2007 - pccsl

CONTENTSPART I: SINHALA SECTIONPress Complaints Commission of Sri Lanka Chairman’s message:Dispute Resolution Council Chairman’s message:Annual Review:Press self-regulation in Sri Lanka: A review – Annexure 1:Report of the Editors’ Guild Code of Practice Review Committee – Annexure 2:Code of Professional Practice:Rules and Complaints Procedure of the Press Complaints Commission of Sri Lanka:Complaint Form:PART II: TAMIL SECTIONPress Complaints Commission of Sri Lanka Chairman’s message:Dispute Resolution Council Chairman’s message:Annual Review:Press self-regulation in Sri Lanka: A review – Annexure 1:Report of the Editors’ Guild Code of Practice Review Committee – Annexure 2:Code of Professional Practice:Rules and Complaints Procedure of the Press Complaints Commission of Sri Lanka:Complaint Form:PART III: ENGLISH SECTIONPress Complaints Commission of Sri Lanka Chairman’s message:Dispute Resolution Council Chairman’s message:Annual Review:Press self-regulation in Sri Lanka: A review – Annexure 1:Report of the Editors’ Guild Code of Practice Review Committee – Annexure 2:1

Monthly Complaints summary:Code of Professional Practice:Rules and Complaints Procedure of the Press Complaints Commission of Sri Lanka:Complaint Form:Audited Accounts:2

Y%s ,xld mqj;am;a meñKs,s fldñiujd¾Isl jd¾;dj - 2007Y%s ,xld mqj;am;a meñKs,s fldñiu96"lsre< mdrfld

wOHCI uKav, iNdm;s;=udf.a mKsjqvhfurg uqøs; udOH iy fmdÿ ck;dj w;r .eg¨ iu:lrKh" ueÈy;alrKh fydafíreïlrKh i`oyd lghq;= lrk uKav,hla jk YS% ,xld mqj;am;a meñKs,s fldñiuisõjeks jir iïmQ¾K lrhs'fuu iafõÉPd iajhx kshduk fldñiu jir 25lg wêl ld,hla furg ls%hd;aul jQmqj;am;a uKav,hg úl,amhla f,i msysgqjkq ,enqjls' rch u.ska kï lrk ,omqoa.,hska f.ka iukaú; mqj;am;a uKav,h u.ska fndfyda úg mqj;am;aj,g tfrysjúksYaphka ,nd ÿka nj Tng u;l we;hs is;ñ' Ys% ,xld mqj;am;a meñKs,s fldñiuwo mqj;am;a l¾udka;h iy uyck;dj fjkqfjka w¾nqo úi`§fï uKav,hla f,ilghq;= lrk wdh;khls' ms

idudðlhka ùu i;=gqodhl lreKls' fuu i;ald¾hh Wfoid Tjqkaf.a mQ¾K iydh,efnk njo mejish hq;=h' tneúka YS% ,xld mqj;am;a meñKs,s fldñifïls%hdldÍ;ajh ms

wdrjq,a ksrdlrK uKav,fha iNdm;s;=udf.a mKsjqvh 2007meñKs,s úi|Su iy ydkslr oE flfrys mÍCIdldÍ fjñka fmdÿ Wkkaÿj okjk ,smsm

jd¾Isl úuiquye¢kaùuY%S ,xld mqj;am;a iudch" YS% ,xld l¾;D ixioh" ksoyia udOH jHdmdrh hk ixúOdk;s%;ajh iu. Y%S ,xld jD;a;Sh mqj;am;al,dfõ§ka f.a ix.uh" f,dal mqj;am;aixúOdkh" fmdÿ rdcH uKav,Sh mqj;am;a ix.uh" wka;¾cd;sl mqj;am;a wdh;kh"wdál,a 19 ixúOdkh iy ol=Kq wm%sldkq udOH wdh;kh wdÈfha o iyfhda.h we;sj1998 jif¾oS fld

.ekSug fya;=jk mßÈ fldñifï l%shdj,sfhka neyerj mdGlhka iDcqju l¾;Djrefj; ,sùu;a ish ms

fujr iudf,dapkhg ,lajk ld,h ;=< ^2007 ckjdß ui isg foieïn¾ ui olajd&Y%S ,xld mqj;am;a meñKs,s fldñiu fj; meñKs,s 125 la ,eî we;' tu meñKs,sm%udKh tu mqj;am;a m

iSudiys; tlai;a m%jD;a;s m;% iud.ug ^f,alayjqia iuQyhg& wh;a mqj;am;a - fâ,sksõia" oskñK" ikafâ Tíi¾j¾" is¿ñK" ;sklrkaúch mqj;am;a iud.ug wh;a mqj;am;a - ,xldoSm" brsod ,xldoSm" isrsl;Wmd,s mqj;am;a iud.ug wh;a mqj;am;a - Èjhsk"Èjhsk bßod ix.%yh"o whs,kaâ"ikafâ whs,kaâiqu;s mqj;am;a iud.ug wh;a mqj;am;a - Èkm;d ,laìu iy bßod ,laìurdjh mqj;am;a iud.ug wh;a mqj;am;a - rdjh,Sv¾ mqj;am;a iud.ug wh;a mqj;am;a - ikafâ ,Sv¾ mqj;am;udia óähd iskaäflaÜ iud.ug wh;a mqj;am;a - iqvfrda,s iy Wohkaßúr óähd fldamf¾Ika iud.ug wh;a mqj;am;a - o fkaIka,xld tlaiam%ia mqj;am;a iud.ug wh;a mqj;am;a - ùrflaiÍhqkhsgâ mqj;am;a iud.ug wh;a mqj;am;a - ;skl=r,a^3& fjk;a meñKs,smqj;am;aj, m

flfrys wjOdkh fhduq l< fyf;u l¾;D ixioh fj; jd¾;djla bÈßm;a lf

±kqj;a lsÍïY%S ,xld mqj;am;a meñKs,s fldñifï m%j¾Ok m%pdrl jHdmdrhY%S ,xld mqj;am;a meñKs,s fldñifï m%pdrl lghq;= i|yd wOHCI uKav,h fj;wkque;sh i|yd bÈßm;a l< jevms

ld¾huKav, idudðlhskaY%S ,xld mqj;am;a meñKs,s fldñifï m%:u m%Odk úOdhl ks,OdßKS ueKsla fukaäiauy;añh 2005 jif¾§;a WmfoaYl fukau isxy, meñKs,s ks,OdÍ tia'oïuq,a, uy;d2006 foieïn¾ udifha§;a b,a,d wiaùu fya;=fjka tu OQr mqrmamdvq úh' kj m%OdkúOdhl ks,Odßjrd f,i fiajhg tla jQ iql=ud¾ frdlajqâ iy isxy, meñKs,s ks,Odßjrhd jYfhka n|jd.;a lu,a ,shkwdrÉÑ iu. tu ld¾h uKav,h"Y%S ,xld mqj;am;ameñKs,s fldñiu 2007 jir i|yd ish mq¾K Yla;sh fhdoñka lghq;= lr we;s njfmkajd ;sfí'bx.%Sis meñKs,s ks,Odßksh f,i lghq;= l< laIdud rKjk Y%S ,xld mqj;am;awdh;kfha udOH ksoyi iy WmfoaYk wxYfha l

weuqKqu wxl - 01› ,xldfõ mqj;am;ays iajhx kshdukh iudf,dapkhlabhka î,aia ¡ 2007 fkdjeïn¾úOdhl uKav,fha ixËsma; újrKhuf.a Tlaf;dan¾ ixpdrfha uQ,sl wruqK jQfha › ,xld mqj;am;a meñ‚,s fldñifï jD;a;Shwdpdr O¾u moaO;sh ms wjia:djla" › ,xldj ;ju;a isák l,dmhg wysñjkjd we;'1' ye¢kaùu15

› ,xld mqj;am;a meñ‚,s fldñiu wjqreÿ y;rl ld,hla ;siafia mj;S' iajhx kshdukmd,kdh;k iïnkaOfhka mj;akd cd;Hka;r ;;a;ajh iuÕ ii|k úg › ,xldfõ tuwdh;kfha tlS meje;auu m%ido cklhehs lsj hq;=h' fï .Kfha we;eï ld¾h moaO;s tlafldaflfuka úhelS wfydais ù hhs" ke;fyd;a" wod< l%shdldÍkaf.a WodiSk;dj" fkdie,ls,a,"ÿ¾j, kdhl;ajh" wNHka;r wr.," wruqo,a W!k;dj fyda rdcH mSvkh¡fyda ta ish,af,autl;=j ksid udi lSmhla we;=

mqj;am;a l¾udka;fha wNHka;rfhys fukau ndysrjo Y%s ,xld mqj;am;a meñKs,s fldñiul=ula i|ydo hkak ms

moaO;sfhka neyer ,d we;ehs idudkH mqj;am;a l,dfõ§kg yefÕk nj;a ta iïnkaOfhkaTjqka oekqj;a lr ke;s nj fukau ta .ek Tjqkaf.a woyia úuid ke;s nj;a ksoyia udOHjHdmdrh yd ix.ïo m%ldY lrk fyhska .eg¨j jvd;a jHdl+, ù ;sfí' tmuKla fkdjwe;eï l¾;Djreka Tjqkaf.au wdpdr O¾u ud,dj fkdßiaiqï iy.;j fkdi,ld yßk njg;ath fkdi,ld yßk f,i Tjqka Tjqkaf.a ld¾h uKav, mjd Èß.kajk njg;a hf:dala;ixúOdk fpdaokd lrhs' m%lg fm!oa.,sl wfmaËdo m%n, wkaoñka foaYmd,kSlrKh jqKqfm!oa.,sl u; bÈßm;a lrk mqoa.,hkao ms

úh hq;=h hkqfjka yeÕSula mj;afka kï th iyuq,skau mrud¾:fhka neyerh' tfyhska tuu;h wffO¾hj;a l< hq;=h' fldñiu Yla;su;a" iajdëk fíreïlrefjls';jo" mqj;amf;aiajdNdúl i;=frla fkdj ñ;%YS,S úfõplfhls' úfYaI ks¾foaY i|yd —tã weuqKqu n,kak'3' mq¿,a fmdÿ ck;djg yd isú,a iudchg - mqj;am;a meñ‚,s fldñifï ld¾h uKav,idudðlhkaf.a m%Odk ld¾h Ndrhh thhs' ck;d úYajdih f.dvkefÕk mßÈ l%shd;aul ùui|yd Tjqyq keje; mqyqKqj ,eìh hq;af;dah' fmdÿ ck iïnkaO;d l%shdldß;ajh id¾:l úhyelafla ;uka ljqrekao ;uka yd mqj;am;a meñ‚,s fldñiu l< hq;af;a l=ulao hk j. tald¾h uKAv, idudðlfhda wjfndaO lr .kafka kï muKls' ks;r wikq ,nk m%Yak i|ydms

³ úYajdifhka hq;=j meñ‚,s bÈßm;a lsÍug yelsjk fia fmdÿ ck;d úYajdih Èkd .ekSums‚i Tjqka oekqj;a lsÍfï j¾;udk jevms

weuqKqu wxl - 02l¾;D ixiofha jD;a;Sh wdpdr O¾u iudf,dapk lñgqjd¾;djmiqìu2002$03 jirj,§ fyda Bg wdikak ld,hl§ › ,xld l¾;D ixio idudðlfhdazmqj;am;a l,dfõ§kaf.a wdpdr O¾u moaO;shZ hkqfjkao ye¢kajqKq jD;a;Sh wdpdr O¾uud,dj talÉPkaofhka iïu; l

weßhqï leß‚' jd¾;djla bÈßm;a lsÍug ;udg yelshdjla fkdue;snj úksiqreùruka;%S mqj;am;a meñ‚,s fldñiug oekaùh'wdpdr O¾u ud,dfjys hï m%;sfYdaOkhla wjYH kï tfia lsÍfï n,dfmdfrd;a;=jwe;sj" ks¾foaY wOHkh fldg ;uka fj; jd¾;djla bÈßm;a lrkq ms‚i l¾;Dixioho ta ld,h ;=

l,dfõ m%dfhda.sl;dj flfrys hï wjOdkhla oelafjk w;ru wm wmf.au Wiiam%ñ;sh mj;ajd .kafka kï" tjeks i|ykla ke;sju wmf.a wruqK imqrd .; yelsh'flfia fyda isxy, fmf

m%ldYlhka i|yd jk wdpdr O¾u moaO;shla iïnkaOfhka jßka jr biau;=jk m%Yakflfryso wdpdr O¾u lñgqfõ ie,ls,a, fhduq jQfõh' th mqj;am;a ix.ufhaie,ls,a,g Ndck úh hq;a;lah hkak lñgqfõ u;h úh' tjeks wdpdr O¾u moaO;shlwjYH;dj m%ldYlhkg oekqï§ug l¾;D ixiohg mq¿jkalu we;s w;r m%ldYlhl=yd l;=jrhl= w;r iïnkaO;dj wjYHfhkau ld¾ñl iïnkaO;djla jk fyhskatjeks ld¾ñl iïnkaO;djla fyda wka;¾ mqoa., iïnkaO;djla wdpdr O¾umoaO;shlska wdjrKh l< yels fkdfõh hk yeÕSu m%ldY úh' tlai;a rdcOdksfhawdpdr O¾u moaO;sh tjeks .súiqï.; ne£ïj,ska ksoyiaj l%shd;aul jk nj i|ykalruq' tjeks úêúOdkhla we;=

Y%S ,xld l¾;D ixiohjD;a;Sh m%;sm;a;s ud,dj uQ,dY%Y%S ,xld l¾;D ixioh úiska iïmdokh lrkq ,en Y%S ,xld mqj;am;a meñKs,s fldñiu úiska ms

