI LP ENGINE (FUEL SYSTEM-N. AMERICA) - EXPLODED VIEWWIRING HARNESSFUSE BLOCKSEE LP TANK ASSEMBLYC2184-2revDAmerican-Lincoln 2-957760

FORD 425EFI LP ENGINE (FUEL SYSTEM-EX MODELS) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-01201 Bracket, 425EFI ECU 12 7-08-01211 Bracket,Injector Assy. 13 7-08-01239 Bracket, LP Regulator 14 2-00-05674 1/4 NPT Hex Nipple, Brass 15* 7-88-00110 Valve, LP Safety 16 2-00-05972 Fitting, 3/8 NPT x 5/8 90° Hose 27 2-00-06000 1/2 NPT x 3/4 Barb Str. 28 2-00-05678 Fitting, 1/4 NPT 90° Brass Street Elbow 19 2-00-05942 Fitting, 1/4 NPT x 1/8 NPT x 3/8 JIC Tee 110 8-82-00046 Switch, Oil Pressure 111 7-33-02616 Hose, 5/8” ID Heater (53” long) 112* 7-33-02617 Hose, 5/8” ID Heater (48” long) 113 2-00-00518 Lock Washer, 1/4 Helical Spring 714 2-00-00220 Screw, 1/4-20 x .625 HHC 715 2-00-00641 Nut, 1/4-20 Fiber Insert 816 2-00-00409 Flat Washer, .687 x .344 x .062 217 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 218 2-00-03407 Clamp, Wittek #10P 619 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 220 2-00-01769 Screw, 1/4-20 x 1.75 HHC 421 2-00-03702 Washer, ,625 x .281 x .063 722 2-00-00221 Bolt, 1/4-20 x 3/4 lg Fin. Hex 123 2-00-03589 Collar, Set Screw 224 7-33-02669 Hose, 3/4” ID LP Low Pressure (44” long) 125* 7-33-02670 Hose, 1/4” ID Vapor (44” long) 126* 7-11-04046 LP Regulator 127 8-08-00927 Bracket, Relay Box 128 2-00-00594 Nut, 1/4-20 Hex 229 2-00-05363 Clamp, Hose 230* 2-00-04787 Fitting, 1/8 NPT x 1/4 Hose Barb 90° Elbow 231* 7-11-04048 EPM, Ford 425EFI 132* 7-11-04053 LP Mixer 1C2184-4revE/8-04*Comes with Engine Assembly2-96 American-Lincoln7760

FORD 425EFI LP ENGINE (FUEL SYSTEM-EX MODELS) - EXPLODED VIEWWIRING HARNESSFUSE BLOCKC2184-4/7-04SEE LP TANK ASSEMBLYAmerican-Lincoln 2-977760

FORD 425EFI LP ENGINE (FUEL SYSTEM-CE MODELS) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-01201 Bracket, 425EFI ECU 12 7-08-01211 Bracket,Injector Assy. 13 7-08-01239 Bracket, LP Regulator 14 2-00-05674 Fitting, 1/4 NPT Hex Nipple, Brass 15* 7-88-00110 Valve, LP Safety 16 2-00-05972 Fitting, 3/8 NPT x 5/8 90° Hose 27 2-00-06000 1/2 NPT x 3/4 Barb Str. 28 2-00-05678 Fitting, 1/4 NPT 90° Brass Street Elbow 19 7-33-02616 Hose, 5/8” ID Heater (53” long) 110* 7-33-02617 Hose, 5/8” ID Heater (48” long) 111 2-00-00518 Lock Washer, 1/4 Helical Spring 712 2-00-00220 Screw, 1/4-20 x .625 HHC 713 2-00-00641 Nut, 1/4-20 Fiber Insert 814 2-00-00409 Flat Washer, .687 x .344 x .062 215 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 216 2-00-03407 Clamp, Wittek #10P 617 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 218 2-00-01769 Screw, 1/4-20 x 1.75 HHC 419 2-00-03702 Washer, ,625 x .281 x .063 720 2-00-00221 Bolt, 1/4-20 x 3/4 lg Fin. Hex 121 2-00-03589 Collar, Set Screw 222 7-33-02645 Hose, 3/8” ID Vapor (22” long) 123 7-33-02646 Hose, 3/4” ID LP Low Pressure (44” long) 124* 7-33-02647 Hose, 1/4” ID Vapor (44” long) 125* 7-11-04046 LP Regulator 126 7-88-00117 Valve Kit, LP Safety 127 8-08-00927 Bracket, Relay Box 128 2-00-00594 Nut, 1/4-20 Hex 229 2-00-05363 Clamp, Hose 230 2-00-04388 Clamp, Hose 231 2-00-06100 Fitting, 3/8Tube x 1/4 NPT Str., SS 132 2-00-06099 Fitting, 3/8 Tube x 1/4 NPT 90° Elbow, SS 133 7-87-02240 Tube, CE LP Fuel 134* 7-11-04048 EPM, Ford 425EFI 135* 7-11-04053 LP Mixer 136* 2-00-04787 Fitting, 1/8 NPT x 1/4 Hose Barb 90° Elbow 2C2184-2b-revE/8-04*Comes with Engine Assembly2-98 American-Lincoln7760

FORD 425EFI LP ENGINE (FUEL SYSTEM-CE MODELS) - EXPLODED VIEWWIRING HARNESSFUSE BLOCKC2184-2b-revESEE LP TANK ASSEMBLYAmerican-Lincoln 2-997760

LP FUEL TANK - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1~# N3-0042-1 Coupling 12~# N2-1106 Fitting, 1/4 NPT x 1/4 FM 45° 13~# N2-1105 Fitting, 1/4 NPT x 3/8 SAE 45, 45° 14~# 31” N8-3001 Hose, 5/16 ID x 31” long #6 UL 15~# N2-1107 Fitting, 1/4 NPT x 3/8 SAE 90° 26~# 20” N8-3001 Hose, 5/16 ID x 20” long #6 UL 17~ 2-00-06094 (N3-0038-1) Relief Valve 18~ 2-00-06093 (N3-0037-1) Fitting, Bulkhead 19 7-15-01038 Collar 210 7-43-05004 Lock 111 2-00-00220 Screw, 1/4-20 x .625 HHC 212 2-00-00518 Lock Washer, 1/4 Helical Spring 213# 8-83-04016 LP Tank 114 2-00-00233 3/8-16 x 1.00 LG 715 2-95-04182 Nut, 3/8-16 Fiber Insert 316 2-00-03702 Washer, ,625 x .281 x .063 217 7-50-05143 Pad 218 2-00-02708 5/16-18 x 1.00 LG 419 2-00-00585 Nut, 5/16-18 Hex 420 2-00-00530 Lock Washer, 5/16 421 2-00-00409 Flat Washer, .687 x .344 x .062 422 2-00-02310 Lock Washer, 3/8 Helical Spring 423# 7-11-04035 Light, Low LP Indicator 124#< REF Fitting25~* 2-00-05997 Fitting, 1/8 NPT x 3/8 Hose Barb 126* 2-00-05281 2” Plug 127* 8-56-05050 Fitting, 1/4 NPT x 3/8 SAE Straight 128 8-30-05171 Guard, LP Tank 1~Contained in LP Kit 7-11-04009

LP FUEL TANK - EXPLODED VIEWC2184-3revEAmerican-Lincoln 2-1017760

MITSUBISHI S4Q2 DIESEL ENGINE (FAN, EXHAUST, HOSES) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 0777-052 Engine Assy., Mitsubishi S4Q2 Diesel 12 7-31-07033 Hanger, Muffler 13 7-33-02615 Hose, Lower Radiator 14 2-00-03404 Clamp 65 8-33-02367 Hose, Upper Radiator 16 7-87-02239 Tube, Exhaust Downpipe 17 7-49-00031 Muffler 18 7-56-04055 Tailpipe 19 2-00-04040 Clamp, 1/4” Muffler 310 7-75-01248 Spacer, S4Q2 Engine Fan 111 7-23-00022 Fan, S4Q2 Engine 112 2-00-00530 Lock Washer, 5/16 1213 2-00-00183 Screw, 1/4-20 Round Head 114 2-00-00518 Lock Washer, 1/4” Helical Spring 115 2-00-00594 Nut, 1/4-20 Hex 116 2-00-05964 Nut, M8 x 1.25 417 2-00-05981 Screw, M8 x 1.25 x 55mm HHC 418 7-34-09016 Sleeve, Insulating 1C2186revD/5-042-102 American-Lincoln7760

MITSUBISHI S4Q2 DIESEL ENGINE (FAN, EXHAUST, HOSES) - EXPLODED VIEWC2186revD/6-04American-Lincoln 2-1037760

MITSUBISHI S4Q2 DIESEL ENGINE (SUPPORTS, THROTTLE) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-81-00273 Support, Engine 12 7-35-00017 Isolator, Engine Mount (Red Dot) 43 2-00-05067 Spacer, Snubbing Washer 84 7-08-01203 Bracket, Engine Rear 25 7-08-01205 Bracket, Engine Front 26 2-00-02310 Lock Washer, 3/8 Helical Spring 67 2-00-04705 Bolt, 3/8-16 x 1.25 LG Fin. Hex Head 68 2-00-02698 Screw, 1/2-20 x 3.50 LG HHC 49 2-00-00640 Nut, 1/2-20 Fiber Insert 410 2-00-04801 Flat Washer, 1.00 x .39 x .06 611 2-00-02312 Lock Washer, 1/2” 212 2-00-02360 Nut, 3/8-16 Hex 513 7-81-00276 Support, Engine Front 114 8-03-04321 Arm, Throttle 115 2-00-05043 Washer, 25/64 ID x 3/4 OD Plain 816 2-00-05957 Screw, M12 x 1.75 x 25mm HHC 817 2-00-05042 Lock Washer, M10 Helical Spring 1818 2-00-05958 Screw, M10 x 1.25 x 20mm HHC 619 7-16-05045 Coupling, Engine 120 2-00-05963 Screw, M8 x 1.25 x 15mm 8.8 Blox 821 7-33-05144 Casting, Pump Plate 122 2-00-05961 Screw, M10 x 1.25 x 30mm HHC 1223 7-08-01209 Bracket, Forward/Reverse Cable 124 8-90-07328 Wire, Ground to Frame 125 2-00-00232 Bolt, 3/8-16 Fin. Hex Head 126 2-00-03829 Lock Washer, 3/8 Int./Ext. Tooth 227 8-13-07094 Clamp, Conduit 128 2-00-04794 Screw, #10-24 x .63 BHS 229 2-00-00426 Flat Washer, .500 x .219 x .063 230 2-00-01246 Nut, #10-24 Elastic Stop 231 7-10-00024 Cable, Throttle (80”) 132 8-25-02036 Connector, Ball Joint 133 2-00-00626 Nut, 10-32 134 2-00-00633 Nut, 1/4-28 Fiber Insert 135 2-00-05528 Screw, M6 x1.0 x 12mm HHC 2C2186-1/1-042-104 American-Lincoln7760

