05.04.2013 Views

Drug Disposition Overview - Pharmacology and at UCSD

Drug Disposition Overview - Pharmacology and at UCSD

Drug Disposition Overview - Pharmacology and at UCSD

SHOW MORE
SHOW LESS

You also want an ePaper? Increase the reach of your titles

YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.

BIOM/PHAR 255 Winter 2013 Halpert - Jan. 17, 2013<br />

Types of P450 Reactions<br />

1. Hydroxyl<strong>at</strong>ion of aliph<strong>at</strong>ic or arom<strong>at</strong>ic carbons<br />

2. Epoxid<strong>at</strong>ion of a double bond<br />

3. Hetero<strong>at</strong>om (S-, N-) oxygen<strong>at</strong>ion <strong>and</strong> N-hydroxyl<br />

4. Hetero<strong>at</strong>om (O-, S-, N-) dealkyl<strong>at</strong>ion<br />

5. Oxid<strong>at</strong>ive group transfer<br />

6. Cleavage of esters<br />

7. Dehydrogen<strong>at</strong>ion<br />

P450 oxid<strong>at</strong>ion reactions<br />

Epoxid<strong>at</strong>ion (arene oxide form<strong>at</strong>ion)<br />

benzo[a]pyrene<br />

N-, O- <strong>and</strong> S-dealkyl<strong>at</strong>ion<br />

O<br />

H3 C CH3 N<br />

CH3CH2 C C CH2CH CH3 methadone<br />

O<br />

benzo[a]pyrene-7,8-epoxide<br />

H3C H<br />

O N<br />

CH3 CH2 C C CH2CH CH3 +<br />

H C<br />

H<br />

O<br />

6 of 22<br />

P450 reactions: oxid<strong>at</strong>ion <strong>at</strong><br />

C<br />

aliph<strong>at</strong>ic hydroxyl<strong>at</strong>ion<br />

H 3 C<br />

CH 3CH 2<br />

O<br />

CH2 CH2 CH2 CH3 pentobarbital<br />

arom<strong>at</strong>ic hydroxyl<strong>at</strong>ion<br />

CH 3CH 2<br />

O<br />

phenobarbital<br />

N<br />

NH ONa<br />

O<br />

NH ONa<br />

O<br />

N<br />

HO<br />

H 3C<br />

CH 3 CH 2<br />

P450 nomencl<strong>at</strong>ure<br />

Based on sequence identity:<br />

O<br />

CH<br />

OH<br />

CH 3 CH 2<br />

CH 2<br />

N<br />

O<br />

CH2 CH3 NH ONa<br />

O<br />

NH ONa<br />

MELSVLLLLALLTGLLLLMARGHPKAYGHLPPGPRP…<br />

MEFSLLLLLAFLAGLLLLLFRGHPKAHGRLPPGPSP…<br />

Family: ≥ 40% sequence identity.<br />

for example: CYP1, CYP2<br />

Subfamily: 40% - 55% sequence identity.<br />

for example: CYP2A, CYP2B<br />

Within subfamily: ≥ 55% sequence identity.<br />

for example: CYP2B1, CYP2B4<br />

O<br />

N

Hooray! Your file is uploaded and ready to be published.

Saved successfully!

Ooh no, something went wrong!