6'2 wmrdO yd wmrdO kvq ms

2' l=uk ;;a;ajhla hgf;a jqjo fmdÿck iqn isoaêh wod< jk wjia:djl§ th h:d mßÈ bgq ù ;sfío hk j. meyeÈ,sj olajkiïmQ¾K úia;rhla bÈßm;a lrk f,i l;=jrhdf.ka yd$fyda mqj;am;a l,dfõÈhdf.ka$fõÈkshf.ka b,a,d isàfï whs;shmqj;am;a meñKs,s fldñiug ,efnkq we;'mß.Kl m%ldYkfuu jD;a;Sh m%;sm;a;s ud,dfõ úêúOdk mqj;amf;a wka;¾cd, m%ldYkj,go wod< jkq we;'iudf,dapkhY%S ,xld l¾;D ixiofha idudðlhkaf.ka$idudðldjkaf.ka yd ixioh úiska m;a lefrk tfy;a ixio idudðlfkdjkakkaf.kao iukaú; jD;a;Sh m%;sm;a;s lñgqjl Wmfoia we;sj" Y%S ,xld l¾;D ixioh fuu jD;a;Sh m%;sm;a;s ud,dfõ úêúOdkjßka jr iudf,dapkh l< hq;af;ah'my; ±lafjk ixúOdk fï wdpdr O¾u moaO;shg iyfhda.h ±laùh'mqj;am;a m%ldYlhkaf.a ix.uh" ksoyia udOH jHdmdrh" Y%S ,xld jD;a;Sh m;%zl,dfõ§kaf.a ix.uh" Y%S ,xld mqj;am;a wdh;kh" Y%S ,xldckudOH úoHd,h" Y%S ,xld uqia,sï udOH ixioh " udOH fiajl jD;a;Sh iñ;s iïfï,kh" Y%S ,xld øúv udOH ixúOdkh" ol=Kq wdishdkq ksoyia udOH ix.uh-^Y%S ,xld md¾Yajh&27

YS% ,xld mqj;am;a meñKs,s fldñiuYS% ,xld mqj;am;a meñKs,s fldñifï Í;s iy meñKs,s ld¾h mámdáh1' YS% ,xldj ;=< m%isoaO lrkq ,nk mqj;am;l fyda iÕrdjl m

fyda m

20'md¾Yaj lrejka wkHldrfhka tlÕ jQjfyd;a ñi fíreï lsßfï úksYaph iNdjúiska hï úfYaI ldrKhla u; iajlSh u;h m%ldY lsÍu msKsi úfYAI{fhl= m;al

31' ;SrKhl meyeÈ,sj fmfkk jerÈ .Kka ne,Sula fyda ,smslre fodaIhla fíreïlsÍfï uKav,h úiska ksjerÈ l< hq;=h'32' ;SrKh ,eî Èk ;syla ^30& we;=

Y%S ,xld mqj;am;a meñKs,s fldñifï m%ldYl jrhd43' iud.ug wod< ish¨ m%;sm;a;s ldrKd i|yd m%ldYljrhd YS% ,xld mqj;am;ameñKs,s fldñifï iNdm;s jrhd fyda uKav,h fjkqfjka l;d lsÍug n,h § we;suKav,fha lsishï idudðlfhl= fyda úh hq;=h'44' ,enqKq ish¨ meñKs,s i|yd iy iNdj úiska .kakd ,o ish¨ ;SrK i|ydm%ldYljrhd m%Odk ks,Odßhd úh hq;=h' tfia jQj o tfia lsÍu ¥ro¾Ys hehs is;kwjia:djl meñKs,s uKav,h iNdfõ iNdm;s jrhd úuish hq;= w;r ljr lreKlaksidj;a isÿfjñka mj;sk mÍlaIKhla iïnkaO úia;r fyda iNdj úiska lrk ,o hïfíreï lsÍfï ;SrK fyda ms

Y%S ,xld mqj;am;a meñKs,s fldñiumeñKs,s m;%sldj1 iïmQ¾K ku (- --------------------------------------------------------------------------2 ,smskh (- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3 ÿrl:k wxlh (- ---------------------cx.u ÿrl:k wxlh (- -----------------------4 *elaia mKsjqv wxlh (- -------------------úµHq;a ;eme,a ^B-fï,a& ,smskh(- ---------------5 mqj;am;$iÕrdj (- -------------------------------------------------------------------------6 m

,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOtUlhe;j mwpf;if – 2007,yq;if gj;jphpif Kiwg;ghl;L Mizf;FO,y : 96, fpUs tPjpnfhOk;G – 05njhiyNgrp (00 94 11) 5353635 : ngf;]; : (00 94 11) 5335500

jiythpd; nra;jp,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOTf;F 4 tUlq;fs;G+h;j;jpaile;Jtpl;ld. ,f;fhyg;gFjpf;Fs; ,e;j Mizf;FOthdJrkhjhdg;gLj;jy;> ey;ypzf;fk;> kj;jpa];jk; Mfpa topfspy; gj;jphpiffSf;Fk;nghJkf;fSf;Fk; ,ilapy; Vw;gLk; gpzf;FfSf;F jPh;Tfis toq;fptUfpd;wJ.gj;jphpiffSf;F vjpuhf epahaq;fis toq;ff;$ba mur mq;fpfhuj;Jldhdrl;lj;jhy; Vw;gLj;jg;gl;l 25 tUlq;fSf;F Nkyhf eilKiwapy; ,Ue;jgj;jphpifg; Nguitf;F khw;W ghpfhukhf Vw;gLj;jg;gl;Ls;s Rafl;Lg;ghl;LxOf;ff;Nfhitr; nraw;ghl;ilf; nfhz;l Mizf;FOthFk;.gj;jphpiffSf;Fk; nghJkf;fSf;Fk; ,ilapy; Vw;glf;$ba gpzf;FfSf;FRKfkhd jPh;itg; ngw;Wf; nfhs;tjw;fhf rptpy; r%fj;jth;fisAk; gj;jphpifj;JiwapdiuAk; cs;slf;fpajhd Kuz;ghl;Lj; jPH;Tf; FOitf; nfhz;lMizf;FO %yk; ,g;NghJ epahaj;ijg; ngw;Wf; nfhs;Sk; tha;g;GVw;gl;bUf;fpd;J. xOf;ff;Nfhit kPwy;fs; ,lk;gnWk;NghJ mJ njhlh;ghfKiwapl;L ,ytrkhfTk;> RahjPdkhdJk; JhpjkhdJkhd Kiwapy;epahaj;ij ,e;j Mizf;FO Clhf ngw;Wf;nfhs;s tha;g;Gvw;gLj;jg;gl;bUf;fpd;wJ.nghJkf;fSf;F ,it njhlh;ghf VjhtJ Njitfspd;NghJ cjTtjw;fhfMizf;FO mjd; mYtyfj;ij Vw;gLj;jp ,aq;fp tUtNjhLKiwg;ghl;Lf;Fhpa epahhkhd fhuzj;Jld; mjw;fhd gj;jphpif ntspaPl;bd;gpujpAld; Kiwg;ghL nra;tjd; %yk; ePq;fs; jPh;itg; ngw;Wf; nfhs;syhk;.,e;j Mizf;FOtpd; Fwpf;NfhshdJ ,e;ehl;by; nghWg;Gzh;Ts;sgj;jpifj;Jiwia Vw;gLj;jtJk; gj;jphpif Mrphpah; rq;fj;jpd;xOf;ff;Nfhitapd; Nehf;fk; gj;jphpifj; njhopy;j; Jiwapd; juj;ij Nky;epiyapy; NgZtJkhf mikfpd;wJ. ehL ,j;Jiwapy; Kd;Ndw;wkhdepiyia vjph;ghh;f;fpd;wJ.,e;j Ra fl;L;ghl;L xOf;fNfhit njhopy;El;gj;ij eilKiwgg;Lj;Jfpd;wmNj Neuk; ehk; gj;jphpiffSf;F ,jpy; ,ize;jpUf;f Ntz;lk; vd;wepge;jid tpjpf;fhtpl;lhYk; mNdfkhd gj;jphpiffs; ,jw;F KOikahdxj;Jiog;ig toq;fp tUtJ Fwpg;gplj;jf;fjhFk;. mj;NjhL ,t;tplak; jw;NghJ,g;gpuhe;jpaj;jpy; cs;s mNdfkhd ehLfspdJk; mtjhdj;ij Mrphpah;fs;kw;Wk; gj;jphpifahsh; midtUk; ,e;j mizf;FOtpd; eltbf;iffisKd;ndLf;f KOikahd xj;Jiog;ig toq;fp nghWg;Gzh;Ts;sClfj;Jiwia Vw;gLj;j xj;Jiof;FkhW ehd; kpfTk; gzpTld; Nfl;Lf;nfhs;fpd;Nwd;.37

,jw;F Vw;fdNt xj;jioj;J tUk; midtUf;Fk; ehd; vdJ ed;wpiaj;njhptpj;Jf; nfhs;fpd;w mNj Neuk; Vidath;fs; ,e;j Rafl;Lg;ghl;LKiwia Kd;khjphpahff; nfhz;L murhq;fk; gj;jphpifg; Nguitia kPz;Lk;Vw;gLj;jpg; gj;jphpif ntspaPl;lhsh;fisAk;> Mrphpah;fisAk;>Clftpayhsh;fisAk; rl;lj;ijf; nfhz;L jz;bf;Fk; epiyiaVw;gLj;Jtjw;fhd tha;g;igj; jLf;fj; Njitahd Kaw;rpfisahtJnkw;nfhs;s Ntz;Lk;.Kuz;ghl;Lj; jPH;Tf;FOtpd; mq;fj;jth;fs; ,e;j Mizf; FOTf;fhfmth;fsJ Nrit %yk; ngWkjptha;e;j Neuj;ij ,jw;fhf mh;gzpj;JtUtijapl;L ehd; ,e;j re;jh;g;gj;jpy; kfpo;r;rpailtNjhL vdJ ed;wpiaj;njhptpj;Jf; nfhs;tjw;fhd re;jh;g;gkhfTk; fUJfpd;Nwd;.,e;j Mizf;FOTf;F cjtp toq;Fk; ehLfSf;Fk; Mjuthsh;fSf;Fk; vdJed;wpiaj; njhptpj;Jf; nfhs;fpd;Nwd;.,.g.K.M.F. tpd; nrayfk; kw;Wk; ,e;j Mizf;FOTf;F KO kdJld;xj;Jioj;J tUk; ,yq;if gj;jphpif ];jhgdk;> ,jopay; fy;Y}hpMfpatw;wpw;Fk; vdJ ed;wpfisj; njhptpj;Jf; nfhs;fp;d;Nwd;.Mh;.v]; tpN[th;jdjiyth;38

Kuz;ghl;Lj; jPHTf;FO jiythpd; nra;jpgj;jphpifj;Jiwapyhd Kuz;ghLfis tprhhpj;J jPh;j;Jitg;gjpy; ,yq;ifgj;jphpif Kig;ghl;L mizf;FO tpiuthfTk; jpwikahfTk; jPh;j;Jitg;gjpy; Kd;Ndw;wk; fz;Ls;s mNj Neuk; gj;jphpiffspd; Mrphpah;fismth;fsJ gj;jphpiffspy; gpuRhpf;Fk; tplaq;fs; njlh;ghf nghJkf;fsJMh;tj;jpw;F Kf;fpaj;jtk; toq;fp ghjpg;Gf;fs; njlh;ghf ftdk; nrYj;jr;nratjpy; ey;y Kiwapy; nrayhw;wp tUfp;d;wJ.,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOthy; MKy;gLj;jj; jf;fgj;jphpifj; Jiwrhh; xOf;ff;Nfhitia gj;jphpif Mrphpah; rq;fk; jpUj;jk;nra;Ak; nghWg;igg; ngw;wpUg;gNjhL mg;gzp jw;NghJ G+h;j;jpaile;j epiyapy;,Ue;J tUtjhy; gj;jphpiffspd; Mrphpah;fs; xd;wpize;J ,gg;zpiag; G+h;j;jpnra;a xj;Jiog;G toq;f Ntz;Lk;.vt;thwhapDk; Kiwg;ghLfspy; FiwT fhzg;gLtjw;F fhuzk; nghJkf;fs;gj;jphpif Kiwg;ghl;L Mizf;FOtpd; eltbf;iffs; gw;wp ,d;Dk;KOikahf mwpahky; ,Ug;gjh my;yJ gj;jphpiffs; xOf;ff;Nfhitia kPWk;tifapy; vijAk; gpuRhpgg;jpy;iyah vd;w fUj;Jk; epyTfpd;wJ. Mdhy; ,e;jfUj;J KOikahf Vw;Wf;nfhs;sf; $bajy;y. Vnddpy; ,.g.K.M.F. thdJmr;R Clfq;fs; njhlh;ghf nghJkf;fSf;F Vw;gLk; gpur;rpidfSf;F jPh;Ttoq;ff;$ba xNu epWtdk; vd;w jftiy ehl;L kf;fSf;F mwptpg;gjpy;KO%r;rhf nraw;gl;L tUfpd;wJ.gj;jphpiffspy; xOf;fNfhit kPwgg;lhky; ,Ugg;jw;Fk;> nghUj;jkw;wGifg;glq;fs; gpuRhpf;fg;gLtijj; jtph;g;gjw;Fk;> ,d hPjpahf Rl;bf;fhl;bFw;wk; Rkj;Jk; epiyia jLgg;jw;Fk; gj;jphpiffspd; Mrphpah;fs; mth;fsJgj;jphpiffspd; gpuRuq;fs; njhlh;ghf kpFe;j mtjhdj;JlDk; fz;fhzpg;GlDk;nray;gl Ntz;Lk;.,yq;if gj;jphpif Kiwg;ghl;L Mzif;FO Ie;jhtJ tUlj;jpy; fhy;gjpf;fpd;w ,t;Ntisapy; ehd; Kuz;ghl;Lj; jPh;Tf;FOtp;d; rhh;ghf mjd; vy;yhntw;wpfSf;Fk; tho;j;Jf;fisj; njhptpj;Jf; nfhs;tjpy; kfpo;r;rpailfpd;Nwd;.rhk; tpN[rpq;fjiyth;Kuz;ghl;Lj; jPHTf;FO39