MITSUBISHI S4Q2 DIESEL ENGINE (SUPPORTS, THROTTLE) - EXPLODED VIEW51735273332143429 3018415168192022242831231376101112931C2186-1/1-042212625American-Lincoln 2-1057760

MITS. S4Q2 DIESEL ENGINE (FUEL SYSTEM) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04801 Flat Washer, 1.00 x .39 x .06 22 8-08-00940 Bracket, Fuel Filter 13 7-24-04078 Filter, Diesel Fuel 14 2-00-04363 Screw, M8 x 1.25 x 20mm 25 2-00-00209 Bolt, 3/8-16 x 1.25 Hex Head 26 2-00-00402 Washer, 25/64 ID x 3/4 OD 27 2-95-04182 Nut, 3/8-16 Hex Stop 28 2-00-05261 Insert, 1/4-20 Threaded 29* 8-60-05028 Pump, Fuel 110 2-00-00518 Lock Washer, 1/4” Helical Spring 311 2-00-00221 Bolt, 1/4-20 x .75 Fin. Hex Head 212* 2-00-05973 Hose Barb, 1/8 NPT x 5/16 90° Elbow 113 8-33-02145 Hose, Fuel (22”) 114 2-95-04388 Clamp, Hose 615 2-00-03702 Flat Washer, .625 x .281 x .062 516 2-00-02587 Cap Screw, 1/4-20 x 1.25 Hex Head 117 2-00-00594 Nut, 1/4-20 Hex 118 8-08-00936 Bracket, Murphy 119 2-00-00641 Nut, 1/4-20 Fiber Insert 320 2-00-00512 Star Washer 221 7-64-00040 Relay, Glow Plug 122 2-00-00052 Screw, #10-24 x .38 RHMS 223 8-08-00939 Bracket, Murphy 124 2-00-00530 Lock Washer, 5/16 425 2-00-00503 Lock Washer, 1/4-20 226 7-64-00041 Relay, Murphy 127* 8-74-00012 Solenoid, Starter 128 8-33-02172 Hose, Fuel (15”) 129 8-08-07050 Bumper, Fuel Line 230 2-00-04873 Clamp, Cable 131 2-00-04602 Clamp 132 2-00-00501 Washer, 1/4 ID x .44 OD x .046 133 2-00-01490 Screw, 1/4-20 x .875 Hex Head 134 7-21-04051 Edging, Frame 235 2-00-05983 Fitting, 1/8 NPT x 5/16 Hose Barb 136 7-33-02641 Hose, 5/16 ID x 4” Fuel 137 2-00-03062 Screw, #10-24 x 5/8 238 2-00-01246 Nut, #10-24 Elastic Stop 2C2186-2revD/5-04*Comes with Engine Assembly2-106 American-Lincoln7760

MITS. S4Q2 DIESEL ENGINE (FUEL SYSTEM) - EXPLODED VIEWC2186-2revD/6-04American-Lincoln 2-1077760

MITS. S4Q2 DIESEL ENGINE (AIR INTAKE/FILTRATION) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-08-01206 Bracket, Air Cleaner 12 7-13-07231 Band, Air Cleaner Assy. 13 7-24-04083 Filter Assy., Air Cleaner 14 7-33-02613 Hose, Air Intake 15 2-00-05042 Lock Washer, M10 Helical Spring 46 2-00-05958 Screw, M10 x 1.25 x 20mm HHC 47 2-00-00409 Flat Washer, .687 x .344 x .062 28 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 29 2-00-00207 Screw, 5/16-18 x 1.25 Hex Head 210 2-00-02216 Clamp, Hose 111 2-00-02217 Clamp, Hose 112 2-00-05004 Fitting, 1/8 NPT Nipple 113 7-24-04087 Filter Service Indicator (20” WC) 1C2184-1/3-042-108 American-Lincoln7760

MITS. S4Q2 DIESEL ENGINE (AIR INTAKE/FILTRATION) - EXPLODED VIEWC2186-3/6-04American-Lincoln 2-1097760

RADIATOR - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-62-01008 Radiator 12 7-08-01237 Bracket, Radiator Mounting 23 8-50-05053 Isolator, Radiator Mount 44 2-00-03702 Washer, .625 x .281 x .063 95 2-00-00501 Washer, .25 ID x .44 OD x .046 46 2-00-00589 Nut, Hex Jam 1/4-20 x .437 x .156 47 2-00-05956 Plug, Radiator Outlet 18 2-00-02214 Clamp, Wittek-28P Hose 19 7-08-01238 Bracket, Radiator Mounting 110 2-00-00518 Lock Washer, 1/4 Helical Spring 511 2-00-00220 Screw, 1/4 - 20 x .625 HHC 112 7-07-02002 Overflow Bottle Assy. (1 liter) 113 2-00-00409 Flat Washer, .687 x .344 x ..062 414 2-00-00530 Lock Washer, 5/16 415 2-00-00208 Screw, 5/16-18 x .75 HHC 416 7-33-02342 Hose, Black, 1/4” ID x 18” long (Gas/LP) 17-33-02343 Hose, Black, 1/4” ID x 36” long (Diesel) 117 7-33-02344 Hose, Clear, 1/4” ID x 24” long 118 2-00-04873 Clamp, Cable 419 2-00-05985 Cap, 3/8 ID x 1 Inside Length (Rubber) 120 2-00-05363 Clamp, Hose 3P4607ecp/3-042-110 American-Lincoln7760

RADIATOR - EXPLODED VIEWP4607ecpAmerican-Lincoln 2-1117760

CE KIT - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 8-79-00030 Stactic Strap 12 8-41-05087 Latch 13 7-41-05099 Brake Lever (replaces 7-41-05083) 14 8-50-00016 CE Serial Number Plate 15 0780-377 Back-Up Alarm (see Chapt. 3) 16 8-31-06090 Latch Key (not shown) 27 2-00-00233 Screw, .375-16 x 1.00 HHC 18 2-00-02310 Lock Washer, Helical Spring 19 2-00-00402 Flat Washer, .750 x .391 x .093 210 2-00-03829 Lock Washer, Int./Ext. Tooth 111 2-00-02360 Nut, .38-16 Fin. Hex 112 2-00-01246 Insert, #10-24 Nylon 213 2-00-00426 Flat Washer, .500 x .219 x .063 214 2-00-03062 Screw, #10-24 x .63 THM 2P library-CE Kit/2-042-112 American-Lincoln7760

Broom ChamberCE KIT - EXPLODED VIEWFrame - Front Left Side.253.0 .2598.50 dia.11910712.931.8612 13 14.201 dia.(2 places)4Position holes where latch catches and holdson tank by as much as possible, but no less than 3/16”.Leave original engine cover latch in machine.35P library-CE Kit/2-04WHT(+)48American-Lincoln 2-1137760

STEERING & INSTRUMENT PANEL - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTYP-47171 8-11-00022 Steering Wheel Cap 12 7-89-08041 Steering Wheel 13 2-00-00232 Screw, 3/8 - 16 x .750 HHC 44 2-00-02310 Lock Washer, Helical Spring 3/8 Med 45 7-70-05135 Steering Column Assembly 16 7-33-05099 Steering Housing 17 2-00-04685 Screw, 1/4-20 x .750 SS 88 2-00-03059 Screw, #10 - 24 x .375 THM 69 7-16-07283 Panel Cover 110 7-60-05029 Steering Control Unit Pump 10880-675 Seal Kit 111 2-00-04688 Nut, Hex 1/4 - 20 Ss 1012 2-00-04687 Lock Washer, 1/4 SS 1013 2-00-04590 Sealing Washer, .63 x .250 814 2-00-04876 Screw, 1/4 - 20 x .500 BHS 415 7-52-00081 Circuit Breaker Panel 116 7-52-00080 Instrument Panel 117 7-52-00083 Blank Panel 118 7-33-05096 Console Housing 119 2-00-03702 Flat Washer 420 7-08-00510 Console Support Bracket 121 2-00-00219 Screw, .25-20 x .50 322 2-00-03466 Screw, #10-16 x .500 T/F RHM 142-114 American-Lincoln7760

STEERING & INSTRUMENT PANEL - EXPLODED VIEW12341014817 23 1656211922720221112718158131112139P-4717/9606American-Lincoln 2-1157760

DECALS - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1*< REF Patent/Patents Pending 12 8-18-00490 Bi-directional Pedal 13 8-18-00517 Front Instrument Panel 14 8-18-00516 Top Instrument Panel 15< REF Turn Off-Lock Wheel 16*< REF ATF/Dextron Fluid Only 17*< REF Fill Marker 18*< REF No Gasoline or Combustibles 19*< REF Do Not Use with Flammables 110 8-18-00521 Left Side Control Panel 111< REF Fire Hazard-Fuel Could Explode 112< REF Gasoline Only (Gas models) 1REF Diesel Fuel Only (Diesel models) 113< REF Surface Hot-Stay Clear 114 8-18-00500 Side Broom-Pull to Raise 115< REF Moving Belts-Stay Clear 116< REF Moving Fan Blade-Stay Clear 217*< REF Exhaust Warning 118< REF Pinch Point-Stay Clear 619< REF Cover/Hopper Could Close 220< REF No Step 321 8-18-00487 Blank Square-Option Covers 122 8-18-00527 Division of Alto 18-18-00549 American-Lincoln Technology (export only) 123 8-18-00526 American-Lincoln (large) 18-18-00528 Alto (export only) 124 8-18-00524 American-Lincoln (small) 28-18-00548 American-Lincoln Technology (export only) 125 8-18-00541 7760 18-18-00561 7760 (export only) 126 REF Serial Plate 127 2-00-04115 Rivet 228 8-50-05022 Pad (foot pedal) 329 7-50-05136 Pad (edge) 130 8-18-00552 Check Engine (Gas/LP only) 1

DECALS - EXPLODED VIEW26191825162427 11925151816313212412WITH COVER CLOSED78189184101452322183028220296P5169A/2-04171120American-Lincoln 2-1177760

INSTRUMENT PANEL CONNECTIONS (GAS/DIESEL) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-82-00026 Key Switch (K-SW) 12 8-82-00024 Horn, Push Button (H-PB) 13 8-64-00008 Circuit Breaker (15 AMP) 84 0795-186 Harness, Instrument Panel 15 8-48-00016 Voltmeter (VM) 16 8-48-05027 Gauge, Oil Pressure (OPG) 17 8-48-05023 Gauge, Hour Meter (HM) 18 8-48-05028 Gauge, Water Temperature (WTG) 19 7-40-05028 Light, Rec High - Solution Low 210 8-82-00044 Switch, Main & Side Broom (SPST On/Off) 211 7-82-00019 Switch, SPST On/Off (L) 212 7-82-00020 Switch, SPDT On/On 213 8-82-00045 Switch, Glow Plug (Diesel Only) 114 2-00-03062 Screw, #10 - 24 x .625 THM 115 2-00-00519 Washer, #10 Lock Med. Helical Spring 416 2-00-00605 Nut, #10 - 24 Hex. 617 8-90-07357 Wire, WTG to FG (Gas & Diesel Only) 218 8-48-05032 Gauge, Fuel (Gas & Diesel Only) 119 8-64-05009 Relay 120 8-64-00012 Relay 321 2-00-03063 Screw, #10 - 24 x .750 THM 322 2-00-00466 Flat Washer, .833 x .250 x .031 123 8-82-00045 Switch, Shaker Motor (SM-SW) 124 2-00-04757 Hole Plug 225 2-00-04942 Hole Plug (Light SW) 126 7-11-04035 Kit, Low LP Indicator Light (LP Only) 127 2-00-03061 Screw, #10-24 x .50 THM 228 0795-111 Harness, Circuit Breaker 129 7-52-00080 Weldment, Instrument Panel 130 7-52-00081 Panel, Circuit Breaker Mount 131 2-00-02330 Nut, #10 - 32 Hex. 432 2-00-00512 Washer, #10 Int. 533 8-08-00748 Bracket, Relay 1C1304ecp/2-042-118 American-Lincoln7760