mwpKfk;,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOtUlhe;j mpf;if – 20071998 Mk; Mz;L ntspaplg;gl;l nfhOk;G gpuflzj;jpd; ntspg;ghlhf,yq;ifg; gj;jphpif Kiwg;ghl;L Mizf;FO cUthf;fg;gl;lJ. ,yq;ifapy;gj;jphpifr; Rje;jpuk; kw;Wk; r%fg; nghWg;Gila gj;jphpifj; Jiw Mfpatw;iwtypAWj;jpa 1988Mk; mz;bd; nfhOk;G gpuflzj;jpd; mbg;gilapy; ,e;jMizf;FO cUthf;fg;gl;lJ. ,yq;if gj;jphpifj; Jiwapduhy; nfhOk;gpy;elj;jg;gl;l rh;tNjr khehl;bd; Kbtpy; ntspaplg;gl;lNj me;j nfhOk;GgpufldkhFk;. ,yq;if gj;jphpif Mrphpah; rq;fk;, Rje;jpu Clf ,af;fk;,ciof;Fk; gj;jphpifahsh; mikg;G, cyf gj;jphpif mikg;G, nghJ eythagj;jphpif A+dpad;, rh;tNjr gj;jphpif epWtdk;, Clfj;Jiwf;fhd gphpT 19kw;Wk; njd; Mgphpf;fhtpd; Clf epWtdk; Mfpatw;wpd; gpujpepjpfs; ,e;jClf khehl;by; gq;Fgw;wpdh;.,yq;if gj;jphpif Kiwg;ghl;L mzif;FO 1995 Mk; Mz;bd; 11 Mk;,yf;f gpzf;Ffisj; jPh;j;J itf;ff;$ba ,zf;f rigr; rl;lj;jpd; fPo;nraw;gLfpd;wJ. ,r;rl;lj;jp;d; fPo; ,q;fpyhe;J, RtPld; kw;Wk; njd; Mgphpf;fhMfpa ehLfspd; gj;jphpif Kiwg;ghl;L Mizf; FOf;fisg; gp;d;gw;wpajhfey;ypzf;fk; rkhjhdg;gLj;jy; kj;jpa];jk; Mfpa topfspy; gj;jphpiffSf;Fvjpuhd Kiwg;ghLfspd; Nghjhd gpzf;FfSf;F jPh;Tfs; toq;fg;gLfp;d;wd.gj;jphpiffs; ,e;j Mizf;FOtpd; jPh;g;Gf;F ,zf;fhtplj;J ,Wjpahftoq;fg;gLfp;d;w kj;jpa];j jPh;ghdJ Kiwg;ghl;lhsh; epahak; Njb cah;ePjpkd;wp;y; tof;Fj; njhLj;jhy; ,e;j jPh;g;G cah; ePjpkd;wj;jp;y; nry;Ygbahfj;jf;fjhFk;.,yq;if gj;jphpif Kiwg;ghl;L Mizf;FO 2007 Mk; mz;L mjd;ntw;wpfukhd ehd;fhtJ tUlj;jpy; fhy; gjpf;fpd;wJ. ,yq;ifapy; gj;jphpifj;Jiwapy; Rafl;L;ghl;L xOf;ff; Nfhitia eilKiwg;gLj;jtjpy; ‘rd;Nlxg;rth;’ ‘rd;Nl yPlh;’ ‘Nkhh;dp;q; yPlh;’ Mfpa gj;jphpiffspd; Fiwe;jsthdxj;Jiog;Gf;F kj;jpapy; gy rthy;fSf;F Kfk; nfhLj;j epiyapy; ,e;jMzif;FO Fwpg;gplj;jf;f gy ntw;wpfis mile;jpUf;fp;d;wJ. ,e;jgj;jphpiffs; ,e;j Mizf;FOtpd; mq;fj;jtuhf ,y;yhjJk; ,jw;Ff;fhuzkhFk;.,Ue;jNghJk; Nyf;`T]; epWtdj;jpd; fPo; ntsptUfpd;w gj;jphpiffshd‘nla;yp epA];’ ‘jpdkpd’ ‘jpdfud;’ Mfpa gj;jphpiffs; ,yq;if gj;jphpifKiwg;ghl;L Mizf;FOtpd; nra;ghLfSf;F xj;jioj;J tUfp;d;wikFwpg;gplj;jf;fJ.,yq;iffapy; fle;j 150 tUlq;fSf;F Nkyhf gj;jphpiffs; ntspte;jNghJk; Ra fl;L;g;ghl;L xOf;fNfhitahdJ ,e;ehl;Lf;F Gjpa tplakhFk;.,e;epiyapy; ,.g.K.M.F.thdJ ,e;j xOf;ff;Nfhit njhlh;ghfClftpayhsh;fs; kj;jpapy; tpopg;Gzh;it vw;gLj;jtjw;fhf njhluhfnraykh;TfisAk; gapw;rpf; fUj;juq;FfisAk; elj;jp tUfpd;wJ.,.g.K.M.F. tpd; jhf;fj;ij gy topfspy; mstpl Kbfpd;wJ. fzprkhdmsT Kiwg;ghLfs; (fPo; tUk; ml;ltidapy; fl;lg;gl;lgb) fpilj;JtUtNjhL mit njhlh;ghf ,.g.K.M.F chpa Kiwapy; ftdk; nrYj;jpgj;jphpifg; gpuRuq;fshy; ghjpf;fg;gl;lth;fSf;F chpa epthudq;fisg; ngw;Wf;nfhLg;gjpy; Nghjpa ftdk; nrYj;jp tUfp;d;wJ. ,jd; kw;nwhU jhf;fkhfgj;jphpiffs; Rakhf mtw;wpy; gpuRukhfpd;w tplaq;fs; njhlh;ghf thrfh;fs;Neubahf Fwpj;j gj;jphpiffSf;Nf Kiwg;ghL nra;Ak; NghJ mtw;Wf;F gpiojpUj;jk;> tpsf;fkspf;f re;jh;g;gk; toq;fy;> kd;dpg;Gf; Nfhuy; Mfpaepthuzq;fis toq;Fk; epiyikfs; tsh;r;rpaile;Js;sd. ,J40

Clfj;njhopy;j; Jiwapd; rpwe;j cah; njhopy; juj;ij ntspgg;Lj;Jtjha;mikfpd;wJ.mj;Jld; ,.g.K.M.F. njhlh;ghf NkYk; ehlshtpahPjpay; tpopg;Gzh;itVw;gLj;Jk; tifapy; 2007 nrg;lk;gh; 15 Mk; jpfjp ,jd; ehd;F tUlepiwitf; Fwpf;FKfkhf ghlrhiy khzth;fs; kj;jpapy; fy;tp mikr;Rld,ize;J Njrpa hPjpahf Kk;nkhopfspYk; fl;Liug; Nghl;bnahd;Welj;jg;gl;lJ. ,jpy; f.ngh.j. (c.ju) tFg;G khzth;fs; fye;J nfhz;ldh;.Kk; nkhopfspYk; ntw;wp ngw;w 09 ntw;wpahsh;fSf;F KiwNa &gh 5>0004>000 &gh 3>000 vd;w mbg;gilapy; Gj;jfq;fisf; nfhs;tdT nra;tjw;fhdgz tTr;rh;fs; ghprhf toq;fg;gl;ld. ,t;itgtj;jpw;F nghJeytha gj;jphpifA+dpadpd; epiwNtw;Wg; gzpg;ghsh; ypd;rp Nuh]; gpujk mjpjpahf fye;Jnfhz;lhh;.gj;jphpiffspd; ntspaPLfSk; rpwe;j juhjuj;Jld; thrfh;fisf;f tUk;tpjkhfTk; ,yF eilapYk; ghjpg;Gf;fis cz;L gz;Dk; my;yJ rh;r;irfpsg;Gk; tplaq;fisf; Fiwj;Jk; ele;J nfhs;tJ ,jd; kw;nwhU jhf;fkhff;fUj Kbfp;d;wJ. jkpo;g; gj;jphpiffs; rhpahf jfty; ntspaPL vd;w tplaj;jpy;kpfTk; nghWg;Gzh;r;rpAld; jkJ ntspaPLfis Nkw;nfhz;L tUtJtuNtw;fj;jf;fjhf mikfpd;wJ. Gs;sptpguq;fspd;gb xOf;ff;Nfhit kPwy;njhlh;ghf mjpfkhd Kiwg;ghLfs; rpq;fs nkhopapyhd gj;jphpiffSf;FvjpuhditahfNt ,Ug;gij mtjhdpf;f Kbfp;d;wJ.ghy; epiy tptfhuq;fs;.gj;jphpifahsh;fSf;Fk; rptpy; r%fj;jpdUf;Fkhd gapw;rp newpfspy; ngz;fspd;gq;fspg;G kpfTk; Fiwe;j epiyapNy ,Ue;J tUfpd;J. ,jw;F Kf;fpa fhuzk;J}u ,lq;fspy; ,Ue;J ngz;fs; gpuahzk; nra;a Ntz;bapUe;jikahFk;.mj;NJhL ngz; Clftpayhsh;fs; mth;fsJ ngw;nwhh; my;yJghJfhtyh;fshy; tjptpl fUj;juq;Ffs; my;yJ gapw;rp newpfspy; fye;Jnfhs;tij mt;tsthf Cf;fg;gLjhikAk; ,jw;F kw;nwhU fhuzkhFk;.kPz;Lk; gj;jphpifg; Nguitia Nehf;fpa efh;Tmurhq;f jfty; jpizf;fsj;jpd; gzp;gghsh; mD\ gpygpbait ,yq;ifgj;jphpif Kiwg;ghl;L Mizf;FOtpd; gpujpepjpfs; re;jpj;J ,jd;nraw;ghLfs; kw;Wk; eltbf;iffs; njhlh;ghf fye;Jiuahly; xd;iwelj;jpad. ,yq;if gj;jphpif ];jhgdk; Clf mikg;Gf;fis xd;W jpul;bmjd; gq;fspg;Gld; murhq;fk; kPz;Lk; gj;jphpifg; Nguitia Vw;gLj;jNkw;nfhz;L tUk; Kaw;rpf;F vjph;g;igj; njhptpj;jJ. ,r;re;jpg;G 2007 Mf];l;khjk; eilngw;wJ.Kiwg;ghLfs;2007 Mk; Mz;L [dthp Kjy; brk;gh; khjk; tiuapyhd fhyg;gFjpf;Fs;,.g.K.M.F. Tf;F 125 Kiwg;ghLfs; fpilj;Js;sd. gj;jphpif thhpahf mittUkhW:-• rpq;fs nkhop%y gj;jphpiffSf;F vjpuhf 92 Kiwg;ghLfs;• jkpo; nkhop%y gj;jphpiffSf;F vjpuhf 13 Kiwg;ghLfs;• Mq;fpy nkhop%y gj;jphpiffSf;F vjpuhf 20 Kiwg;ghLfs;,jd;gb mjpfkhd Kiwg;ghLfs; rpq;fs nkhop%y gj;jphpiffSf;Fvjpuhditahf miktNjhL ,e;ehl;by; Mff; $Ljyhd thrfh;fs; ,Ug;gJk;rpq;fs nkhop%y gj;jphpif fSf;fhFk;. nkhj;j thrfh; vz;zpf;ifapy; 70tPjkhd thrfh;fs; rpq;fs nkhop %y thrfh;fshf ,Ug;gNjhL ,.g.K.M.F.gj;jphpifj; JiapdUf;fhd xOf;fNfhitf;F cl;gl gpuRuq;fisNkw;nfhs;tJ njhlh;ghf mg;gj;jphpiffspd; Mrphpah;fspd; Mff; $Ljyhd41

xj;jiog;igAk; ngw;Wf;nfhs;tjpy; ntw;wpfz;bUg;gJ Fwpg;gplj;jf;fJ. mNjNghd;W jkpo; nkhop %ykhd gj;jphpiffSlDk; KOikahd xj;Jiog;igg;ngw;W gj;jphpifj; jipadUf;fhd xOf;ff; nfhitia mKy;gLj;jtjpy;ntw;wpfz;L tUfpd;w mNj Neuk; %d;W Mq;fpyg; gj;jphpiffs; ,e;jxOf;ff;NfhtiAld; xj;Jg; Nghtjpy;iy vd;W KbntLj; jpUf;fpd;wJ.Kiwg;ghLfspd; tiffs; gpd;tUkhW: -fpilj;Js;s Kiwg;ghLfspy; nry;Ygbaw;w Kiwg;ghLfs; 56. ,it,.g.K.M.F. tpd; Kiwg;ghl;L xOq;F tpjpfSf; Fl;gl;litfshFk;.Cjhuzkhf tpsg;guq;fs; my;yJ tpsk;guq;fSld; rk;ge;jgg;Lk; tifapyhdMf;fq;fs; Nghd;wtw;Wf;F vjpuhd Kiwg;ghLfis ,e;j Mizf;FO Vw;Wtprhuiz nra;tjpy;iy. mit Kiwg;ghl;L tpjpKiwfSf;F cl;glhjitfshFk;.jPh;T fhzg;gl;l Kiwg;ghLfs; 25. 2006 Mk; Mz;Lld; xg;gpLifapy; ,JKiwg;ghl;by; mjpfhpg;igf; fhl;Lfp;d;wJ. 36 tPjkhd Kiwg;ghLfSf;F jPH;Tfhzg;gl;lij ,J fhl;Lfp;d;wJ. 44 Kiwg;ghLfspd; Nfhh;itfs; %lgg;l;ld.Kiwg;ghl;lhsh;fs; kiwg;ghl;ilr; nra;J tpl;L mtw;iwj; njhlu Kd;tuhjjd;fhuzkhf ,t;thW %lg;gl Ntz;bNaw;gl;lJ.Kiwg;ghLfs; fpilf;fg; ngw;w gj;jphpiffs; tUkhW: -• Nyf;`T]; epWtdj;jpd; gj;jphpiffshd nla;yp epA];> jpdkpd> rd;Nlxg;rth;>rpYkpd k;Wk; jpdfud;• tp[a epA];nggh;]; ypkpll;bd; yq;fhjPg> rphpfj> QhapW yq;fhjPg• j Iyd;> jptapd> QhapW jptapd kw;Wk; QhapW Iyd;l; Mfpa cghypepA]; Nggh;]; ypkpll; epWtdj;jpd; ntspaPLfs;.• Rkjp ntspaPl;L epWtdj;jpd; yf;gpk> QhapW yf;gpk.• uhta epWtdj;jpd; uhta gj;jphpif• rd;NlsPlh; ( yPlh; gg;ypNfrd;)• Rlh; xyp (kh]; kPba rpd;bNfl;)• j Nerd; (hptpu kPbah NfhgNurd;)• tPuNfrhp (vf;gpu]; epA]; Nggh;]; ypkpll; epWtdk;)• jpdf;Fuy; (Aidll; epA];Nggh;]; ypkpll; epWtdk;)Vida Kiwg;ghLfs;Kiwg;ghl;L tpjpKiwfSf;F nghUe;jhjJk; ,yj;jpdpay; Clffq;fSf;FvjpuhdJkhd rpy Kiwg;ghLfSk; fpilj;Js;sd. rpy tpsk;guq;fs;njhlh;ghditahFk;. mj;jifa kiwg;ghLf;s nghWj;jnkdf; fUJk; gl;rj;jpy;Fwpg;gpl;l epWtdq;fspd; Jiwj; jiyth;fsp;d; ftdj;jpw;FmDg;gpitf;fg;gl;ld.thrfh; chpikthrfh; chpik njhlh;ghf ,.g.K.M.F. gj;jphpiffspy; gpuRhpg;gjw;fhfmDg;gg;gl;l mtpj;jy;fs; gj;jphpiffSf;F mDg;gpitff;g;gl;ld. mit gygj;jphpiffspy; mwptpj;jy; tpsk;gukhfTk; nra;jpahfTk; gpuRhpff;g;gl;ld. mittp[a epA];nggh;];> Rkjp ntspaPl;L epWtdj;jpd; gj;jphpiffs;> vf;gpu]; epA];nggh;]; ypkpll; epWtdk;> Ada;ll; epA];Nggh;]; ypkpll; epWtdj;jpd; jpdf;Fuy;gj;jphpif> Nyf;`T]; epWtdj;jpd; jpdfud; gj;jphpif kw;Wk; etkzp Mfpagj;jphpiffspy; gpuRhpf;fg;gl;ld.42