INSTRUMENT PANEL - EXPLODED VIEW29325 631LP ONLY26 18GAS &DIESELONLYWTGSI8 177 273315161211SIDEBROOMSWITCH12MAINBROOMSWITCH12GVMIFG SGISQUEEGEEDECKSWITCH123BRUSHDECKSWITCH123REC. HIGHLIGHTSOL. LOWLIGHT9102322512SHAKERMOTORSWITCHK-SWH-P BGP-SW1 2OP GSGIHM-+321SCRUBROTATIONSWITCH321SCRUBPRESSURESWITCH321615141142DIESEL ONLY21221516R1R22013128NOTE: IF ALL OPTIONS ARE NOT ORDERED,PLUG ONE OF 8-11-00015 INTO EACHUNUSED WIRE.211516330CB -5 CB -4 CB -3 CB -2CB -120R4R31924CB -9 CB -8 CB -7CB -6C1303ecp/5-04American-Lincoln 2-1197760

MACHINE HARNESS WIRING (GAS/LP/DIESEL) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-82-00017 Float, Switch (Solution Low) Ref.2 7-82-00021 Float, Switch (Rec. High) Ref.3 0875-008 Battery (Gas/LP Only) Ref.0875-057 Battery (Diesel Only) Ref.4 8-09-01083 Bushing, Connector (Liquid Tight) 15 2-00-05171 Boot, Protective (Red) Ref.6 2-00-00232 Screw, 3/8-16 x .750 HHC Ref.7 8-32-09013 Horn Ref.8 7-90-07262 Cable, Battery (Negative) Ref.9 2-00-04952 Boot, Protective (Red) 110 2-00-04937 Tie, Cable 111 0795-187 Harness, Machine 112 2-00-03060 Screw, #10-24 x .250 THMS Ref.13 7-13-07096 Clamp, Adjustable 3314 8-90-07167 Cable, Battery (Positive) Ref.15 0880-705 Motor, Shaker Ref.16 8-09-01081 Bushing, Snap 117 2-00-05173 Boot, Protective (Black) Ref.18 8-90-07433 Wire Assembly, Hopper (HO - WA) 119 2-00-04551 Terminal, .156 Bullet 220 2-00-04602 Clamp 321 2-00-03061 Screw, #10-24 x .500 RHM Ref.22 2-00-04345 Ty-Rap 3023 2-00-00056 Screw, #10-24 x .750 THM Ref.24 2-00-00233 Screw, 3/8-16 x 1.00 HHC Ref.25 2-00-03829 Lock Washer, 3/8 Int./Ext. Ref.26 2-00-02360 Nut, 3/8-16 Hex Ref.27 2-00-00519 Lock Washer, #10 228 2-00-00460 Flat Washer, #10 Ref.29 0875-087 Diode Assembly 130 2-00-00183 Screw, 1/4 - 20 x .750 THM 331 2-00-00518 Lock Washer, 1/4 ID Helical Spring 532 2-00-00594 Nut, 1/4-20 Hex 433 8-09-01082 Bushing, Universal Ref.34 2-00-03878 Grommet 135 8-90-07328 Cable, Ground Ref.36 2-00-00498 Lock Washer, 1/4 Ext. 337 2-00-00605 Nut, #10-24 138 2-00-01974 Washer, #10 Sealing 139 0795-164 Harness, Hopper 140 2-00-00221 Screw, 1/4-20 x .75 HHC 141 2-00-03702 Flat Washer, .625 x .281 x .063 342 2-00-01490 Screw, 1/4-20 x .875 HHC 12-120 American-Lincoln7760

7760 HARNESS WIRING DIAGRAM (GAS/LP/DIESEL)437273810HIGHRECOVERYSWITCHFLOATRECOVERY TANK(BACK WALL)22210,23,27,37,38SOLUTIONLOW FLOATSEE INSTRUMENTPANEL2219SOLUTION TANKRECOVERY(INSIDE WALL) TANK42,41,terminal,36,frame,36,41,31,323 426 85 9 77356,25,2624,2511129D2NOTE:TAPE INDIVIDUALLYWHEN NOT USEDFUEL TANKCONNEC T TOENGINE BLOCK913 14 8 3 16 17 540,31,41-14-PIN Metripack GT connector,2-PIN Anderson Powerpole connector+CONNECT TO STARTE R “+”HORN32 31 22 20 3033Foot Pedal Prox. ConnectorsWires 12, 55, & 46 = ReverseWires 12, 56, & 46 = Forward3439231518SHAKERMOTORFROM INSTRUMENTPANEL HARNESSMILLIGHTTHROTTLE SW.EPMTO FORDENGINE HARNESSLP REGULATORDIESEL FUEL PUMPFORD F8JL-9A350AB -come s w/Engine Assy.GASOLINEFUEL PUMPto MITSUBISHIENGINE HARNESSNOTE: THESE (3) WIRES MUST EXITMAIN HARNESS IN THE MIDDLEOF THE OPENING FOR LIGHTOPTIONS FOR THE REST OFTHE HARNESS TO FITAMERICAN-LINCOLN 2-1217760

7760 ELECTRICAL SCHEMATIC (GAS/LP/DIESEL)12 VOLT BATTERYPM SHAKER MOTORMTRCB-1 SHAKER RELAY2 8 R1 278730CB-2 H-PBHORN289(+) (-)HMR25011IGNITIONTHROTTLE SW.A111111Throttle Sw.101BC11Not UsedDE(I)WATER TEMPERATURE SENDER(S)F33WT12(S)(G)(I)G32OP12CB-3R214 PIN ENGINEHARNESSCONNECTOROIL PRESSURE SENDER10CB-4HOUR METER POWERH2911121226G.P. SwJ GLOW PLUG SW. INPUT11CB-510START/ CRANK POWERK1010Not UsedL24LOW LPG SW SIGNALM51R12Not UsedNENGINE. FAULT LIGHT SIGNAL17P PR46R355R4564612 (I) (G)VM46(S) (GAS ONLY) 34(FGS)(G)12 (I)FG(85)35 SHAKER MOTOR RELAY46(86)R1HO-SW. HD-SW.(C) (NO) (C) (NO)CB-67DUST CONTROL SOL. (I)37CONTROL SW.OPTIONMAIN BROOM SOL. (2)SHAKER MOTOR SW.DUSTBY DOOR MAIN BROOM SW.13 57 1538HELD CLOSED HELD CLOSEDBY HOPPERSIDE BROOM SW. 39SIDE BROOM SOL. (5)SCRUB BRUSHES SW.SCRUB BRUSHES SOL. (6)43RAISE4358R4187SCRUB BRUSHES SOL. (8)421240CB-7PRESSURE SW.BRUSH46LOWER (ON)331418NORMAL ROTATION BRUSH SOL. (4)12REVERSE ROTATION BRUSH SOL.(3)3BRUSHROTATIONSW.46SCRUB BRUSH LOCK UP SOL. (9)18LOCK UP SOL. (10)SQUEEGEE18FAN MOTOR SOL. (12)SQUEEGEE30D230CB-8CYLINDER SOL.(7)SQUEEGEE25RAISE(TRANSVERSE)3SQUEEGEE SW.197LOWERREVERSE1948R3LOW LIGHTSOLUTIONSL-SWR2019HIGH LIGHTRECOVERYR41RH-SW4412BATTSTIGNACCK-SWCB-9TO L-SW #2TO OPTIONSTO L-SW #1AMERICAN-LINCOLN 2-1227760

7760 CONNECTION DIAGRAM (GAS/LP/DIESEL)SIDE BROOM SW MAIN BROOM SW1 39 38 12 15 15 2SHAKERMOTOR SW1 35 37 12 1515 23AOPTIONDUST CONTROL SW.QCB-WHR S6 7 13 16 19 21 2 4 5 8 9 10 11 12A B C D E F A B C D E F A B CA B C D E F A B C D E F A B C6 7 13 16 19 21 1 4 5 8 9 10 11 12BLANKBLANKINSTRUMENT LIGHTSARE OPTIONSVMG46Diode Assy0775-281I1248 2555 563025OPGS I4632 1224FGGS I4634 12For LPG lightrecrimp wire 12with 0.25” insulatedfem term.5112(+)(-)46HM50WTGS I4633 12SQUEEGEE DECK SW1231930SCRUBROTATION SWBRUSH DECK SW4058433 4646 32184021 14 42 1123SCRUBPRESSURE SW.1641REC. HIGHLIGHT16SOL. LOWLIGHT2046GSMIL LIGHT1711THROTTLE SW.113101 212 11 10 9 8CB-5 CB-4 CB-3 CB-2 CB-165 4 226 6 7 7CB-9 CB-8 CB-7 CB-621 19 18 13OPTION48244723GSRAFGS49 34 49GAS ONLYEECB-WHBACKUP ALARMRIGHT TAIL &BRAKE LIGHTRIGHT REARTURN SIGNAL30 R2 30 R3 30 R4 30OPTION85 85 85 8544L-SW.7 6861986 86 8622 23 2187A411187 87 87 87Z Y X W V UT2 B K-SW B AST 48585858546 135 46 55568686868624I46 29 464630 25 14 20 41 19 44 17 34 37 38 39 40 13 42 43 24 26 27 28 29 18 32 33 10 11 101 15 21 22875878787GRN3PLUG28 11527 50 485823 51 48 55 56 12630303030A B C D E F A B C D E F A B C D E F A B C D E F A B C D E FTOGETHER8 11 1918A B C D E F87A87A87A87AREDWIRES 44 &19GP-SW 1 2 43A B C D E F A B C D E F A B C D E F A B C D E F A B C D E FIF NOT RECYCLEA B C D E FH-PB2630 25 14 20 41 19 44 17 34 37 38 39 40 13 42 43 24 26 27 28 29 18 32 33 10 11 101BLUBRN15 21 22 23 51 48 55 56 12GS SOL. HIGH F REC-SW9YELSH-SW R11 4 INDICATORFLASHER29Reverse Forward42 5ESP-WHProx Prox8M-WHDETG. HIGH3 6 67OPTION7 135TURN SIGNALSBR-SWDL-SW46 1N N15 6 89 1023 A A4623B B46 46 4612 5622462 K91K1A B C D E F G2221A A A 139 43 4218 18 55SECTION B A A 146 C C12 47SECTION "A"464611 PLG 101PLGPLG 33322B25BBB224 D D2446 464C29 26BCE10PLG 51 PLG174LEFT FRONT 27 E E 2797DD22ATURN SIGNALB 1 B7BLANK F F BLANKM-WH78H J K L M N PA3BEE846GS2427LEFTLS-DMP 9 9 B A F F 9HEADLIGHT46HO-SW4REDEABLKREDHO-WANO C108PUMP A24RIGHTEngine HarnessBLK1341MTRHEADLIGHTHORN574046connections46 4614 38 37 46 44E4610 DETGE360°PUMPSM231928 4 3 2 1ARIGHT FRONT20TURN SIGNALGS30OPTION46HD-SW57BLKBLKC12NO 15WHTE2124R LEFT TAIL &BRAKE LIGHT VARI-DUMPONLYSL-SWRH-SW47ROTATINGFLASHING360°FLASHINGSTROBELPG FUEL CONTROLSLPG LOCKOUTSOLENOIDNegxxxxxxxx xLP REGULATORPN 0795-200Part of 425 EFIFuel Patch HarnessLOW PRESSURESWITCH(C)Negxxxxxxxx xx xx(NC)Mto FORD ENGINEHARNESSP/N 0895-13522OPTIONSAEMegejector14 Pin connectorLPG OnlyFord HarnessFord PN 1565000Part of 425 EFIEngine HarnessLEFTREARTURNSIGNALGas fuel pump5 NegPN 0795-200Part of 425EFIEngine HarnessBLKFord HarnessF8JL-9A350-ABIncluded withEngine AssyBLKWHTWHTDieselfuel pumpHPart of MitsubishiEngine HarnessIP-WHAMERICAN-LINCOLN 2-1237760

SEE CONN E CTIONNOTE (3)LPG FUEL LOCKOFF7760 FORD 425EFI FRAME SIDE CONNECTIONSFordEngine-SideHarnessNEG = GRNDPOS +12VCONNECTION DRAWING FORINTERFACE HARNESS P/N 0895-135To FOR D 12A581 HARNESSSEE CONNECTIONNOTE (2)Pin # 18SELF-TEST SWITCHGROUND ON ENGINESPST- ENGINE MOUNTEDCONNECTION NOTES(1) ENGINE RUN SIGNALFOR GASOLINE ENGINES:CONNECT SPADE FROM PIN H ON 14 PIN GT TO FUEL PATCHHARNESSCONNECT FUEL PATCH HARNESS 2-PIN PACKARD TO EWHFOR LPG ENGINE:CONNECT SPADE FROM PIN H ON 14 PIN GT TO FUEL PATCHHARNESSCONNECT FUEL PATCH HARNESS 2-PIN PACKARD TO FORDENGINE HARNESSCONNECTION TO BE MADE AT NCFI BASED ON FUELINGSEE CONNECTIONNOTE (1)NOTE: CONNECTION TO SOLENOIDMADE IN FORD ENGINE HARNESSPIN H - 14 PIN GTOIL PRESSURESENDERWATER TEMPSENDER(2) SELF-TEST INPUTFOR EXPORT ENGINES CONNECT TO PIN #3FOR 2004-COMPLIANT ENGINES CONNECT TO PIN #18(3) FUEL SELECT WIREFOR GASOLINE OPERATION, REMOVE FUEL SELECT WIRE FROMPIN #7FOR LPG OPERATION, REMOVE WIRE FROM PIN #5.REMOVE AND TAPE BACK AT NCFIStarterUSE 12 GAUGE FUSE LINK FROMFORD CONNECTOR KITPOS +12VLPG OPTIONLOW LPG PRESSURE SWITCHCUSTOMER SUPPLIEDABStarter SolenoidGROUND ON ENGINECDEFrame GroundFEngine GroundTOPAlternatorN49GHJK+ 12VUSE FORHOURMETERISSTARTER RELAYZB-014-0018 GAUGE WIRE -RED80 AMP MAXIFUSE AND HOLDER8 GAUGE WIRE - BLACKANDERSON POWER POLE CAT #992Anderson Power Pole 5915 Terminal.LOW FUEL LIGHT - LPGLMNP14 pin Metri-pack GTCONN: 15326922TERM: 1530473 (MALE SPADE)SEAL: 12191234PLUG: 12010300AMERICAN-LINCOLN 2-1247760

7760 S4Q2 DIESEL FRAME SIDE CONNECTIONSGLOW PLUG RELAYMM431-2820124MB084-014 CONNECTOR ASSY.CONNECTION DRAWING forINTERFACE HARNESS P/N 0895-134MITSUBISHI S4Q2 DIESEL(2) M5800-516 CONN. ASSY.1312 GA FUSE LINKAlternatorNAMB084-014 CONN. ASSYGLOW PLUGS14 pin Metri-Pack GTCONN: 15326922TERM: 15304731 (MALE SPADE)SEAL: 12191234PLUG: 12010300STARTER RELAYZB-014-001ISStarterSolenoidFrame GroundStarterFuel PumpIgnition Power SignalWater Temp Sender OutputOil Pressure Sender OutputABCDEFGEngine GroundGROUND TOENGINE14 AMP BUSS FUSE (ON MURPHY)8 GA WIRE - RED80 AMP MAXI FUSE AND HOLDER‘Engine Running At Speed’ OutputDiesel Glow Plug SignalStart/ Crank Signal InputAlternator Light SignalNOTE:CLOSES TO GROUNDIF NOT CHARGINGHJKLMNPFOR HOUR METERENERGIZED TO RUNFUEL CONTROL SOLENOIDPULL COIL - REDP/N 31A900300Oil Pressure Sw8 GA WIRE - BLACKP/N MM432104 (ON BASE ENGINE)Water Temp SwANDERSON POWER POLE CAT #992Anderson Power Pole 5915 TerminalHOLD COIL - WHITEGROUND - BLACK30A87-00600 3PC CONN. ASSY.GROUND TOENGINEAMERICAN-LINCOLN 2-1257760

7760 HYDRAULIC SCHEMATIC (VARIABLE DUMP)A1.93CIR.BSIDE BROOMMOTORSIDEBROOMVALVECYLINDERCONTROLVALVEC3270 PSI4C2CSQUEEGEEDECKCYLINDERBINHOPPERCONTROLVALVEA2200PSI0. 159CIR.SQUEEGEEVACUUMMOTOROIL COOLERSCRUBDECKCYLINDERC1DOUTCLIF T CYLINDERBAPOWE R STEERINGCYLINDERP10.0Cir.10.0Cr i.DUMP CYLINDERRETURNBLOCKSCRUB BRUSHMOTORS4.50Cir.43T3.05Cir.UT SDCONTROLMOTOR21500PSIP TFILTER9.7 GPMW ET SWEEPBYPASSVALUE(OPTIONAL)04.5Cr. i1P1.75GPM2500PSIP4 882A/ 08032200RPM15.0 Cir. 1.24 Cir.1 . 20Cr. i8. 2 GPM1. 5 GPM1 . 02C ir.PMAIN CONTROLVALVE1TERARWHEELMOTORDRIVE & AUXILIARYPUMPRESERVOIRAMERICAN-LINCOLN 2-1267760

7760 HYDRAULIC SCHEMATIC (MANUAL DUMP)2T3 1TSIDEBROOMVALVE(OPTIONA L)A1.93CIR.B2200PSI0.154CIR.POWER STEERINGCYLINDER10.010.0 10.0CIR. CIR. CIR.LR3.05Cir.1500PSI4.5CIR.PT2500PSIP5113/08032200RPM1.24 CIR 1.02CIR1.02CIRAMERICAN-LINCOLN 2-1277760

TABLE OF CONTENTS - CHAPTER 3Overhead Guard Option .............................................................................................................................. 3-2Brush Options ............................................................................................................................................ 3-4Side Broom Option - Manual Dump ............................................................................................................ 3-6Broom Options ........................................................................................................................................... 3-8Back-up Alarm Option ................................................................................................................................ 3-9Lights Options ............................................................................................................................................ 3-10Turn Signal Option ..................................................................................................................................... 3-12Warning Lights (Standard) Option ............................................................................................................... 3-14Warning Lights with Overhead Guard Option .............................................................................................. 3-16Fire Extinguisher Option ............................................................................................................................. 3-18Protecto-Seal Gas Cap Option ................................................................................................................... 3-19Debris Basket Option ................................................................................................................................. 3-20Suspension Seat Option ............................................................................................................................ 3-21Seat Belt Option for Suspension Seat ........................................................................................................ 3-22Seat Belt Option for Standard Seat............................................................................................................. 3-23Detergent & Solution Tank, ESP Option ..................................................................................................... 3-24Recovery Tank & Detergent Pump, ESP Option ......................................................................................... 3-26Instrument Panel, ESP Option ................................................................................................................... 3-28Wiring, ESP Option .................................................................................................................................... 3-30Tire Options ............................................................................................................................................... 3-31Vacuum Wand Option ................................................................................................................................ 3-32Wet Sweep Bypass Option ........................................................................................................................ 3-34Cab Options ............................................................................................................................................... 3-36Spare Parts Kit, Gas/LP(Variable Dump) .................................................................................................... 3-52Spare Parts Kit, Diesel (Variable Dump) ..................................................................................................... 3-53Spare Parts Kit, Gas/LP (Manual Dump) .................................................................................................... 3-54Spare Parts Kit, Diesel (Manual Dump) ...................................................................................................... 3-55Engine Service Parts - Ford 425EFI Gas/LP ............................................................................................... 3-56Engine Service Parts - Mitsubishi S4Q2 Diesel .......................................................................................... 3-57American-Lincoln 3-17760

OVERHEAD GUARD OPTION - PARTS LISTOPTION NO. 0780-379KEY NO. PART NUMBER DESCRIPTION QTY1 7-30-05086 Guard ( Weldment ) 12 7-81-00120 Support ( Weldment ) 13 7-81-00121 Support-( Weldment ) 14 7-81-00188 Support-( Weldment ) Ref.5 2-00-00239 Screw, 1/2 - 13 x 1.000 HHC 126 2-00-02352 Nut, Hex 1/2 - 13 x .875 x .484 127 2-00-02312 Lock Washer, Helical Spring 1/2 Med 168 2-00-01444 Flat Washer, .750 x .520 x .062 169 2-00-00240 Screw, 1/2 - 13 x 1.250 HHC 4P-4621/97033-2 American-Lincoln7760

OVERHEAD GUARD OPTION - EXPLODED VIEW513978876258P4621A/970376American-Lincoln 3-37760

BRUSH OPTIONS - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTYDisc Brushes:1 7-08-03170-1 Nylon (Black) 31 7-08-03172-1 Polyprolene/Amerfil (.040) 31 7-08-03173-1 Straight Wire 31 7-08-03205-1 Super Grit (60/45/25) Brown 31 7-08-03262-1 Soft Nylon 3Sectional Brushes:3 0760-283 Brush Plate Attachments 34 2-00-04221 Pin, Spring 6Plastic Back:5 7-08-03207-1 Super Grit 185 7-08-03173-1 Straight Wire 185 7-08-03194-1 Nylon (Black) 185 7-08-03248-1 Soft Nylon 185 7-08-03196-1 Polyprolene/Amerfil (.040) 185 7-08-03197-1 Amergrit 186 2-00-02706 Screw, 1/4 - 20 x 1.000 HHM 67 2-00-00518 Washer, Helical Spring 1/4 Med 68 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 6Pad Driver Assembly: 0772-074Individual service pieces which can be ordered separately include:2 7-45-05026 Lug (2 required)9 7-70-00098 Center-Lok IIIP4195d3-4 American-Lincoln7760