Kuz;ghl;Lj; jPh;Tf; FOKuz;ghl;Lj; jPh;Tf; FOthdJ 09 Kiw $baNjhL ,uz;L khjj;jp;w;nfhUKiw $Ltnjd;Wk; jPh;khdpf;fg;gl;lJ. ,e;j Kuz;ghl;Lj; jPh;Tf; FOtpd;jiytuhf Xa;T ngw;w Kd;dhs; ghuhSkd;w nrayhsh; ehafk; rhk;tpN[rpq;f flikahw;WtNjhL mthuJ KjyhtJ ghtpf;fhyk; epiwtile;jepiyapy; fle;j mf;Nlhgh; khjk; eilngw;w tUlhe;j nghJf;$l;lj;jpy; NkYk;%d;W tUl fhyj;jpw;F gjtpf;fhyk; ePbg;Gr; nra;ag;gl;lJ. ,f;FOtpd; VidacWg;gpdh;fs; tptuk; tUkhW. fyhepjp NjtNdrd; Nera;ah, jpUkjp> rpj;jpjpUr;nry;tk;, [htpl; A+Rg;, Yrpy; tpN[th;jd, bNahd; #kd;, [p.v];.ngNuuh,jpUkjp ky;ypfh tdpf Re;ju, rphp udrpq;f. [ajpyf b rpy;th, kw;Wk; gpuNkhl;b. rpy;th.xOf;ff;Nfhit kpsha;Tf; FO,q;fpyhe;jpd; xOf;ff;Nfhitf; FOtpd; nrayhsh; ,ad; gpy;]; 2007 mf;Nlhgh;17 Kjy; 23 mk; jpfjp tiuapy; FWfpa fhyk; ,yq;iff;F tp[ak; nra;jhh;.,yq;if gj;jphpif ];jhgdk;> gj;jphpif Mrphpah; rq;fk; Mfpatw;wpd;miog;gp;d; Nghpy; mth; ,t;tp[aj;ij Nkw;nfhz;lhh;. xOf;ff;Nfhitnjhlh;ghf ftdk; nrYj;jpa mth; mJnjhlh;ghf mwpf;ifnahd;iw ,yq;ifgj;jphpif Mrphpah; rq;fj;jplk; ifaspj;Js;shh;. mjd; gpujpnahd;Wk; ,e;jmwpf;ifapy; ,izf;fg; gl;bUf;fpd;wJ.gj;jphpifj;Jiw Clftpayhsh;fSf;fhd %d;W tUlq;fs; goiktha;e;jxOf;fNfhitia kPsha;T nra;tjw;fhf ,.g.M.r. j;jpd; Ntz;Lnfhspd; Nghpy;,.g.K.M.F. thy; kPsha;Tf; FOnthd;W epakdh; nra;ag;gl;lJ. ,f;FOtpy;jpUkjp> rpj;jp jpUr;nry;tk;> [htpl; A+Rg; (Kuz;ghl;Lj; jPh;Tf; FOtpd;cWg;gpdh;fs;) mg;Nghija nla;yp kpuh; gj;jphpifapd; MrphpaUk; jw;NghJ‘tPf;yp nghl;nlhk; iyd;’ gj;jphpifapd; Mrpauhd ep];jhh; fhrpKf;Fg; gjpyhfvk;.v];.vk;. ma;A+g;> Rje;jpu Clf mikg;gpd; mq;fj;jtUk; ,.g.K.M.F.tpd;gzpg;ghsh; rig cWg;gpdUkhd ctpe;J FUFy#hpa MfpNahh;,lk;ngWfpd;wdh;.MapDk; ,Nj gzpia Nkw;nfhs;tjw;fhf Vw;fdNt epakpf;fg;gl;be;jfphp];Nlhgh; tPuke;jphp jiyikapyhd FOthy; Fwpg;gpl;l fhyg;gFjpapy;xOf;ff;Nfhitia kPsha;T nra;Ak; gzpiag; G+h;j;jp nra;a Kbahky;Ngha;tpl;lJ. ,f;FO mjd; eltbf;ififSf;fhf xU Kiw kl;LNk$bapUe;jJ. ,f;FOtpYk; Clfj;Jiw kw;Wk; rptpy; r%fj;ijr; Nrh;e;jKf;fpa cWg;gpdh;fs; gyh; ,lk;ngw;w;pUe;jdh;.,yq;if gj;jphpif Mrppah; rq;fk;> ,ad;gpy;]; ,J njhlh;ghf nra;Js;srpghhpRfisAk; mjw;Fr; rkkhf Gjpjhf epakpff;g;gl;l kPsha;Tf; FOthy;nra;ag;gl;Ls;s rpghhpRfisAk; ftdj;jpy; vLj;jpUf;fpd;wJ. (,izg;G 02 Mfme;j gpujp ,q;F ,izf;fg;gl;bUf;fpd;wJ.)njhiyf;fhl;rp nra;jpahsh;fSf;fhd xOf;ff; Nfhitnjhiyf;fhl;rp epiyaq;fsp;d; Ntz;LNfhSf;fpzq;f ,yj;jpudpay;Clfatpayhsh;fSf;fhd xOf;ff;Nfhitnahd;iw tFg;gJ njhlh;ghf,yq;if gj;jphpif Kiwg;ghl;L Mizf;FO gq;fspg;Gr; nra;jJ. MTV, ITN,ETV, TNL, ‘Rth;zth`pdp’ ‘nlud’ Mrpa njhiyf;fhl;rp epiyaq;fs;njhiyf;fhl;rpj;Jiw Clftpayhsh;fSf;fhf xOf;ff;Nfhitnahd;iwjahhpg;gJ njhlh;ghf ,f;fye;Jiuahliy Vw;ghL nra;jpUe;jJ.,.g.K.M.F. tpd; mq;fj;Jtk;,.g.K.M.F. tpd; mq;fj;jtuhf ,Ue;j m[pj; rkuehaf;fhtpd;(Nyf;`T];eptdj;jpd; Mq;fpy ntspaPLfspd; gpujk Mrphpauhf ,Ue;j) kuzj;ijj;43

njhlh;e;J Vw;gl;l ntw;wplj;jpw;F jw;NghJ nla;ypepA]; gj;jphpifapd;Mrphpauhd ge;Jy [aNrfu epakpf;fg;gl;lhh;. Mdhy; mth; Mrphpah; gjtpia,uh[pehkhr; nra;jjhy; mg;gjtp ntw;wplkhf ,Uf;fpd;wJ. mj;NjhL Rje;jpuClf mikg;ghy; epakdk; nra;ag;gl;bUe;j fky; ypadhur;rp ,e;jMizf;FOtpd; rpq;fs nkhop%y Kiwg;ghl;L cj;jpNahfj;jjh; gjtpf;Fepakpff;g;gl;lijaLj;J me;j cWg;gpdh; gjtpAk; ntw;wplkhfpaJ. mjw;Fg;gjpyhf Rje;jpu Clf mikg;gpd; gpujpepjpahf ,.g.K.M.F. tpd;mq;fj;Jtj;jp;w;fhf jpUkjp> jhhpjp nghd;Nrfh epakpf;fg;gl;lhh;. 2007 brk;gh; 31Mk; jpfjpahFk;NghJ ,.g.K.M.F. tpd; mq;fj;jtk; 49 Mf ,Ue;jJ.tpopg;G+l;Lk; eltbf;iffs;,.g.K.M.F. tpd; gpur;rhu eltbf;iffs;,.g.K.M.F. tpd; eltbf;iffs; gw;wp kf;fs; kj;jpapy; tpopg;ig Vw;gLj;Jk;Nehf;fpyhd jahh;gLj;ljg;gl;l gpur;rhuj; jpl;lq;fs; gzpg;ghsh; rigapd;mq;fPfhuj;jp;w;fhf xg;gilf;fg;gl;lJ. ,jd; eltbf;iffs; gw;wpa mr;rplg;gl;ljfty;fs;, Rtnuhl;bfs; nghJ kf;fsp;d; Mh;tj;ijj; J}z;Lk; tifapyhdmwptpj;jy;fs; kw;Wk; tndhyp njhiyf;fhl;rp tpsk;guq;fs; vd;gd ,jpy;mlq;Ffpd;wd. mj;NjhL nghJkf;fs; elkhl;lk; mjpfk; cs;s gFjpfspy;Fwpg;ghf gk;gsg;gpl;b> fpUyg;gid> Gwf;Nfhl;il kw;WK; fz;b tPjp Mfpa,lq;fspy; ,it ghh;itf;fhf cs;sd.,.g.K.M.F. tpd; eltbf;iffs; gw;wp ,yFthf mwpe;J nfhs;sf;$batifapy; ifNaL xd;Wk; mr;rplg;gltpUf;fp;d;wJ.nraykh;TfSk; fUj;juq;ffSk;,.g.K.M.F. tpd; nraw;ghLfs; gw;wp; nghJ kf;fSf;F mwpT+l;Lk; epfo;r;rpfs;gy gz;lhutis> gJis> ,uj;jpdGhp> Nffhiy kw;Wk; rpyhgk; Mfpa,lq;fspy; elj;jg;gl;ld. ,e;epfo;r;rpfSf;F murhq;f mjpfhhpfs;> Mrphpah;fs;>gyjug;gl;l njhopy;fspy; gJis> ,uj;jpdGhp> Nffhiy kw;Wk;rpyhgk; Mfpa gFjpfisr; Nrhh;e;j Clftpayhsh;fSf;fhf ,uzL ehs;nraykh;Tfs; elj;jgg;l;ld.• Clf xOf;fNfhit njhlh;ghf ,d;lh; epA]; Vw;ghL nra;jpUe;jthndhyp Clftpayhsh;fSf;hd gapw;rpf; fUj;juq;F ,.g.K.M.F.tpd;gq;Fgw;wYld; khj;jiwapy; elj;jg;gl;lJ. mj;NjhL nfhOk;G fpwp];jtNjthyaj;jpYk; fUj;juq;nfhd;W elj;jg;gl;lJ.• nrQ;rpYitr; rq;f mjpfhhpfSf;Fk; ,.g.K.M.F.tpd; eltbf;iffs;njhlh;ghf mwpT+l;ly; epfo;r;rpnahd;W elj;jg;gl;lJ.• kdpjhgpkhd nraw;ghl;L Kfth; epiyaj;jhy; Vw;ghL nra;ag;gl;l (CHA)gapw;rp nraykh;tpy; gj;jphpif Kiwg;ghl;L Mizf;FO gw;wpamwpT+l;ly; tphpTiu elj;jg;gl;lJ.ntspehl;L gapw;rp Rw;Wyh,.g.K.M.F. tpd; gpujk epiwNtw;W mjpfhhp “myad;]; xg; ,d;bngd;ld;lgpu]; fTd;rpy;” ]nfhl;ye;jpy; elj;jpa khehl;by; fye;J nfhz;lh;. ,k;khehL2007 nrg;lk;gh; khjk; 18 – 22 Mk; jpfjp tiu eilngw;wJ. ,e;j khehl;ilj;44