BRUSH OPTIONS - EXPLODED VIEW1283745P4195d62Top View9American-Lincoln 3-57760

SIDE BROOM OPTION (MANUAL DUMP) - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04210 Clamp 22 2-00-00049 Screw, #10-24 x .500 23 2-00-00512 Lock Washer, #10 24 2-00-00605 Nut, Hex #10-24 25 8-21-04030 Edging 16 7-10-00029 Cable 17 2-00-00585 Nut, Hex 5/16-18 118 2-00-00530 Lock Washer, Helical Spring 5/16 119 7-08-00705 Cable Bracket 110 8-15-01003 Collar, 3/4 ID w/setscrew 111 7-09-01134 Bushing, 3/8-16 Thd. 112 7-79-00060 Lift Cable Strap 113 7-08-00841 Bracket Side Broom 114 2-00-00409 Flat Washer, 5/16 515 7-03-04154 Side Broom Arm 116 7-08-00859 Side Broom Bracket 117 2-00-03029 Screw, 5/16-18 x 1.00 HSFHC 318 0885-061 Hydraulic Broom Drive Motor, w/Key 119 7-25-06038 Adapter Flange 120 8-08-03107 Side Broom 121 2-00-00447 Flat Washer 1.25 x .25 122 2-00-00518 Lock Washer, 1/4 423 2-00-03537 Screw, 1/4-28 x 2.000 HHC 124 2-00-03564 Screw, 5/16-18 x 1.000 525 2-00-02310 Lock Washer, Helical Spring 3/8 126 2-00-00232 Screw, 3/8-16 x .75- HHC 127 7-18-00215 Side Broom Label 128 8-82-00044 Switch 129 2-00-04918 Fitting 230 8-33-02216 Hose, ORS-4-Str. Ends 231 2-00-04895 Fitting 232 2-00-00218 Screw, 5/16-18 x 2.00 HHC 333 2-00-05350 Screw, 1/4-28 x .625 HHC 3C-0360/96093-6 American-Lincoln7760

SIDE BROOM OPTION (MANUAL DUMP) - EXPLODED VIEW727286891029113121BA34512781317141516AB2225CONTROLBLOCK30C0360/9609141918243287202122237814American-Lincoln 3-77760

BROOM OPTIONS2P4195a1KEY NO. PART NUMBER DESCRIPTION QTY1 8-08-03180 Proex and Wire 11 8-08-03190 Proex 11 8-08-03191 Natural Fiber and Wire 11 8-08-03193 Nylon 11 8-08-03200 Poypro Prolene 11 8-08-03196 Nylon, High Density 11 8-08-03198 Fiber and Wire, High Density 12 8-08-03107 Poly Prolene 12 8-08-03177 Nylon 1P-4195a/96093-8 American-Lincoln7760

1BACK-UP ALARM2WHT(+)48345687OPTION NO. 0780-377KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-04578 Male Bullet Plug 12 2-00-00221 Screw, 1/4 - 20 x .750 HHC 23 2-00-00501 Lock Washer, 1/4 Int. 14 2-00-00828 Terminal 15 8-32-09009 Backup Alarm 16 2-00-00409 Flat Washer, .687 x .343 x .062 27 2-00-00518 Lock Washer, Helical Spring 1/4 Int. 28 2-00-00594 Nut, Hex 1/4 - 20 2P4899ecp/2-04American-Lincoln 3-97760

LIGHTS OPTION - PARTS LISTHEADLIGHTS/TAILLIGHTS/INSTRUMENT LIGHTS: 0880-351HEADLIGHTS/TAILLIGHTS/BRAKE LIGHTS/INSTRUMENT LIGHTS: 0880-354KEY NO. PART NUMBER DESCRIPTION QTY1 8-08-00871 Light Bracket with Knockouts 42 8-08-00872 Backing Plate 43 2-00-00501 Lock Washer, 1/4 Int. 324 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 165 8-40-05028 Headlight 26 2-00-04578 Male Bullet Plug 47 8-90-07358 Ground Wire 48 8-40-05030 Instrument Light and Lead 49 2-00-04588 Wire Nut 110 8-82-00027 Light Switch, Push/Pull 111 8-40-05029 Taillight 212 7-90-07229 Wire 113 2-00-00409 Flat Washer, .687 x .343 x .062 214 2-00-04876 Screw, 1/4 - 20 x .500 BHS 1615 8-28-05011 Fuse, FU-1 15 Amp 1P-4822/96093-10 American-Lincoln7760

LIGHTS OPTION - EXPLODED VIEWPANEL15HARNESS1431116210126REARLIGHT SWITCH71334437FRONT26VMFGWT5OPHM113314P4822/9609924AMAINHARNESS8American-Lincoln 3-117760

TURN SIGNAL OPTION - PARTS LISTHEADLIGHTS/TAILLIGHTS/INSTRUMENT LIGHTS/BRAKE LIGHTS & TURN SIGNALS: 0880-389KEY NO. PART NUMBER DESCRIPTION QTY1 REF W/D, Light Bracket 22 7-08-01173 Bracket, Rear Light 23 7-40-05046 Head Light, 12VDC/55W 24 7-08-01174 Bracket, Head Light Mount 25 7-40-05047 Light, Red Tail/Brake/Turn 26 2-00-00049 Screw, 10-24 x .50 RHM 207 2-00-01246 Nut, #10-24 Elastic Stop 208 8-40-05048 Light, Amber Side Marker 49 8-40-05030 Instrument Light and Lead 410 2-00-04588 Wire Nut 111 8-82-00027 Light Switch, Push/Pull 112 2-00-00501 Lock Washer, 1/4 Int. 1613 2-00-04876 Screw, 1/4 - 20 x .500 BHS 1614 2-00-04578 Bullet Plug (Male) 1115 8-90-07358 Ground Wire for Lights 816 7-90-07229 Wire 117 8-64-00008 Circuit Breaker (15 Amp) 118 8-11-00044 Boot 119 8-11-00015 Terminal 120 8-82-00039 Switch, Brake 121 2-00-00519 Lock Washer, #10-24 222 2-00-00605 Nut, Hex MS 1/4 - 20 x .437 x .187 223 2-00-00006 Screw, #10-24 Hex 224 2-00-00512 Lock Washer, #10 Int. 225 2-00-00455 Flat Washer # 10 226 2-00-01994 Screw, # 8-15 x .75 Sht. Mtl. 127 2-00-01128 Terminal, Butt Splice 228 8-82-00025 Turn Signal Switch 129 2-14-03197 Rubber Washer, 1.000 x .187 x .125 130 2-00-05261 Insert 1631 0775-294 Resistor Assy. 2P4823tiff/2-043-12 American-Lincoln7760

TURN SIGNAL OPTION - EXPLODED VIEWCB5BACKSIDE OFCIRCUIT BREAKER PANEL18HOLE PLUGGED17TO BE USED IF MATINGCONNECTOR IS NOT OFTHE MOLDED TYPE 1928BUTTSPLICE23 2221ACB96B6A14FUSEHOLDERFLASHER2629FROM CB821 -FROM HARNESS13 123424 2327MOUNT ON LEFT SIDEOF STEERING COLUMN21 2218242320BRAKE ARM254721A21B2224AUSE RED WIRE FROMTURN SIGNAL LIGHTBACKSIDE OFINSTRUMENTPANEL11241624A10TO KEY SWITCH(BATT. TERM.)HARN31303175623A47A24C12134824B24C4747A22AAmerican-Lincoln 3-137760

WARNING LIGHTS (STANDARD) - PARTS LISTROTATING LIGHTKEY NO. PART NUMBER DESCRIPTION QTY1 8-40-05033 Red 18-40-05041 Yellow 12 2-00-04578 Connector 13 2-00-00491 Grommet 14 2-00-00512 Lock Washer, #10 Int 2FLASHING LIGHTKEY NO. PART NUMBER DESCRIPTION QTY5 8-40-05033 Red 18-40-05041 Yellow 16 2-00-04578 Connector 17 2-00-00491 Grommet 18 2-00-00512 Lock Washer, #10 Int 29 2-00-04897 Screw, #10 - 24 x 1.250 THM 210 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 2STROBE LIGHTKEY NO. PART NUMBER DESCRIPTION QTY11 8-40-05033 Red 18-40-05041 Yellow 112 2-00-00838 Terminal 113 2-00-00491 Grommet 114 2-00-00512 Lock Washer, #10 Int 215 2-00-04578 Connector 116 2-00-04341 Grommet 117 2-00-03063 Screw, #10 - 24 x .750 THM 218 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 2LIGHT SUPPORTKEY NO. PART NUMBER DESCRIPTION QTY19 8-81-00145 Weldment 120 8-90-07362 Wire Assembly 121 2-00-00491 Grommet 1CIRCUIT BREAKERKEY NO. PART NUMBER DESCRIPTION QTY22 8-64-00008 Circuit Breaker (15AMP) 123 8-11-00044 Boot 124 8-11-00015 Terminal 1P-4902/96093-14 American-Lincoln7760

WARNING LIGHTS (STANDARD) - EXPLODED VIEW121932142095678101712232211131418241516P4902American-Lincoln 3-157760

WARNING LIGHT with OVERHEAD GUARD - PARTS LISTROTATING LIGHTKEY NO. PART NUMBER DESCRIPTION QTY1 8-40-05033 Red 18-40-05041 Amber 12 2-00-04578 Connector 13 2-00-00491 Grommet 14 2-00-00512 Lock Washer, #10 Int 2FLASHING LIGHTKEY NO. PART NUMBER DESCRIPTION QTY5 8-40-05033 Red 18-40-05041 Amber 16 2-00-04578 Connector 17 2-00-00491 Grommet 18 2-00-00512 Lock Washer, #10 Int 29 2-00-04897 Screw, #10 - 24 x 1.250 THM 210 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 2STROBE LIGHTKEY NO. PART NUMBER DESCRIPTION QTY11 8-40-05033 Red 18-40-05041 Amber 112 2-00-00838 Terminal 113 2-00-00491 Grommet 114 2-00-00512 Lock Washer, #10 Int 215 2-00-04578 Connector 116 2-00-00605 Nut, Hex MS #10 - 24 x .375 x .125 217 2-00-03063 Screw, #10 - 24 x .750 THM 2GUARD WIRE & SUPPORT ASSEMBLYKEY NO. PART NUMBER DESCRIPTION QTY18 8-58-05228 Light Support 119 2-00-00221 Screw, 1/4 - 20 x .750 HHC 420 8-90-07363 Wire Assembly 121 2-00-00491 Grommet 122 2-00-00518 Lock Washer, Helical Spring 1/4 Med 42324 2-00-03063 Screw, #10 - 24 x .750 THM 325 2-00-04209 Clamp 326 2-00-00426 Flat Washer, .500 x .218 x .062 327 2-00-00512 Lock Washer, #10 Int 328 2-00-00605 Nut, Hex MS #10 - 24 x.375 x .125 3CIRCUIT BREAKERKEY NO. PART NUMBER DESCRIPTION QTY29 8-64-00008 Circuit Breaker (15AMP) 130 8-11-00044 Boot 131 8-11-00015 Terminal 1P-4901/96093-16 American-Lincoln7760