njhlh;e;J gpujk epiwNtw;W mjpfhhp ,q;fpyhe;J gj;jphpif Kiwg;ghl;Lmizf;FOTf;Fk; tp[ak; nra;J mjd; eltbf;iffisf; fz;fhzpj;Js;shh;.gj;jphpiffspd; Mrphpah;fSldhd re;jpg;G,f;fhyg;gFjpf;Fs; gpujk epiwNtw;W mjpfhhpAk; Kiwg;ghl;Lcj;jpNahfj;jUk; gj;jphpiffspd; mYtyfq;fSf;F tp[ak; nra;Jgj;jphpiffspd; Mrphpah;fSld; ,.g.K.M.F. gw;wp gy fye;Jiuahly;fiselj;jpAss;dh;.,izaj;jsk;,q;fpyhe;jpd; gj;jphpif Kiwg;ghl;L Mizf;FOitg; Nghd;W ,jd;,izaj;jsKk; GJnkU$l;lg;gl;L tbtikf;fg;gl;lJ. ,e;j ,izaj;jsj;jpy;,.g.K.M.F. gw;wpa gy;NtWtpjkhd jfty;fSk; cs;sd. mj;NjhLKiwg;ghLfisAk; ,izaj;jsk; Clhf nra;tjw;Fk; trjpaspf;fg;gl;bUf;fpd;wJ.tUlhe;j nghJf; $l;lKk; gzpg;ghh; rigf; $l;Kk;,.g.K.M.F. tpd; gzpg;ghsh; rig khjhe;jk; $b tUfpd;wJ. ,jd; tUlhe;jnghJf; $l;lk; 2007 mf;Nlhgh; 20 Mk; jpfjp eilngw;wJ. Kd;idagzpg;ghsh;fspy; xd;gJ Ngh; kPz;Lk; 12 khj fhyj;jpw;Fg; gzpahw;wntdkPz;Lk; njhpT nra;ag;gl;ldh;. ,e;j $l;lj;jpd;nghJ ,.g.K.M.F. tpd; gphhpT65 D ,w;F jpUj;jk; rkh;g;gpf;fg;gl;L mq;fpfhpf;fg;gl;lJ. mjd;gb ,.g.K.M.F.,d; Kuz;ghl;Lj; jPh;Tf;FOtpd; jiytiu NkYk; %d;W tUl fhyj;jpw;Fgjtptpapy; ePBg;Gr; nra;tjw;F trjpaspg;gjhFk;.rig mq;fj;jth;fs;jpU. uQ;rpj; tpN[th;jd (jiyth; ,yq;if gj;jphpif ];jhgdj;jpd; epakdcWg;gpdh;) epky; nty;fk (gj;jphpif ntspaPl;lsh;fs; rhh;ghf) rpd;` ul;dJq;f( ,yq;if gj;jphpif Mrphpah; rq;fk; rhh;ghf) ctpe;J FUFy#hpa (Rje;jpuClf mikg;G) nkdpf; b. rpy;th, tUz fUzhjpyf (,yq;if gj;jphpif];jhgdk; rhh;ghf) jpkjp. ehkpdp tpN[jhr, vd;.vk;. mkPd;, Re;ju ep`jkhdp b.nky; ( ,.g.K.M.F. tpd; nghJ mq;fj;Jtk; rhh;ghf)cj;jpNahfj;jh;fs;2007 Mk; mz;L Kjy; ,.g.K.M.F. mjd; KO mstpyhd gyj;Jld; ,aq;fptUfpd;J. gpujk epiwNtw;W mjpfhpahf RFkhh; nuhf;T+l;> rpq;fsg; gphpTKiwg;ghl;Lg; nghWg;gjpfhhpahf fky; ypadhur;rp MfpNahh; Vw;fdNt epytpantw;wplq;fis epug;Gk; tifapy; epakpf;fg;gl;ldh;. gpujk epiwNtw;Wmjpfhhpahf ,Ue;j kdpf; nkd;b];> MNyhrfuhf ,Ue;j v];. jk;Ky;yMfpNahhpd; gjtp tpyfyhy; ,t;ntw;wplq;fs; Vw;gl;bUe;jd.2007 Mk; mz;L etk;gh; khjk; Mq;fpy Kiwg;ghl;L mjpfhhpahf ,Ue;j rhkhudtd ,yq;if gj;jphpif ];jhgdj;jpd; Clf nraw;ghLfSf;fhdmjpfhhpahf epakpf;fg;gl;lijaLj;J Mq;fpy Kiwg;ghLfs; njhlh;ghdnghWg;G gpujk epiwNtw;W mjpfhhpahd RFkhh; nuhf;T+l;blk;xg;gilf;fg;gl;lJ. jkpo; Kiwg;ghLfSf;fhd nghWg;ghd cj;jpNahfj;juhfvk;.v];. mkPh; `_ird; gzpahw;Wfpd;whh;.gpujk epiwNtw;W mjpfhhp,yq;if gj;jphpif Kig;ghl;L Mizf;FO45

Cøn¨¦–1£z-v-›-øPa _¯ JÊ-[-QøÚ C»-[-øP-°À HØ-£-k-z-x-uÀ & J¸ B´Ä{øÓ÷ÁØÖUSÊ AÔ-U-øP°ß _¸UP®:C¯ß¤Àì -– |Á®£º 2007JU-÷hõ-£º ©õu-z-vÀ |õß ÷©Ø-öPõ-sh Á¸-øP-°ß ¤µ-uõÚ ÷|õU-P-©õ-°-¸-¢-u-x. C»-[øP £z-v-›-øP

{»-Ä® Aµ-]-¯Ø `ÇÀ C¢u C»-U-QøÚ Aøh-Áøu ÷©¾® ]U-P-»õ-U-S-® {ø»-°-¾®öÁØÔ ö£Ö-Áx AÁ-\-µ-©õÚ ÷uøÁ-¯õ-S-®. CßÖ Põn-¨-£-k-Q-ßÓ C¢u öÁØ-Ô-h-zvøÚ¨£¯-ß-£-k-z-vU öPõsk Aµ_ _¯ JÊ-[øP HØ-£-k-z-x-Á-vÀ uõß ÁÇ-[-Q¯ Jz-xøÇ-¨ø£«Í¨-ö£-Ó-Ä-®, £z-v-›-øP¨ ÷£µ-øÁø¯ ¦v-¯-uõP {Ö-Á-Ä® •ß-Á-µ-U-T-k-®.xøÓ-\õ-º-¢-u-Á-º-P-Î-h-ª-¸-¢x •Ê-ø©-¯õP EÖ-v-¨-£õk Qøh-U-P-Â-À-ø»-¯õ-°ß Ax J¸¤ß-Ú-øhøÁ HØ-£-k-z-x®. Gv-º-Põ» {v-²-u-Â-PÒ Âh-¯-z-v-¾® ¤ß-Â-øÍ-Ä-PøÍ÷uõØ-Ö-Â-z-x-Â-k-®. Cß-Ö® CÆ-Â-h-¯-z-vÀ •ß-÷Úõ-i-¯õP C»-[øP C¸-U-S® {ø»-°-¾-®, _¯ JÊ-[-QøÚ HØ-£-kzu Áõ´-¨-£õÚ CÖ-va \¢-u-º-¨-£-•® CÇ-U-P-¨-£-m-k-Âh-»õ-®.1. AÔ-•-P-®:& £z-v-›-øP

÷©Ø-£i Âh-¯-[-P-Ð-USz wºÄ Põn-¨-£-hÀ AÁ-]-¯-®. Põ»-[-P-h-¢x Âh-Â-À-ø». BÚõ-À, µ-¯-©õ-QU öPõs-i-¸-U-Q-Ó-x.2. ¤øÇzv-¸-¨-£x ¯õx? :& SÖ-Q-¯-öuõ¸ Põ»-z-v-ÝÒ C¢-÷|õ-US ©¸-¢-øuU Ps-k-¤-iz-uÀA›-x. B°-ß, Cx |øh-•-øÓU ÷PõøÁ GÚ-U-öPõ-ÒÍ-z- u-U-P-u-À» GßÖ Âøµ-Â-÷»÷¯ öu›-¯-Á-¢-u-x. Auß £»-Ã-Ú-[-PÒ ÷£õv¯ AÍÄ-US £Ÿ-m-]-U-P-¨-£-m-i-¸-U-P-Â-Àø» Gß-Ö® öu›¯ Á¢-u-x. Eh-ß-£õk SøÓ-ÁõP C¸-¢-uø© J¸ ¤µ-a-]øÚ GÚU Põs-¤-U-P-¨-£-m-h-x. BÚõ-À, |øh-•-øÓU ÷PõøÁ-°ß £i Ax HØ-Ö-U-öPõ-ÒÍ-¨-£-mh Âu-zv-À-uõߤµ-a-]øÚ C¸-¢-u-x. |øh-•-øÓU ÷PõøÁ £ØÔ AÔ-¯õ-v-¸-¢-u-ø©-²® ]U-P-»õ-P÷Á C¸-¢-u-x. BÚõ-À, BønUSÊÂ ß £[-S- £o ©Ø-Ö® Ax E¸-Áõ-U-P-¨-£-m-h-u-Ø-PõÚ \›-¯õÚ Põµ-n® ö£¸-©Í-Ä-USz öuÎ-ÁõP¨ ¦›-¯-¨-£-hõ-©-¼-¸-¢-u-ø©÷¯ ¤µ-a-]-øÚ-¯õ-S-®.|øh-•-øÓU ÷PõøÁ «Íõ´Ä ö\´-¯-¨-£-hõø© ÷£µõ-£-zx Gu-øÚ-²® ÷uõØ-Ö-Â-U-Põ-x.Ax C¨-÷£õ-x® £¯-Ý-ÒÍ-x-uõ-ß. v¸-z-u-[-PÒ ö\´-¯-¨-£-k-®-÷£õx ªP-Ä® £¯-Ý-ÒÍ-uõPC¸-U-S-®. (¤ß-Ûøn-¨¦ ¥ °À B÷»õ-\-øÚ-PÒ uµ-¨-£-m-k-ÒÍ-Ú) Bs-k-÷uõ-Ö® CuøÚ«Íõ´Ä ö\´¯õø© ¤µ-a-]-øÚ-°ß J¸ SÔ-±÷h. Es-ø©-¯õÚ ¤µ-a-]øÚ G[-÷Põ-uõß C¸-U-Q-Ó-x.Põn-¨-£-k® ÷|õ´-U-S-Ô-PÒ CÖ-vU Põ»-z-v-ØS›¯øÁ Gß÷Ó A¤-¨-¤-µõ-¯-[-PÒ öu›-Â-U-Q-ß-Ó-Ú. £Ø-Ô-ß-ø©, EÒ-•-µ-s-£õ-k, ÁÈ-Põ-m-h-¼-ßø© ÷£õßÓ Põµ-n-[-PÒPõs-¤-U-P-¨-£-k-Q-ß-Ó-Ú. Cx Gu-Ø-PõP C¸-U-Q-Óx Gß-£-x- £-ØÔ £z-v-›-øP

U-öPõ-s-hõ-¾® Bµ-®£ Põ»-z-vÀ Põm-i-Á-¢u Bº-Á-{-ø»-¨-£õ-m-iøÚ C¨-÷£õxöPõs-i-¸-U-P-Â-À-ø». Gk-z-x-U-Põ-m-hõP Au-ØS E›-ø©-²ÒÍ |øh-•-øÓU ÷PõøÁø¯JÊ-[-PõP «Íõ´Ä ö\´-Áøu øP -Â-m-i-¸-¢-u-x. öÁÎ-¯õº ‰»® ö\¯-Ø-£-k-Á-u-ØS Aø©-U-P-¨-£-mh Cøn ÷PõøÁ SÊ B£-zøu HØ-£-k-z-x® Âu-z-vÀ Âm-ka ö\ß-Ó-x. öÁÎ-¯õ-›ß J¨-¦-uÀ |®-£-P-z-u-ß-ø©ø¯ u¢-v-¸-UP ÷Ás-i-¯-x.‰ß-Óõ-Á-uõ-P, _¯ JÊ-[S HØ-£-k-z-x® Âh-¯-z-v-÷»÷¯ £z-v-›-øP-PÒ J¸-ª-zu P¸-zøuUöPõs-i-¸-U-P-Â-À-ø». ÷»U-í-Äì öÁÎ-±-hõÚ öh°¼ {³ì £z-v-›-øP BønUSÊÂß|hÁiUPPÐUS JzxøÇUP u J¨-÷\-Áº ©Ö-zx {ß-Ó-x. ½hº £z-v-›øP Gv-º-zx {ß-Ó-x.C¢-{ø» ©U-PÒ ©z-v-°À |®-£-P-z-u-ß-ø©ø¯ CÇ-U-Pa ö\´-u-x. Cx ÷©¾® JßøÓ_m-k-Q-Ó-x. C¢u Aø©-¨¦ Gu-ØPõP C¸-U-Q-Óx Gß-£øu £z-v-›-øP-P÷Í ¦›-¢-x-öPõ-ÒÍõu {ø»-ø¯-²® uõ÷© BønUSÊÂÚõÀ £õx-Põ-U-P-¨-£-h-Â-¸-U-Q-ß-÷Óõ® Gß-£øu-²®En-µõu {ø»-²® EÒÍ-x. \¢-÷u-P-z-v-ØS Ch-[-öPõ-hõx «s-k® TÖ-÷Áõ-®,BønUSÊ Cn-U-P® HØ-£-k-z-x-Á-x; wº-¨¦ TÖ® Av-Põ-µ® öPõs-h-x; Aµ\ uø»-±kAÀ-»x }s-h, AvP ö\»Ä ¤i-U-S-®, £øP-ø©-²-n-ºÄ ªUP }v-z-xøÓ |h-Á-i-U-øP-P-Ð-US©õØ-ÓõP ö\¯-Ø-£-k-Á-x.GÆ-Áõ-Óõ-°-Ý-®, £z-v-›-øP

CøÁ GÀ»õ ©m-h-z-v-Ú-¸-U-S® öu›-Â-U-P-¨-£h ÷Ás-k-®.1. Cz-x-øÓ-\õ-º-¢-u-Á-º-P-Ð-U-S: ©Ú CÖ-U-P® AÀ-»x ]¢-v-U-Põ-©÷» {µõ-P-›-z-uÀ ÷£õU-S-PøÍ Gv-º-zx¨ ÷£õµõh Eu-Ä-®. IU-Q-¯®, Jz-x-øÇ-¨¦ £Ø-Ô¯\õ¯ø» ©ÚvÀ ÷uõØ-Ö-Â-U-S-®. öÁÎ-°-k-÷Áõ-›À öuõh-[Q B]-›-¯º FhõP RÌÁ›-ø\-P-Ð-US ö\ß-Ó-øh-²-®. C®-•øÓ Ca-ö\-¯-ß-•øÓ £»-Á-ØøÓ EÒÍ-h-U-Q-°-¸-¨-£-uõP En-º-Áx A¢-{-¯z uß-ø©ø¯ AP-ØÓ Eu-Ä-®. ÷£õmi {Ö-Á-Ú-[-P-Îß B]-›-¯-º-P-Î-øh÷¯ AÀ-»x HøÚ-÷¯õº ©z-v-°À G[-PøÍ & AÁ-º-PøÍ Gß-Ý®]¢-u-øÚ¨ ÷£õUS A›-z-xa ö\ß-Ö-Â-h-»õ-®. CÁ-ØøÓ Aøh-Á-u-Ø-PõÚ ]£õ-º-_-P-Ю ÷©¾® £»-Á-ØøÓ EÒÍ-h-U-Q¯ ÷PõøÁø¯z u¯õ-›-U-S® £m-i-¯À ¤ß-Û-øn-¨¦ A °À Cøn-U-P-¨-£-m-k-ÒÍ-x.2. £z-v-›-øP

¤ß-Û-øn-¨¦ A-£z-v-›-øP

CvÀ HØ-P-Ú÷Á \[-P-z-v-¾-ÒÍ-Á-º-P-Ю CÀ-»õ-u-Á-º-P-Ю EÖ-¨-¤-Ú-µõ-°-¸-z-uÀ ÷Ás-k-®. Cx {¯õ-¯-¨-£õ-k-ÒÍ-uõ-P-Ä-®, {øÓ-¢u ¤µ-v-{-v-zx-Á®öPõs-h-uõ-P-Ä® C¸-U-S-®. Az-x-h-ß, }s-h-Põ» ÷|õU-QÀ \[-P-z-vßEÖ-¨-¤-Ú-º-P-Ð-U-S-®, EÖ-¨-¤-Ú-º-PÍõP CÀ-»õu £z-v-›øP B]-›-¯-º-P-Ð-US® Cøh-°À Põn-¨-£-m-i-¸-¢u Cøh-öÁÎ {µ-¨-£-¨-£-k-Á-u-Ø-PõÚ `ÇÀ E¸-Áõ-S-®. ÷©¾®, ¤µ-£» Fh-P-z-xøÓ {Ö-Á-Ú-[-P-Î-¼-¸-¢x ÷uº-¢-öu-k-U-P-¨-£-mh‰zu EÖ-¨-¤-Ú-º-PøÍ |øh-•øÓU ÷PõøÁ SÊ-Â-ÝÒ Dº-z-x-U-öPõ-Ò-Ð-uÀ_¯ JÊ-[-S-£-k-z-uÀ £o-P-ÎÀ ÷©¾® •ß-÷Ú-Ø-Ó-P-µ-©õÚ £[-P-Î-¨ø£ ö\´-²-®. JÊ-[S •øÓ¯õÚ öuõÈ-¼h P¸-z-u-µ-[-S-P-øͨ £z-v-›-øP

Gß-£-ÁØøÓ Ai¨-£-øh-°À öPõsk J¸ |øh-•-øÓU ÷Põ-øÁø¯ C¯Ø-Ô-¯x. ÷PõøÁ,1998B® Bs-iß Fh-Pa-_-u¢-v-µ® \‰-P¨ ö£õ-Ö¨¦ £Ø-Ô¯ öPõ-Ê®¦ ¤µ-P-h-Úz-vßuzx-Á[-P-øÍ-²® P¸z-vØ öPõs÷h u¯õ-›U-P¨-£m-i-¸¢-ux.Fh-P-Â-¯»-õͺ-PÒ uõ® ¤ß-£Ø-Ó-öÁÚ J¸ öuõ-Sv ÁÈ-Põm-hÀ-PøÍU öPõs-i-¸¨-£-xhß,SØ-Ó-Â-¯À AÁ-y-Ö \m-h[-PÒ µz-xa ö\´-¯¨-£-k-Á-uØS ©õØ-ÓõP CÆ-Á-È-Põm-hÀ-PøÍ J¸ _¯ JÊ[-S-£-kz-uÀ ö£õ-Ô-•-øÓ-ö¯õß-Ôß ‰»-©õP A•À-£-kzu ÷Ásk-ö©ßÖöPõ-Ê®-¦¨ ¤µ-P-h-Úz-vÀ J¨-£-ªm-h-Áº-PÒ ÁÇ[-Q¯ EÖ-vö©õ-Èø¯ |øh-•-øÓU ÷PõøÁ HØ-ÖU-öPõs-hx. Cu-øÚU ÷Põ-›-¯-Áº-PÒ ö£õ-x-©U-P-Ю Aµ-]-¯Ø -u-ø»-Áº-P-Ð-©õ-Áº.2002B® Bs-iÀ SØ-Ó-Â-¯À AÁ-y-Ö \m-h[-PøÍ £õ-µõ-Ð-©ß-Ó® J¸-©-Ú-uõP µz-xaö\´-ux.÷£µz-vß ©Ö-¦-Óz-v-¼-¸¢u £z-v-›øP B]-¯º \[-P® ÷Põ-øÁø¯ E¸-ÁõU-S-Á-ußÁÈ-÷¯ u©-x £õ-Pzøu Cm-k -{-µ¨-¤-¯x. ÷Põ-øÁø¯ |øh-•-øÓ¨-£-kz-x® ÁøP-°À C»[-øP¨ £z-v-›øP •øÓ¨-£õmk BønU-S-ÊøÁ ¦v-uõP E¸-ÁõU-P¨-£mh C»[-øP¨ £z-v-›øP{Ö-Á-Ú® HØ-£-kz-v-¯x.£z-v-›øP B]-›-¯º \[-Pz-vß ÷Põ-øÁ-²® C»[øP £z-v-›øP •øÓ¨-£õmk BønU-S-Ê-Ä®\m-h¨-£-i-¯õÚ £z-v-›-øP¨ ÷£µ-øÁa \m-hz-vß RÌ ÷PõøÁ |øh-•-øÓ¨-£-kz-u¨£k-Á-øu{µõ-P-›z-x- Âm-hÚ. Az-x-hß, £z-v-›-øP¨ ÷£µ-øÁ-°ß ö\¯Ø-£õ-k-PÒ •i-ÄUSU öPõsk-Á-µ¨-£mkAx 2002CÀ ö\-¯Ø-£õm-iøÚ {Öz-vU öPõs-hx.Cß-øÓ¯ {ø»:& £z-v-›øP B]-›-¯º \[P ÷PõøÁ ¤µ-©õ-n[-P-Îß £i Bs-iØS J¸-u-høÁ AuøÚ«Íõ´Ä ö\´-uÀ ÷Ás-k®. ÷PõøÁ «Íõ´Ä ö\´-¯¨£h ÷Ás-k-÷© uµ, Pm-hõ-¯-©õP«Íõ´Ä ö\´-¯¨-£h ÷Ás-k-ö©ß-£-ußÖ. GÆ-Áõ-Óõ-°-Ý®, \[-Pz-v-ÚõÀ 2002B® Bs-i-¼-¸¢x •øÓ¨-£-i-¯õÚ J¸ B´Ä |øh-ö£Ø-Ó-÷u-°Àø». 2005B® Bsk K´-Ä-ö£ØÓ }v-¯-µ-\ºQÔì-÷uõ-£º õ-©¢-v› uø»-ø©-°À ÷PõøÁ «Íõ´-ÄU SÊ-øÁ \[-P® {¯-ªz-ux. õ-©¢-v›\º-Á-÷u\ }v-©ß-Ôß K´-Ä-ö£ØÓ xønz -u-ø»-Á-¸®, £z-v-›øPa _u¢-v® £Ø-Ô¯ B´-Ä-PøÍ GÊv öÁ-Î-°-k-£-Á-¸-©õ-Áõº. CU-S-Ê-ÂÀ £» •U-Q¯ ¤µ-•-Pº-P-Ю, £z-v-›-øPzx-øÓ¨¤µ-•-Pº-P-Ю C¸¢-u-Úº. ÷Põ-øÁUS AÁ-]-¯-©õÚ v¸z-u[-PøÍ Âu¢-x-øµU-S®-£i AÁº-PÒ ÷Pm-P¨-£m-i-¸¢-u-Úº.÷PõøÁ «Íõ´-ÄU-SÊ \¢-v¨-¦-PøÍ ÷©Ø-öPõsk P¸z-x¨ -£-›-©õ-ÓÀ-P-ÎÀ Dk-£m-h-uõ-°-Ý®, Cµsk Bs-k-PÒ Ph¢-x® Âu¨-¦-øµ-PÒ Gu-øÚ-²® •ß-øÁU-Põ-v-¸¢-ux. Cu-ÚõÀ,«Íõ´-Äa ö\¯ß-•øÓ uõ-©-u¨-£-kz-u¨-£m-hx. 2007CÀ £z-v-›øP B-]-›-¯º \[-P® £z-v-›øP •øÓ¨-£õmk BønU-S-Ê-ÄUS ÷Ás-k-÷PõÒ Jß-ÔøÚ Âkz-ux. Auõ-Áx, Âu¨-¦-øµ-P-øÍ ö\´-Á-uØ-öPÚ Cøn ÷PõøÁ «Íõ´-ÄU-SÊ Jß-ÔøÚ {¯-ªU-S-©õÖ ÷Pm-kU-öPõshx.C¢u CønU-S-Ê-ÄUS u©-x B÷»õ-\-øÚ-PøÍ ÁÇ[-S-©õÖ ö£õ-x-©U-PÒ ÷Pm-P¨-£m-i-¸¢-u-Úº. C¢-{-ø»-°À, u®-©õÀ AÔUøPö¯õß-ÔøÚ \©º¨-¤UP •i¯õ-v-¸¨-£-uõ-P}v-¯-µ-\º õ-©¢-u› £z-v-›øP •øÓ¨-£õmk BønU-S-Ê-ÄUS AÔ-Âz-uõº.C÷u-÷Á-øÍ, £z-v-›øP B]›-¯º \[-P® uÚ-x EÖ¨-¤-Úº-PøÍU öPõs-h ÷PõøÁ «Íõ´-ÄUSÊ-öÁõß-ÔøÚ Aø©zx, QøhU-P¨-÷£õ-S® Âu¨-¦-øµ-PøÍ B´Äö\´x \[-Pz-vØS AÔUøP-ö¯õß-ÔøÚa\©º¨-¤U-S-©õÖ ÷Pm-i-¸¢-ux. Auõ-Áx, ÷Põ-øÁUS v¸z-u[-PÒ AÁ-]-¯-©õ GÚ AÔUøP u¸®-£i ÷Pm-P¨-£m-h-x.£z-v-›øP B]-›¯º \[-Pz-vß ÷PõøÁ «Íõ´-ÄU-SÊ ÷©Ø-öPõs-i-¸¢u |h-Á-iU-øP-P-ÎÀJßÖ, IU-Q¯ Cµõa-]-¯z-vß £z-v-›øP B]-›-¯º-PÒ ÷PõøÁ SÊ-Âß ö\¯-»õÍ-µõÚ v¸.- C-¯ß ¥Àì AÁº-PøÍ C»[-øPUS AøÇU-S-©õÖ C»[-øP¨ £z-v-›øP {Ö-Á-Úzøu ÷Põ-›-¯ø©-¯õ-S®.v¸. C¯ß ¥Àì £z-v-›øP B]-›-¯º \[-Pz-vß xøÓ-\õº |øh-•-øÓU ÷Põ-øÁ-²-hß|ßS £›m-]-¯® Eøh-¯-Áº Gß-£-x-hß, C»[øP £z-v-›øP •øÓ¨-£õmk BønUSÊøÁ E¸-ÁõU-S-Á-v-¾® Eu-Â-¦-›¢-u-Á-µõ-Áõº.v¸.- ¥Àì 2007 AU-÷hõ-£º 16B® vP-v öPõ-Ê®¦ Á¢x, J¸-Áõ-µ- Põ-»® u[-Q-°-¸¢x÷Põ-øÁ «Íõ´-ÄU SÊ-Â-Ú-øµ-²®, ÷ÁÖ- £-»-øµ-²® \¢-vz-uõº. AÁº-P-ÐÒ £z-v-›øP•øÓ¨-£õmk Bøn-¯-Pz-vß uP-µõ-Ö-P-Îß wº-ÄU-PõÚ \ø£-°ß uø»-Áº, EÖ¨-¤-Úº-PÒ,53