WARNING LIGHTS with OVERHEAD GUARD - EXPLODED VIEW19122182252627 28324421249525 2627 282662172081017CB53029CB96B6A211511RED123113BLACK1416P4901/9511American-Lincoln 3-177760

FIRE EXTINGUISHERH252DRIVER’SCOMPARTMENT1H15P4872-3/9704KEY NO. PART NUMBER DESCRIPTION QTY1 8-83-04033 Fire Extinguisher 12 2-00-00221 Screw, 1/4 - 20 x .750 HHC 43 980657 Lock Washer, 1/4 Split 44 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 4P-4872-3/97043-18 American-Lincoln7760

1PROTECTO-SEAL GAS CAPP4875KEY NO. PART NUMBER DESCRIPTION QTY1 8-11-00024 Protecto-Seal Gas Cap 1P4875/3-04American-Lincoln 3-197760

DEBRIS BASKET71236DRILL .281 DIA HOLE - 2 PLACESUSE PUNCH MARKS FOR LOCATION45643C0354/9609KEY NO. PART NUMBER DESCRIPTION QTY1 7-06-00001 Debris Basket 12 7-27-07156 Debris Basket Frame 13 2-00-04685 Screw, 1/4-20 x .750 HHC 24 2-00-04590 Sealing Washer, 1/4 25 2-00-04686 Lock Washer, 1/4 26 2-00-04688 Nut, Hex 1/4-20 27 3-73-00024 Edging 3.75 ft.C-0354/96093-20 American-Lincoln7760

SUSPENSION SEATWEIGHT ADJUSTMENT LEVERBACKREST7ADJUSTMENT1FORWARD/BACKWARDADJUSTMENT LEVER234P50806KEY NO. PART NUMBER DESCRIPTION QTY1 8-69-00019 Seat without armrests 12 2-00-00225 Screw, 5/16-18 x 1.500 HHC 43 2-00-00409 Flat Washer, .687 x .343 x .062 44 8-71-00016 Shim Block 45 2-00-02322 Lock Washer 5/16 46 2-00-00644 Nut, 5/16-18 Lock 47 8-03-04320 Armrest Kit (Includes both Armrests) 1P-5080/96010780-109 Suspension Seat Option (Includes all the Above)American-Lincoln 3-217760

SEAT BELT OPTION FOR SUSPENSION SEAT0780-661/9-05KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-06037 Screw, 7/16-20 x .75 Shorthead 12 2-00-00415 Washer, .94 ID x .47 OD x .062 13 2-00-03334 Screw, 7/16-20 x .75 14 2-00-06038 Retractable Seatbelt 10780-661/9-053-22 American-Lincoln7760

SEAT BELT OPTION FOR STANDARD SEAT0780-443/11-01KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-05391 Retractable Seatbelt 12 7-70-08005 Drive Compartment Weldment REF3 2-00-04936 Nut, 1/2-13 Fiber Insert 24 2-00-00239 Screw, 1/2-13 x 1.0 HHC 20780-443/11-01American-Lincoln 3-237760

DETERGENT & SOLUTION TANK, ESP OPTION - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-13-07084 Hose Clamp 102 2-74-00001 Fitting 33 2-00-05022 Fitting, Tee 1/4 NPT 14 7-82-00017 Float 25 2-00-04628 Fitting, Nipple 1/4 NPT to 3/8 NPT 16 2-00-05020 Sealing Washer 17 2-00-05018 Nut 18 2-00-05014 O-Ring Seal 49 2-00-05015 Sealing Washer 410 2-00-05239 Flat Washer, 2x1.063 x .125 SS 211 7-25-02038 Fitting, 90° Elbow, Pipe to Hose 112 2-00-03407 Clamp 413 7-33-02328 Hose, Pump to Solution Tank 114 2-00-04654 Fitting, 90° 215 7-87-02147 Detergent Feed Tube 18” 316 2-95-04268 Elbow, Street 3/4 NPT 217 2-00-04689 Flat Washer, .687 od X.260 id x .050 418 7-83-04162 Detergent Tank 119 7-25-02080 Fitting, Bulkhead (Detergent Float) 120 2-00-05346 Fitting, Bulkhead (Detergent Tank) 121 7-60--05025 Pump, ESP 122 2-00-04685 Screw, 1/4-20 x .750 HHC SS 423 7-81-00187 Detergent Tank Support 124 7-33-02329 Hose, Pump to Recovery Tank 125 2-00-04590 Sealing Washer, 1/4 x .063 426 2-00-04687 Lock Washer, 1/4 Med. HS SS 427 2-00-04688 Nut, Hex 1/4-20 x .437 x .218 SS 428 2-00-01246 Nut, #10-24 x 1.500 RHM 629 2-00-00089 Screw, #10-24 x 1.500 RHM 430 7-87-02129 Tube 131 2-00-05019 O-Ring Seal 132 2-00-05003 Fitting, Reducer 133 2-00-00641 Nut Fiber 134 2-00-04655 Fitting, 90º Elbow 135 2-00-03261 Grommet 136 2-00-05412 Fitting, Union-Reducer Connector 237 7-60-05031 Pump, Peristaltic Metering 138 2-00-05056 Screw, #10-24 x 2.000 SCH 239 8-75-01207 Spacer 240 2-00-00426 Flatwasher, .50 OD x .219 ID x .063 641 2-00-00498 Washer, external Star 242 7-87-02130 Tube (Cut to 11.00) 143 2-00-04578 Terminal 145 2-00-00828 Terminal 146 3-61-00189 Wire, Black-16 AWG. 1’47 2-00-01490 Bolt 148 2-00-03702 Flatwasher 249 2-00-04751 Fitting, 90º Swivel Elbow 150 2-00-04608 Fitting, ¾ NPT Couping 151 2-95-02518 Fitting, ¾ NPT Close Nipple 152 2-00-04469 Fitting, 90º Elbow 153 7-24-04022 Solution Inlet Filter 154 2-00-04736 Fitting, ¾ NPT Connector 155 2-00-05035 Reducing 90º Elbow ¼ to 1/8 NPT 1P-5170/00073-24 American-Lincoln7760

DETERGENT & SOLUTION TANK, ESP OPTION - EXPLODED VIEW1824TOFLOAT41819H107H1082115H206TO DETERGENTPUMP COUPLING ATSOLUTION TANK11419H107H108H282122114DETERGENTTANKSOLUTION1 2 3TANK456108915221612248 9 12723FROM PUMP17201113TODETERGENTPUMP2 STRAINER151P5170-1/9704American-Lincoln 3-257760

RECOVERY TANK & DETERGENT PUMP, ESP OPTION - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-13-07084 Hose Clamp 62 2-00-05014 O-Ring Seal 23 2-00-05015 Sealing Washer 24 2-00-03407 Clamp 15 7-33-02328 Hose, Pump to Solution Tank 16 7-87-02147 Detergent Feed Tube 18” 17 2-95-04268 Elbow, Street 3/4 NPT 18 7-60-05025 Pump, ESP 19 7-33-02329 Hose, Pump to Recovery Tank 110 2-00-01246 Nut, #10-24 Hex 411 2-00-00089 Screw, #10-24 x 1.500 RHM 412 7-87-02129 Tube 113 2-00-04479 Terminal, 3-Way 114 2-00-04655 Fitting, 90° 115 2-00-03261 Grommet 116 2-00-04345 Ty-Rap 117 7-60-05031 Pump, Peristaltic Metering 118 2-00-02848 Screw, #10-32 x .500 RHM 319 2-00-00519 Lock Washer, #10 Med. HS 320 2-00-00426 Flat Washer 721 8-11-00015 Terminal, 1/4 Male Blade Covered 122 2-00-02296 Washer, #10 Star 123 2-00-01081 Screw, #8-32 x .500 RHPH 124 2-00-00506 Lock Washer, #8 Int. 225 2-00-00842 Terminal 126 0780-071 Tubing Connector Service Parts Kit Ref.28 0780-073 Bellows Module Service Parts Kit Ref.29 2-00-04751 Fitting, 90° Swivel Elbow 130 2-00-04608 Fitting, 3/4 NPT Coupling 131 2-95-02518 Fitting, 3/4 NPT Close Nipple 132 2-00-04469 Fitting, 90° Elbow 133 7-24-04022 Solution Inlet Filter 134 2-00-04736 Fitting, 3/4 NPT Connector 1P-5171/98093-26 American-Lincoln7760

RECOVERY TANK & DETERGENT PUMP, ESP OPTION - EXPLODED VIEWRECOVERYTANKMOVE EXISTING HWD.& CLAMP TO TOP HOLETO PUMP INLETCUT EXISTING SLEEVE IN1/2, (APPROX. 3.50")4293230318493310734 23TOSOLUTIONTANKTORECOVERYTANK5 4 8NOTE:USE PST PIPE SEALANT ON STEEL PIPECONNECTIONSUSE TEFLON TAPE ON PLASTIC CONNECTIONS20118REF. 7-08-00437CUT OFF EXISTING TERMINAL,RESTRIP & REPLACE WITH2-00-04626CAMELWIRINGHARNESS141158A1022 10TO SOLUTIONTANKTO SOLUTIONFEEDLINKAGE13RIGHT HAND SIDEMAIN BROOM CHAMBERP5171/970616TO SCRUB BRUSHES1820CUT OFF EXISTING TERMINAL,RESTRIP & REPLACE WITH#45 2-00-04281American-Lincoln 3-277760251719

INSTRUMENT PANEL, ESP OPTION - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTYC12311 0795-114 ESP Wiring Harness 12 7-52-00082 ESP Instrument Panel 13 7-82-00022 DPS ON/OFF Switch 14 7-90-07233 Wire Assembly, Gr. for Detergent Low & Solution High 15 7-40-05028 Light 26 7-39-00021 Knob 17 2-00-03059 Screw, #10-24 x .375 RHM 28 2-00-02296 Lock Washer, #10 Ext. 29 7-30-05057 Guard, Rheostat 110 2-00-00529 Lock Washer, Helical Spring #8 Med. 211 2-00-00602 Nut, Hex MS #8-32 x .375 x .125 212 7-18-00136 Decal, Detergent Flow 13-28 American-Lincoln7760

INSTRUMENT PANEL, ESP OPTION - EXPLODED VIEWEXISTING INSTRUMENTPANEL HARNESSINSTRUMENTPANELH191H190H124H19119B41A443561H1908K187H1242279546126131 4523 6354C1231-1/9704American-Lincoln 3-297760