£À-÷ÁÖ F-h-P¨ ¤µ-v-{-v-PÒ, C»[øP°À £o-¦-›-²® Fh-P-¯-»-õͺ \[-Pz-vß ¤µ-v-{-v-PÒ Gß-÷£õ-øµ-²® \¢-vz-v-¸¢-uõº.v¸.- ¥ÀìU-S®, ÷PõøÁ «Íõ´ÄU SÊ-ÄU-S-ª-øh÷¯ |øh-ö£ØÓ Eøµ-¯õhÀ-PÒ £¯ÝÒÍøÁ-¯õPC--¸¢-uÚ. AÁº uÚx |õm-iØSz v¸®-¤¯ ¤ß, SÊ-Âß ÷Ás-k-u-¼ß Põ-µ-n-©õPuÚ-x ]£õº-_-PøÍ Aݨ-¤- øÁz-v-¸¢-uõº. AÁ-µ-x AÔUøP, «Íõ´-ÄU SÊ-Â-ÚõÀ |ßS £›-^-¼U-P¨-£m-h-x-hß Ax ¤ß-Á-¸® Âu¨-¦-øµ-P-Ð-hß \[-Pz-vß EÖ¨-¤-Úº-P-Îß A[-Q-Põ-µz-vØ-öPÚ \©º¨-¤U-P¨-£m-hx.÷Põ-øÁ-°À ö\´-¯¨-£-hU-T-i¯ ©õØ-Ó[-P-ÐU-PõÚ ]£õº-_-PÒ:÷Põ-øÁ-¯õ-Úx Bsk ÷uõ-Ö® «Íõ´-ÄU-Sm-£-kz-u¨-£-h-ÂÀø» Gß-£x Á¸z-uz-vØ-S-›-¯-÷u-¯õ-°-Ý®, Ax J¸ ÷£µõ-£zx AÀ». «Íõ´Ä ö\´-¯¨-£h ÷Ás-k-ö©ßÓ ÷Põ-›UøP ©õØ-Ó[-PÒ uõ-©õ-P÷Á |øh-ö£-Ó- ÷Ás-k-ö©ßÓ Aºz-u® öPõs-h-uÀ». v¸z-u[-PÒ Gß-£ÚCmk {µ¨-£¨-£h ÷Ás-i¯uõÚ vm-h-Ám-h-©õÚ \õß-Ö-PÒ C¸¢-uõÀ ©m-k÷© ÷©ØöPõÒͨ-£-h-»õ®.SÖ-Q-¯ Põ-»¨-£-S-vU-SÒ £Ø-£» v¸z-u[-PÒ Ch®-ö£-Ö-©õ-°ß,uk-©õØ-Ózøu HØ-£-kz-x®. wºU-P-©õÚ •i-Âß-ø©ø¯U SÔz-xU Põm-k-Á-uõP C¸U-S®. AøÁ HØ-P¨-£-hõ-©-¾® ÷£õ-S®.£z-v-›-øP¨ ÷£µ-øÁ-°ß CønU-SÊ •ß-øÁzu P¸z-xU-P-ÎÀ A-h[-Q-°-¸¢u B÷»õ-\-øÚ-PÒus-iU-S® ÷|õU-S-øh-¯-Ú-ÁõP Põ-n¨-£m-hÚ. (-£z-v-›-øP¨ ÷£µ-øÁ-°ß •ß-øÚ¯B÷»õ-\-øÚ-PÒ •µs-£mk {-Ø-QßÓ B]-›-¯º-P-ÐUS £õ-h[ -PØ-¤¨-£øu ÷|õU-P-©õPUöPõsk Áøµ-¯¨-£m-i-¸¢-uÚ. Ax \›-¯õÚ Aq-S-•-øÓ-¯õP C¸UP •-i-¯õx GßÖ |õ® P¸-v-÷Úõ®. ÷PõøÁ Auß \õ-µõ®-\z-v-÷»÷¯ Ps-i¨¦ {øÓ-¢-u-uõP C¸-¢-v-¸-¢-u-x. AuøÚ A•Àö\´-¯-¨-£-hõu {ø»°¸¢-uõÀ, {º¨-£¢-u® HØ-£-kz-u¨-£mh ¤ß-Úº CnU-P¨-£õmøh HØ-£kz-x®{ø» ÷£µ-øÁUS HØ-£mk C¸U-S®)÷Põ-øÁ°À ©õØ-Ó[-PÒ ö\´-²® Âh-¯z-vÀ P¸z-vÀ öPõÒͨ-£h ÷Ás-i-¯øÁ:&1. £z-v-›-øP¨ ÷£µ-øÁ-°ß Jz-x-øǨ-ø£U ÷Põ-¸-Á-uõÚ ¤µ-©õ-n® JßÖ •P¨-¦- Áõ-\-Pz-vÀ ÷\ºU-P¨-£-hÀ ÷Ás-k®. IU-Q¯ Cµõa-]-¯z-vß ÷Põ-øÁ-°À C÷u-÷£õßÓ J¸ £SvPõ-n¨-£-k-Q-Óx. Ax C÷uõ: •øÓ¨-£õ-k-PøÍz wºzx øÁ¨-£-vÀ £z-v-›øP B]-›-¯º-PÒ£z-v-›-øP¨ ÷£µ-øÁ-²-hß Jz-x-øÇz-uÀ ÷Ás-k®. ÷Põ-øÁø¯ «Ö® Âuz-vÀ ¤µ-_-›U-P¨-£m-i-¸¨-£-uõPU P¸-u¨-£-k® H÷u-Ý® JßÖ Âh-¯z-vÀ Ax öuõ-hº-£õÚ wº¨¦ JßÖ •Êø©-¯õ-P-Ä®,E›-¯ •U-Q-¯z-x-Áz-x-h-Ý®, £z-v-›-øP¨ ÷£µ-øÁ-ø¯U SÔz-xU-Põmk®uø»¨¦ Ch¨-£mh {ø»-°-¾® ¤µ-_-›U-P¨-£-k-uÀ ÷Ás-k®. Cx C»[-øP¨ £z-v-›øP B-]-›-¯º-P-Îß JÊU-P-ö|-ÔU Ph¨-£õ-hõP HØ-P-Ú÷Á C¸¢x Á¸-Q-Ó-uõ-°-Ý®, Cx ÷Põ-øÁ-°-ÝÒ CønU-P¨-£-h-ÂÀø».1. (A) \º-Á-÷u-\zøu öuõ-hº-¦-£-kz-x®.... \º-Á-÷u\ Fh-P-Â-¯À E¯º uµz-vøÚ ÷£q®A÷u÷ÁøÍ GßÓ Á›ø¯ B[-Q» ‰»z-v-¼-¸¢x APØ-Ó-Ä®, \º-Á÷u\ Fh-P-Â-¯À |øh-•-øÓ£Ø-Ô¯ E¯º-u-µ® £ØÔ K-µÍÄ P›-\øÚ Es-öh-Û-Ý®, G©-x |õm-iß E¯º uµzøu |õ®÷£q® {ø»-°À AuøÚ |õ® EÒÍ-hU-Põx Âh-»õ®. ][-PÍ ö©õÈ Eøµ¨-£-S-v-°À Cx SÔzv-¸U-P¨-£-h-ÂÀ-ø».2. C-»[-øP-°À J¸ •U-Q-¯-©õÚ Âh-¯-©õPU PoU-P¨-£-k® uØ-öPõø» £Ø-Ô¯ö\´-v-PøÍ öÁ-Ψ-£-kz-x® ÷£õx ]» Pm-k¨-£õ-k-PÒ ÷uøÁ. As-ø©-°À IU-Q¯ Cµõa-]-¯z-vß ÷PõøÁ ¤ß-Á-¸-©õÖ v¸z-u¨-£m-hx. uØ-öPõø» £Ø-Ô¯ ö\´-vø¯ öÁ-Î-°-k®-÷£õx, Ax GÆ-ÁõÖ {PÌz-u¨-£m-hx Gß-£øu ªøP-¯õP £-›z-uÀ uºU-P¨-£h ÷Ás-k®.3. ÷Põ-øÁ-¯õ-Úx, ÂÍU-P -÷Á-Ö-£õ-k-P-Ð-h-ÚõÚ ö\´v öÁ-Î-±-k-PÒ Âh-¯z-vÀöuõ-h-µ-Óõ Cøn-¯ ÷\øÁ ©Ø-Ö® £z-v-›-øP-P-ÐUS ¤µ-÷¯õ-QU-Pz uU-Px. Az-xhß,¤Ó öuõ-h-µ-Óõa ÷\øÁ-P-øÍ Âg-]¯ uõº-«P AÝ-T-»[-P-øÍ-²® ÁÇ[-S-Q-Óx Gß-£vÀöu-Î-Áõ-°-¸z-uÀ ÷Ás-k®.54

4. ÷Põ-øÁ-¯õ-Úx, SÔ¨-£õP Áøµ-¯-Â-¯À ö\´v öÁ-Î-±k, £h[-PÒ Gß-£-ÁØøÓ EÒÍhU-S®Âuz-vÀ ›-ÁõU-P® ö\´-¯¨-£-hÀ ÷Ás-k® Gß-Ó -Á-øP-°-»õÚ B÷»õ-\-øÚ-PÒ£» uµ¨-£m-kÒÍÚ. GÆ-Áõ-Óõ-°-Ý®, Ca-]U-P-»õÚ ÂÁ-Põ-µ® ÷Põ-øÁ-°-¾ÒÍ 6:1¤µ-©õ-nz-v-ÚõÀ Bͨ-£mk Á¸-Á-x SÔ¨-¤-hz-uU-Px. Cuß ¤µ-Põ-µ® ö\´-vz- uõÒ-PÒE›-¯ uP-ÁÀ-PøÍ ö£õ-x-©U-PÒ |»ß -P-¸-v÷¯ öÁ-Î-°h ÷Ás-k-ö©ß-£-uØ-P-ø©-ÁõPE›-¯ Enºa] öÁ-Ψ-£õ-k-P-Ð-h-Ý® uØ-x-o-Ä-h-Ý® öÁ-Î-°-k®.5. uªÌ¨ £¯[-P-µ-Áõu SÊU-P-Îß Áß-•-øÓ-P-Îß Av-P-›¨-÷£õk uª-Ǻ-P-ÐU-öP-v-µõÚ £z-v-›øP ©º-\-Ú[-PÒ Av-P-›z-v-¸¨-£-x- £ØÔ uªÌ¨ £zv-›-øP-PÒ SÔ¨-¤mk Põs-¤z-u ÂÁ-Põ-µ[-PÒ PÁ-Úz-v-ö»-kU-P¨-£m-kÒÍÚ. C¸¢-x®, CÆ-Â-h-¯® ÷Põ-øÁ-°ß¤µ-©õ-n® 6.3CÀ EÒÍhU-P¨-£m-kÒÍx. Auß-£i, öu›¢x öPõs-÷hõ, ÷Ás-k-ö©ß-÷ÓõCÚ, ©u ÷ÁÖ-£õ-k-P-øÍ-÷¯õ Áß•øÓ-P-øÍ-÷¯õ ys-i-Â-k-uÀ uøh ö\´-¯¨-£m-kÒÍx. Azx-hß,¤µ-©õ-n® 6.4 IE®, 6.4II E® CÚ[-PÒ, ©u[-PøÍ ÷\º¢u uÛ¨-£m-h-Áº-P-Îßö£¯ºPøÍU SÔ¨-¤mk S¢-u-P® ÂøÍ-ÂU-S® ö\´-v-PÒ öÁ-Î-°-h¨-£-k-Áøuz uøhö\´-Qß-ÓÚ. C-Úz-x-ÁU SÊU-PÒ AøÚz-x÷© C[S ö£õ-x-ÂÀ SÔU-P¨-£-k-Qß-ÓÚ. uÛz-u-Û-¯õP CÚ[-PÒ SÔzx S-Ô¨-¤-h¨-£-hõ-ø©ø¯ SÔz-xU -öPõÒ-Ð-uÀ ÷Ás-k®.6. ÷Põ-øÁ-°ß }Í® £ØÔ¯ Âh-¯® P¸z-vÀ öPõÒͨ-£-hÀ ÷Ás-k®. ©º-\-Pº-PÒ ]»ºCuß }Í® ªP Av-P-©õP EÒÍ-uõPU TÖ-Qß-Ó-Úº. ÷ÁÖ® ]»º ÷©¾® vm-h-Ám-h©õPC¸U-S® Âuz-vÀ ÷PõøÁ ›-ÁõU-P¨-£-hÀ ÷Ás-k® GÚ TÖ-Qß-Ó-Úº IFJ ÷Põ-øÁ-¯õ-Úx JÊU-P-ö|-Ô-£Ø-Ô-¯x. AÔ-•-øÓ Ÿv-°-»õ-Úx. |øh-•-øÓ -Ÿ-v-°-»õ-Ú-ußÖ. Au-ÚõÀ wº¨¦ ÁÇ[-S® Ph¨-£õ-hØ-Óx. G©-x £z-v-›-øP-¯õ-]-›-¯º ÷PõøÁ C»[-øP-°ß S-Ô¨-¤mh `Ç-ø©-Ä-P-ÐU-÷PØ-£-Ä®, wº¨¦ ÁÇ[-S® ö£õ-Ö¨-¦ÒÍ-uõ-P-Ä®, ¤Ó Cx-÷£õßÓ ÷Põ-øÁ-P-Î-ÝÒ ]Ô-¯uõ-P-Ä® u¯õ-›U-P¨-£mh JßÖ. CuøÚ ÷©¾® }m-k-ÁxEP¢-uuÀ».* B°-Ý®, AiU-Pi Gʨ-£¨-£-k® ÂÚõU-P-ÐUS Âøh-¯-ÎU-S® ÁøP-°-¾®, •ß-øÚ¯ £zv-›øP÷£µ-øÁ-°ß wº¨-¦U-PÒ AÝ-£-Á[-P-Îß Ai¨-£-øh-°-¾® \ØÖ Â›-ÁõÚ J¸- Cøn¨¦£ØÔ B-÷»õ-]UP •i-²®. Az-u-øP¯ ]Ø-÷Ók ÷£µ-øÁ°ß J¸ Cøn-öÁ-Î-±-hõP C¸¨-£-x-hßAv-P® ÷Ás-h¨-£-k® wº-Ä-PøÍz u¸-Á-uõ-P-Ä® C¸z-uÀ ÷Ás-k®. Az-u-øP¯ BÁ-nö©õß-ÔøÚ(FAQ) £z-v-›øP B]-›-¯º-PÒ, Fh-P-Â-¯-»õͺ-PÒ BQ÷¯õº ÷Põ-øÁ-°ßHØ-£õ-k-PÒ £z-v-›-øP

\-øÚ-PøÍ ö£Ö® Â-uz-vÀ A-v-P Av-Põ-µ[-P-Ð-h-ÚõÚ SÊ-öÁõß-ÔøÚ {¯-ªU-S-©õÖ÷Põ-øÁU-SÊ ]£õº_ ö\´-Q-Ó-x. ¦v¯ ÷Põ-øÁU -S-Ê-Áõ-Úx uÚ-x EÖ¨-¤-Úº-P-Ð-hß,EÖ¨-¤-Ú-µÀ-»õ-u-Áº-PøͲ® Cønz-xU-öPõÒÍU- T-i¯ _u¢-v-µ-©õÚ SÊ-ÁõP C¸U-S®.E-£õ¼ öuß-ÚU-÷Põß,]Ô -µ-n-][-P,][-P -µm-Ú-x[P,ám-i-»õ öÁÀ-»-ö£õh,©ÛU j ]À-Áõ,H.]-Á-÷|-\a-ö\À-Áß,Ÿ.S-¸-ÂØÓ £s-hõµ,Ã.÷u-Á-µõä.áÚ-Á-› & 2008,yq;if gj;jphpif Mrphpah; rq;fk;njhopy;rhh; eilKiwf; Nfhit• rhpahd jfty;fs;• ek;gfkhd %yq;fs;• jdpj;Jtkhd nfsutk;• ,ufrpaj;jd;ik56