WIRING, ESP OPTION - PARRTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 0795-114 ESP Wiring Harness, Section A 12 0795-114 ESP Wiring Harness, Section B 13 8-82-00036 LS - DMP Switch 14 2-00-04345 Wire Tie 95 2-00-04551 Terminal, .156 Male 26 2-00-03418 Terminal, .250 FISO Female 27 8-21-04019 Edging 18 2-00-03575 Carriage Bolt 29 2-00-00407 Flat Washer, .562 x .265 x .062 210 8-08-00532 Bracket 111 2-00-00426 Flat Washer, .500 x .218 x .062 212 2-00-00518 Lock Washer, Helical Spring 1/4 Med. 213 2-00-00594 Nut, Hex MS #10-24 x .375 x .125 214 2-00-00519 Lock Washer, HS #10 Med. 215 2-00-00605 Nut, Hex MS #10-24 x .375 x .125 216 2-00-04749 Radial Locking Spring Pin .125 x 1.375 117 2-00-03059 Screw, #10-24 x .375 THM 218 8-11-00015 Terminal, .250 FISO 219 2-00-04578 Terminal, .156 Male 1C1217/96093-30 American-Lincoln7760

WIRING, ESP OPTION - EXPLODED VIEWDETERGENTTANKRECOVERYTANKSOLUTIONTANKDL-SWEXISTING12 5SH-SWRH-SWESP HARNESSSECTION BESP HARNESSSECTION A5 GPMPUMPMACHINEWIRINGHARNESSH86BLKRED4611REMOVE EXISTINGTERMINALS82710H206H721LS-DMP3SOLUTIONCONTROLLINKAGE9INSTRUMENTPANELDETG.PUMPGNDC1217-1/9704H9H10H113H25American-Lincoln 3-317760

TIRE OPTIONSKEY NO. PART NUMBER DESCRIPTION QTYP45541 7-89-08071 Siped Rear Drive Tire 11 0780-098 Front Tire, Urethane 23-32 American-Lincoln7760

1, 2VACUUM WAND OPTION53476OPTION NO. 0780-382KEY NO. PART NUMBER DESCRIPTION QTY1 7-13-07097 Clip 102 2-00-04312 Screw, #10 - 24 x .625 T/C HH 103 7-03-00040 Adapter 14 634118 Clarke Hose 15 639804 Clarke 1 1/2" Wand Assembly 16 638828 14" Squeegee 17 7-18-00121 Decal, Warning 1P-4930/9601American-Lincoln 3-337760

WET SWEEP BYPASS OPTION - PARTS LISTKEY NO. PART NUMBER DESCRIPTION QTY1 7-88-00038 Solenoid Valve (N.O.) 12 2-00-04978 ORFS Run Tee, 3/4-16 to 13/16-16 13 8-08-00590 Bracket 14 2-00-04924 ORFS Run Tee, 3/4-16 to 13/16-16 15 2-00-01980 Screw, 1/4 - 20 x 2.500 HHC 26 8-33-02190 Hose (Gas) 16 7-33-02205 Hose (Diesel) 17 2-00-03702 Flat Washer, .625 x .281 x .062 18 2-00-00501 Lock Washer, 1/4 Int. 19 2-00-00518 Lock Washer, Helical Spring 1/4 Med 210 2-00-00594 Nut, Hex 1/4 - 20 x .437 x .218 211 7-15-01031 Spacer 212 2-00-05046 Fitting, 90° Elbow 113 7-33-02192 Hose Ref.14 8-33-02214 Hose Ref.15 7-82-00020 Switch 116 7-90-07228 Wire, Jumper 1P-4881/96013-34 American-Lincoln7760

WET SWEEP BYPASS OPTION - EXPLODED VIEWTO PRESSURE SIDE OFDUST CONTROL MOTOR109 81122131437 46H46IWIRINGHARNESS711435TO MAIN BROOMMOTORTO RETURN SIDE OFDUST CONTROL VALVETO NO. 2 PORT MAINCONTROL VALVE123715B321156SHAKERMOTORSWITCHDUSTCONTROLSWITCH16P4881/9809American-Lincoln 3-357760

SOFT CAB OPTION - PARTS LISTOPTION 0780-602**KEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07468 Cover, Front 12 8-52-00201 Panel, Overhead Guard Top Cover 13 8-90-01005 Window 14 0882-070 Motor, Windshield Wiper 15 2-00-00409 Flat Washer, .687 x .344 x .062 76 2-00-00228 Screw, 5/16-18 x 2.5 Hex 27 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 58 2-00-00518 Lock Washer, 1/4 Helical Spring 89 2-00-00220 Screw, 1/4-20 x .625 HHC 810 7-16-07488 Soft Cover - RH 111 7-16-07486 Soft Cover - Rear (for LP Engine) 112 7-16-07489 Soft Cover - LH 113 3-73-00082 Seal, Window 11 ft.14 8-03-04315 Arm, Wiper 115 8-06-03004 Blade, Wiper 116 7-16-07491 Soft Cover - Rear (for Gas Engine) 117 8-11-00044 Boot 118 8-64-00008 Circuit Breaker (15 amp) 119 2-00-03418 Terminal, .25 Fisco Female 320 3-61-00189 Wire, 16-gauge (Black) 4 ft.C2204/3-04**Must be assembled on Overhead Guard 0780-3793-36 American-Lincoln7760

SOFT CAB OPTION - EXPLODED VIEW1611298756133129141415810C2204/3-04201917 18American-Lincoln 3-377760

SOFT CAB OPTION - LP ENGINE ONLYLP ENGINE ONLYC2204-1/3-04OPTION 0780-602 (LP ONLY)KEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07469 Cover, LP Tank 12 7-32-00053 Hinge, 1.5 x 6 13 2-00-00049 Screw, 10-24 x 1/2 RHM 44 2-00-01246 Nut, #10-24 Elastic Stop 2C2204/3-043-38 American-Lincoln7760

SOFT CAB W/ PRESS. FAN OR HEATER OPTION - LP ENGINE ONLYLP ENGINE ONLYC2205/3-04OPTIONS 0780-603 & 0780-604 (LP ONLY)KEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07469 Cover, LP Tank 12 7-32-00053 Hinge, 1.5 x 6 13 2-00-00049 Screw, 10-24 x 1/2 RHM 44 2-00-01246 Nut, #10-24 Elastic Stop 25 7-16-07486 Soft Cap, Rear 1C2205/3-04American-Lincoln 3-397760

SOFT CAB w/PRESSURIZED FAN OPTION - PARTS LISTOPTION 0780-603**KEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07468 Cover, Front 12 8-52-00201 Panel, Overhead Guard Top Cover 13 8-90-01005 Window 14 0882-070 Motor, Windshield Wiper 15 2-00-00409 Flat Washer, .687 x .344 x .062 36 2-00-00228 Screw, 5/16-18 x 2.5 Hex 27 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 28 2-00-00518 Lock Washer, 1/4 Helical Spring 89 2-00-00220 Screw, 1/4-20 x .625 HHC 810 7-16-07488 Soft Cover - RH 111 7-16-07490 Soft Cover - LH 112 3-73-00082 Seal, Window 11 ft.13 7-16-07491 Soft Cover - Rear (for Gas Engine) 114 8-03-04315 Arm, Wiper 115 8-06-03004 Blade, Wiper 1C2205-1/3-04**Must be assembled on Overhead Guard 0780-3793-40 American-Lincoln7760

SOFT CAB w/PRESSURIZED FAN OPTION - EXPLODED VIEWC2205-1/3-04American-Lincoln 3-417760

SOFT CAB w/PRESSURIZED FAN OPTION (con’t) - PARTS LISTOPTION 0780-603KEY NO. PART NUMBER DESCRIPTION QTY1 8-52-00200 Panel, Heater Mounting 12 8-33-05139 Housing, Blower 13 8-24-04141 Filter 14 8-33-05140 Clamp, Filter 15 2-00-00221 Bolt, 1/4-20 x 3/4 Fin. Hex Head 126 2-00-00641 Nut, 1/4-20 Fiber Insert 87 2-00-00208 Screw, 5/16-18 x .75 HHC 38 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 39 8-23-00015 Blower Assembly 110 8-75-01205 Spacer, Blower Mounting 411 8-18-03025 Cover, Ajustable Louvered Vent 112 2-00-03042 Screw, 1/4-20 x 1.5 HSHC 413 2-00-00501 Flat Washer, .25 ID x .44 OD x .046 414 2-00-00594 Nut, 1/4-20 Hex 415 0882-055 Motor, Blower 116 3-73-00075 Seal 3 ft.C2205-2/3-043-42 American-Lincoln7760

SOFT CAB w/PRESSURIZED FAN OPTION (con’t) - EXPLODED VIEWC2205-2/3-04American-Lincoln 3-437760

SOFT CAB w/PRESSURIZED FAN OR HEATER/WIRING - PARTS LISTOPTIONS 0780-603 & 0780-604KEY NO. PART NUMBER DESCRIPTION QTY1 8-11-00044 Boot 12 8-64-00008 Circuit Breaker (15 amp) 13 2-00-03418 Terminal, .25 Fisco Female 34 3-61-00189 Wire, 16-gauge (Black) 6 ft.5 7-82-00011 Switch, 4-position Rotary 16 7-33-05096 Housing, Console REFC2205-3/3-043-44 American-Lincoln7760

SOFT CAB w/PRESSURIZED FAN OR HEATER/WIRING - EXPLODED VIEW321654C2205-3/3-04American-Lincoln 3-457760

SOFT CAB w/HEATER OPTION - PARTS LISTOPTION 0780-604**KEY NO. PART NUMBER DESCRIPTION QTY1 7-16-07468 Cover, Front 12 8-52-00201 Panel, Overhead Guard Top Cover 13 8-90-01005 Window 14 2-00-00409 Flat Washer, .687 x .344 x .062 35 2-00-00228 Screw, 5/16-18 x 2.5 Hex 26 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 17 2-00-00518 Lock Washer, 1/4 Helical Spring 88 2-00-00220 Screw, 1/4-20 x .625 HHC 89 7-16-07488 Soft Cover - RH 110 7-16-07490 Soft Cover - LH 111 3-73-00082 Seal, Window 11 ft.12 7-16-07491 Soft Cover - Rear (for Gas Engine) 1C2206/3-04**Must be assembled on Overhead Guard 0780-3793-46 American-Lincoln7760

SOFT CAB w/HEATER OPTION - EXPLODED VIEW1228764511310187C2206/3-049American-Lincoln 3-477760

SOFT CAB w/HEATER OPTION (con’t) - PARTS LISTOPTION 0780-604KEY NO. PART NUMBER DESCRIPTION QTY1 8-52-00200 Panel, Heater Mounting 12 8-33-05139 Housing, Blower 13 8-24-04141 Filter 14 8-33-05140 Clamp, Filter 15 2-00-00221 Bolt, 1/4-20 x 3/4 Fin. Hex Head 126 2-00-00641 Nut, 1/4-20 Fiber Insert 87 2-00-00208 Screw, 5/16-18 x .75 HHC 38 2-00-00644 Nut, 5/16-18 Fiber Insert Hex 39 8-23-00015 Blower Assembly 110 8-75-01205 Spacer, Blower Mounting 411 8-18-03025 Cover, Ajustable Louvered Vent 112 2-00-03042 Screw, 1/4-20 x 1.5 HSHC 413 2-00-00501 Flat Washer, .25 ID x .44 OD x .046 414 2-00-00594 Nut, 1/4-20 Hex 415 0882-055 Motor, Blower 116 3-73-00075 Seal 3 ft.17 8-08-00893 Baffle, Heater Air 118 8-62-01015 Heater Core 119 2-00-01994 Screw, #8-15 x 3/4 TF/PRH 420 2-00-03702 Washer, .625 x .281 x .063 221 2-00-03407 Clamp, Witteck #10P Hose 222 8-32-00052 Hinge (RH) 123 8-32-00053 Hinge (LH) 124 2-00-00426 Flat Washer, .50 x .219 x .063 425 2-00-01246 Nut, #10-24 Elastic Stop 826 2-00-00049 Screw, 10-24 x 1/2 RHM 427 8-33-05141 Door, Blower Housing 128 8-13-07094 Clamp, Conduit 229 2-00-00006 Screw, #10-24 x 5/8 FH 430 8-55-08135 Pivot Pin, Heater Door 131 8-33-05142 Handle, Blower Housing 132 8-21-04015 Edging 133 3-71-00125 Hose, 5/8 ID Heater 12 ft.C2206-1/3-043-48 American-Lincoln7760

SOFT CAB w/HEATER OPTION (con’t) - EXPLODED VIEWC2206-1/3-04American-Lincoln 3-497760

SOFT CAB w/HEATER OPTION (con’t) - GAS/LPFORD 425EFI LP ENGINEFORD 425EFI GAS ENGINEC2206-2/3-04OPTION 0780-604KEY NO. PART NUMBER DESCRIPTION QTY1 3-71-00125 Hose, 5/8 ID Heater 25 ft.2 8-88-00043 Valve, 3-way 13 2-00-05152 Fitting, 5/8 90° Elbow Barbed Hose 34 2-00-04497 Fitting, Branch Tee Male 15 7-25-02040 Fitting, 1/2 NPT x .62 Hose 16 2-00-03407 Clamp, Witteck #10P Hose 47 2-00-00426 Flat Washer, .50 x .219 x .063 38 2-00-00519 Lock Washer, #10-24 Helical Spring 29 2-00-03059 Screw, #10-24 x 3/8 THMS 2C2206-2/3-043-50 American-Lincoln7760

SOFT CAB w/HEATER OPTION (con’t) - DIESELC2206-3/3-04OPTION 0780-604KEY NO. PART NUMBER DESCRIPTION QTY1 2-00-05127 Fitting, 1/2 NPT x 3/8 ID Barbed Hose 22 2-95-04388 Clamp, Hose 23 3-71-00085 Hose, 3/8 ID x .62 OD 9 ft.C2206-3/3-04American-Lincoln 3-517760

SPARE PARTS - GAS/LP (VARIABLE DUMP) MACHINESOPTION NO. 0780-620KEY NO. PART NUMBER DESCRIPTION QTY.BROOM & HOPPER COMPONENTS7-25-08036 Flap, Broom Chamber Front 17-25-08032 Flap - Broom Chamber 17-25-08034 Flap - Broom Chamber Rear Sides 27-25-08033 Flap - Broom Door 27-29-00226 Gasket - Broom Door 17-25-08068 Flap - Hopper Lip 17-68-05019 Seal Outer Door 1SQUEEGEE COMPONENTS7-77-00107 Rubber Rear Squeegee Outer 17-77-00108 Rubber Side Squeegees 27-77-00105 Rubber Rear Squeegee Inner 1FILTERS7-24-04086* Engine Air Filter (Safety) 17-24-04085* Engine Air Filter (Main) 17-24-04032 Hydraulic Return Filter Element 17-24-04046 Hopper Panel Filter 1*Both filters should be changed at the same timeENGINE-RELATED COMPONENTSFord 425EFI Gas/LP Engine8-24-04156 Oil Filter 17-24-04080 Fuel Filter Element (tank) 12-00-05404 Belt, Alternator/Water Pump 13-52 American-Lincoln7760

SPARE PARTS - DIESEL (VARIABLE DUMP) MACHINEOPTION NO. 0780-621KEY NO. PART NUMBER DESCRIPTION QTY.BROOM & HOPPER COMPONENTS7-25-08036 Flap - Broom Chamber Front 17-25-08032 Flap - Broom Chamber 17-25-08034 Flap - Broom Chamber Rear Sides 27-25-08033 Flap - Broom Door 27-29-00226 Gasket - Broom Door 47-25-08068 Flap - Hooper Lip 17-68-05019 Seal - Outer Door 1SQUEEGEE COMPONENTS7-77-00107 Rubber Rear Squeegee Outer 17-77-00108 Rubber Side Squeegees 27-77-00105 Rubber Rear Squeegee Inner 1FILTERS7-24-04086* Engine Air Filter (Safety) 17-24-04085* Engine Air Filter (Main) 17-24-04032 Hydraulic Return Filter Element 17-24-04046 Hopper Panel Filter 1*Both filters should be changed at the same timeENGINE-RELATED COMPONENTSMitsubishi S4Q2 Diesel Engine7-24-04097 Oil Filter 17-24-04088 Fuel Filter Element 12-00-05968 Belt, Alternator/Fan 1American-Lincoln 3-537760

SPARE PARTS - GAS/LP (MANUAL DUMP) MACHINESOPTION NO. 0780-624PART NUMBER DESCRIPTION QTY.BROOM & HOPPER COMPONENTS7-25-08052 Flap, Broom Chamber Front 17-25-08051 Flap, Brrom Chamber Upper 17-25-08050 Flap, Hopper Lip 4SQUEEGEE COMPONENTS7-77-00107 Rubber Rear Squeegee Outer 17-77-00108 Rubber Side Squeegees 27-77-00105 Rubber Rear Squeegee Inner 1FILTERS7-24-04086 Engine Air Filter (Safety) 17-24-04085 Engine Air Filter (Main) 17-24-04032 Hydraulic Return Filter Element 1ENGINE-RELATED COMPONENTSFord 425EFI Engine8-24-04156 Oil Filter 17-24-04080 Fuel Filter Element (tank) 12-00-05404 Belt , Alternator/Water Pump 13-54 American-Lincoln7760

SPARE PARTS - DIESEL (MANUAL DUMP) MACHINESOPTION NO. 0780-625PART NUMBER DESCRIPTION QTY.BROOM & HOPPER COMPONENTS7-25-08052 Flap, Broom Chamber Front 17-25-08051 Flap, Broom Chamber Upper 17-25-08050 Flap, Hopper Lip 4REAR SQUEEGEE COMPONENTS7-77-00107 Rubber Rear Squeegee Outer 17-77-00108 Rubber Side Squeegees 27-77-00105 Rubber Rear Squeegee Inner 1FILTERS7-24-04086 Engine Air Filter (Safety) 17-24-04085 Engine Air Filter (Main) 17-24-04032 Hydraulic Return Filter Element 1ENGINE-RELATED COMPONENTSMitsubishi S4Q2 Diesel Engine7-24-04088 Fuel Filter Element 17-24-04097 Oil Filter 12-00-05968 Belt, Fan/Alternator 1American-Lincoln 3-557760

ENGINE SERVICE PARTS - FORD 425EFI GAS/LPPART NUMBER DESCRIPTION QTY7-88-00106 PCV Valve 18-24-04156 Oil Filter 18-14-07012 Coil Pack 17-75-03008 Spark Plug 47-90-08021 Spark Plug Wire Set 10775-290 New Starter 10875-109 Rebuilt Starter 10880-663 Water Pump 17-82-00054 Switch, Water Temperature (Ford Black) 18-69-00013 Sender, Water Temp (Am. Lin. Instrument Panel) 17-11-04067 Sensor, Water Temperature (Ford Gray) 12-00-05404 Belt, Water Pump/Alternator 17-84-08020 Thermostat 10775-289 Alternator 17-23-00024 Fan, Ford 425 Breeza 17-75-01245 Spacer, 425 Fan (Gas) 17-82-00053 Switch, Oil Pressure (Ford) 18-82-00046 Switch, Oil Pressure (Am. Lin. Instrument Panel) 18-69-00005 Oil Pressure Sender (Am. Lin. Instrument Panel) 17-11-04065 Light, Malfunction Indicator 17-11-04040 Fuel Rail (gas) 17-11-04039 Injector (gas) 47-11-04041 Throttle Body 17-11-04044 LP Mixer (N.Am. certified) 17-11-04072 LP Mixer (EXPORT) 17-11-04043 LP Regulator (N. Am. certified) 18-33-02377 Intake Hose 17-88-00110 LP Safety Valve 10895-135 Wiring Harness 17-63-05003 Filter, HP Fuel w/bypass 17-08-01213 Bracket, HP Fuel Filter 17-60-05051 Fuel Injection Pump 17-24-04080 Filter, Tank Fuel 17-11-04045 MegaJector (N. Am. certified) 17-11-04062 HEGO Sensor 17-11-04063 Sensor, Intake Air TemperatureChange 17-11-04064 MAP Sensor 17-11-04066 O 2Sensor 17-11-04038 Catalytic Converter 10769-033 EPM w/Calibration (N. Am. certified) 10769-034 EPM w/Calibration (EXPORT) 17-11-04075 Sensor, Crankshaft Position (CPS) 12-00-04515 Fitting, 1/4 NPT Street “T” 18-56-05026 Fitting, 1/4 NPT Street 45 12-00-06528 Bushing, 1/4-1/8 NPT 12-86-00393 Operator Handbook2-86-00415 Parts Catalog2-86-00208 Service Manual3-56 American-Lincoln7760

ENGINE SERVICE PARTS - MITSUBISHI S4Q2 DIESELPART NUMBER DESCRIPTION QTY0775-287 Alternator 17-23-00022 Fan, S4Q2 Engine 12-00-05968 Belt, Alternator/Fan 17-60-05048 Water Pump 17-29-00339 Gasket, Water Pump 17-24-04097 Oil Filter 17-75-03005 Glow Plug 47-64-00041 Relay, Glow Plug (installed on wire harness) 17-64-00040 Relay, Murphy (installed on wire harness) 10769-029 Injector 17-56-04071 Pipe, Cylinder #1 17-56-04072 Pipe, Cylinder #2 17-56-04073 Pipe, Cylinder #3 17-56-04074 Pipe, Cylinder #4 17-56-04079 Pipe, Fuel Leak-Off 17-29-00312 Gasket, Thermostat 17-84-08016 Thermostat 10775-285 Starter 17-29-00338 Gasket, Cylinder Head 17-24-04089 Element, Water Separator 17-24-04088 Element, Fuel Filter 17-82-00052 Switch, Water Temperature 17-82-00055 Switch, Oil Pressure (for Murphy Shutdown) 12-86-00385 Operator Handbook2-86-00386 Parts Catalog2-86-00406 Service ManualAmerican-Lincoln 3-577760

14600 21 st Avenue NorthPlymouth, MN 55447-3408www.americanlincoln.comPhone: 800-331-7692Fax: 877-877-2586©2006 American-Lincoln