,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOtpdhy;eilKiwg;gLj;jg;gl;Ls;s ,yq;ifr; nra;jpMrphpah;fSf;fhd njhopy; eilKiwf;Nfhit(xOf;ff;Nfhit)1. Kd;Diuvy;yhg; gj;jphpif epWtdq;fSf;Fk; mtw;Ws; gzpahw;Wk; gj;jphpifahsh;fSf;Fk; nghUe;Jk; tifapyhd ,e;j xOf;ff;Nfhit ,yq;ifapd; mr;RClfq;fs; Rje;jpukhf nraw;gl;L mjd; thrfh;fsJ Njitfs; kw;Wk;vjph;ghh;g;Gf;fis rhpahfTk; nghWg;Gzh;r;rpAlDk; Nkw;nfhs;sNtz;bapUgg;NjhL gj;jphpifj; njhopy;Jiwapd; Nkd;ikiaAk; rpwe;jjuhjuj;ijAk; ghJfhf;Fk; Nehf;fj;ij Fwpf;Nfhshff; nfhz;lJkhFk;gpioaw;w jd;ik kw;Wk; njhopy; Neh;ik mj;Jld; nghJ eyDf;fhfGydha;T nra;jy;> gj;jphpifj; njhopypd; jiy rpwe;j gd;ghLfisg;NgDtjw;fhfg; gj;jphpiffs; risf;fhJ Kaw;rpnaLj;Jg; gj;jphpifr;Rje;jpuj;jpw;F vjpuhfr; rjp nra;Ak; jphpGgLj;Jk; th;j;jfr; rhh;G my;yJxOq;fw;w jhf;fk; my;yJ FWfpa Nehf;fk; Mfpatw;wpdhy; tpyq;fplg;glhky;,Uf;f Ntz;Lk; vd;gtw;iwAk; ,j;juq;fs; Njitg;gLfp;d;wd. gj;jphpiffSk;Clftpayhsh;fSk; Rje;jpukhfj; jk; nrhe;jf; fUj;Jf;fisf; nfhz;bUf;fTk;jkJ jplkhd fUj;Jf;fis jhuhskhf ntspaplTkhd Rje;jpuj;ijnfhz;Ls;s mNj Ntisapy; mth;fs; Vidath;fspd; fUj;Jf;fSf;F chpaftdk; nrYj;jp jkJ r%fg; nghWg;gpid gpujpgypf;f Kaw;rp vLf;f Ntz;Lk;.,f;Nfhit jdp egh; chpikfisg; ghJfhj;J nghJkf;fs; nra;jpfis mwpe;Jnfhs;Sk; chpikiaj; jhq;fp epw;fpwJ. mJ vOj;jpy; kl;Lky;yhJcl;fUj;jpYk; kjpf;fg;gl Ntz;Lk;. mjhtJ jdp egh; chpikfs; njhlh;gpy;mjd;

• VNjDk; Kiwg;ghLfs; njhlh;gpy; gj;jphpif Kiwg;ghl;Lmzif;FOtpd; jPh;khdq;fSf;F gj;jphpif Mrphpah;fs; Jhpjkhfxj;Jiog;G toq;f Ntz;Lk;. ve;jnthU gpuRuKk; gj;jphpif jh;kj;ijkPWtjhf jPh;g;gspf;fg;gLkplj;J mjid KOikahfTk; Kf;fpaj;Jtk;nfhLj;Jk; gj;jphpif Kiwg;ghl;L mizf;FOtpd; Fwpg;Gld; gpuRhpf;fNtz;Lk;.2. rhpahd nra;jp2.1 nra;jpfs; kw;Wk; glq;fisr; rhpahfTk; jphpGgLj;jy; ,d;wpAk;mwptpf;f vy;yh Clfq;fSk; rfytpjj;jpYk; epahakhd ftdk;nrYj;j Ntz;Lk;2.2 gpuRhpg;gjw;F Kd; nra;jp mwpf;iffs; rhpahditah vd;gijcWjpg;gLj;jpf; nfhs;tjw;fhf rfy nra;jp Mrphpah;fSk;jdpg;gilahd Clftpayhsh;fSk; epahakhd vy;yh Kaw;rpfisNkw;nfhs;s Ntz;Lk;. mg;gb cWjpg;gLj;jpf;nfhs;s Kbahjtplj;Jme;j epiy gw;wpr; nra;jp mwpf;ifapy; Fwpg;gpl Ntz;Lk;.2.3 nra;jp Mrphpah;fSk; mth;fsJ gzpahl;njhFjpapdUk;Gwg;gq;fspg;ghsh; cl;gl jhk; mwpe;jtiu ngha;ahdJ my;yJgpioahdJ vd ek;gf;$ba fhuzk; cs;s ve;jnthUtplaj;ijAk; MNkhjpf;Fk; tpjj;jpy; mwpf;iffisg; gpuRhpf;fNtz;lhk;2.4 nghJ eyd; fUjp Gydha;T Clf eltbf;iffspy;

5.1 jftiyg; ngw;Wf;nfhs;s ,ufrpakhd %yq;fis> mk; %yq;fs;khwhf mDkjpj;jhyd;wp ghJfhg;gjw;F xt;thU ClftpayhsUk;nghJthff; flikg;gl;Ls;sdh;.6 nghJthd nra;jp mwpf;if kw;Wk; vOj;jpy; tbj;jy;6.1 mf;fpukk;, td;nray;fs;, xsljq;fspd; J\;gpuNahfk;,nfh^uj;jd;ik gpwUf;F Nehtpid nra;jy;, fhkk; kw;Wk; xOf;ff; NfLNghd;w Fwpg;ghf mjph;r;rpA+l;Lk; mj;Jld; czh;Tfspy; NehtpidiaVw;gLj;Jk; Rghtj;ijAila r%fg; gpur;rpidfisg; gw;wpa tplaq;fs;njhlh;ghf mr;R Clfk; nghJ eyd; fUjpr; nra;jpfisg; gpuRhpf;Fk;mjd; flikf;fika cz;ikr; rk;gtq;fs; fUj;Jf;fs; Gifg;glq;fs;kw;Wk; rpj;jpuq;fis chpa czh;TlDk; tpNtfj;JlDk; rkh;g;gpf;ftpN\l ftdk; vLf;f Ntz;Lk;.6.2 Fw;wr; nray;fs; my;yJ Fw;wr; nray; tof;F gw;wpa tplaq;fismwptpf;Fk;NghJ rl;lj;jpdhy; mDkjpf;fg;gl;L kw;Wk; nghJ eyd; fUjpmy;yhky; gpd;tUtdtw;iwg; gpuRhpf;ff; $lhJ.• ghypay; Fw;wr; nraypdhy; ghjpf;fg;gl;lthpd; ngah;• Fw;wr; nray; gw;wp Fw;wk; rhl;lg;gl;l 16 taJf;Fl;gl;l kw;Wk; Kd;Gjz;liz mDgtpj;jpuhj ,sk; tajpdh; xUthpd; ngaiuNtz;Lnkd;Nw Fwpg;gply;• Fw;wr; nranyhd;Wf;fhf my;yJ jz;lid toq;fg;gl;Ls;s xUthpd;cwtpdh;fis mth;fsJ rk;kjk; ,d;wp ,dk; fhz;gpj;jy;.6.3 Clftpayhsh; xUth; jhk; mwpe;jpUe;Jk; my;yJ Ntz;Lnkd;Nw,d> kj> hPjpahd Kuz;ghLfSf;F toptFf;Fk; tifapy; rkaxw;Wikapd;ikia my;yJ td;nray;fisj; J}z;Lk; tifapy; jkJvOj;Jf;fisf; ifahsf;$lhJ.6.4. i xUthpd; Fyk;, epwk;, kjk;, ghypay; my;yJ VJnkhU cly;my;yJ gytPdk; gw;wpj; jg;ggpg;gpuhaj;ij Vw;gLj;jf;$ba my;yJmepahakhff; Fwpg;gpLtjpy; ,Ue;J Clfk; jtph;e;J nfhs;sy; Ntz;Lk;.ii .nra;jpAld; Neubahf njhlh;G mw;w gl;rj;jpy; xUthpd; Fyk;, rhjp,kjk;, ghypay; rha;T, cly; my;yJ kdNeha; my;yJ FiwghL gw;wpatptuq;fis gpuRhpj;jy; jtph;f;fg;gl Ntz;Lk;.6.5 (i) rl;lk; jLf;fhj NghjpYk; gpurpj;jkhf gpuRhpf;f Kd; Kw;$l;bj;jkf;F fpilf;Fk; jftiyj; jd; nrhe;j epjp ,yhgj;jpw;fhfClftpayhsh;fs; ghtpf;ff; $lhJ vd;gNjhL Vidath;fspd;,yhgj;jpw;fhf mj;jifa jftiy toq;fTk; $lhJ.(ii) jhd; my;yJ jdJ neUq;fpa cwtpdh;fs; fzprkhd msT epjpgw;wpa rpuj;ij nfhz;Ls;sjhfj; jhd; mwpe;jpUf;Fk; gq;Ffs; my;yJcWjpg; gj;jpuq;fs; gw;wp jd; rpuj;ijia nra;jp Mrphpah;fs; my;yJepjpr; nra;jp Mrphpah;fSf;F mwptpf;fhky; vOjf; $lhJ.• jw;nfhiy njhlh;ghd nra;jpfs; gpuRhpf;fg;gLk; nghOJmjidf; ftdkhf ifahStJld; vt;thW jw;nfhiyNkw;nfhs;sg;gl;lJ vd;gJ njhlh;ghd tpguq;fis gpuRhpj;jy;jtph;f;fg;gl Ntz;Lk;.59

7 ,ufrpaj;jd;ik7.1 jdp egh;fspd; Vfhe;jk; kw;Wk; FLk;g tho;f;if mth;fspd; tPl;Ltptfhuq;fs;> cly; eyd; kw;Wk; fbjg; Nghf;Ftuj;Jf;fs; Mfpatw;iwkjpg;gjpy; Clfk; Fwpg;ghff; ftdQ; nrYj;j Ntz;Lk;. nghJ eyd;kpiff;Fk; NghJ khj;jpuNk rk;kjk; ,d;wp ,j;jifa Vfhe;jkhdtplaq;fspy; jiyapLtij epahankdf; nfhs;syhk;.7.2 nghJ eyDf;fhftd;wp jdpahh; my;yJ gpurpj;j ,lq;fspy;epahakhf Vfhe;jj;ij vjph;ghh;f;f my;yJ Vw;Wf;nfhs;s Kbahjitjtph;j;J rk;kjk; ,d;wp kdpjh;fisg; Gifg;glk; vLg;gjw;fhf njhiyNehf;F (ngUg;gpf;Fk;) fz;zhbfis (nyd;];) fis my;yJ Gifg;glf;fUtpfisg; ghtpj;jy; jtph;f;fg;gl Ntz;Lk;.7.3 Jf;fk; my;yJ mjph;r;rp rk;ge;jg;gl;l tplaq;fspy; tprhuizfs;my;yJ jiyapLtij czh;TlDk; tpNtfj;JlDk; Nkw;nfhs;tjpy;ftdk; nrYj;j Ntz;Lk;.7.4 ,sk; tajpdh; jk; ghlrhiyg; gUtj;ij mehtrpakhd jiyaPL,d;wpg; G+uzg;gLj;Jk; Rje;jpuj;ijf; nfhz;bUjy; Ntz;Lk;. xUgps;isapd; Vfhe;j tho;f;ifiag; gw;wp mr;rpWtdpd; my;yJmr;rpWkpapd; FLk;gk; my;yJ ghJfhtyhpd; gpugy;ak;, nfl;l ngah;my;yJ gjtp Mfpatw;iwf; ftdpahJ myhjpahdnjhU nghJ eyd;,Ue;jhy; khj;jpuNk nra;jpiag; gpuRhpj;jy; Vw;Wf; nfhs;sf;$bajhf,Uf;Fk;.7.5 nghJ eyDf;fhftd;wp itj;jparhiyfs; my;yJ mj;jifaepWtdq;fspy; cs;sth;fs; gw;wp Nkw;nfhs;sg;gLk; tprhuizfs;Vfhe;jj;jpy; jiyapLtJ gw;wpa ,f;fl;Lg;ghLfSld; Fwpg;ghf,izahditahFk;.8. njhe;juT kw;Wk; je;jpNuhghak;8.1 Gifg;gl Clftpayhsh;fs; cl;gl Clftpayhsh;fs; mr;RWj;jy;my;yJ njhe;juT nra;jy; my;yJ jphpj;Jf; $wy; %yk; my;yJje;jpukhd topfiyf; fiahz;L jftiy my;yJ Gifg;glq;fisg;nghw;Wf;nfhs;s KayyhfhJ. nghJ eyd; my;yJ tplaj;ijg;ngw;Wf;nfhs;s NtW topapy;iy vd;w epahak; ,y;yhky; njhiyNehf;F fz;zhb (]_k; nyd;];) Gifg;glf; fUtpfisg; my;yJxw;Wf;Nfl;Fk; fUtpfisg; gad;gLj;jf; $lhJ.9 nfsutk;9.1 xt;nthU ClftpayhsUk; mtdJ my;yJ mtsJ njhopypd; Ranfsutj;ijg; Ngz Ntz;Lk;.10 nghJkf;fs; eyd; gpd;tUtdtw;iw cs;slf;Fk;ey;yhl;rp kw;Wk; kf;fs; eyidf; fUj;jpy; nfhz;L rdehafk; kw;Wk;mbg;gil kdpj chpikfisg; ghJfhj;jy; mj;Jld; Fw;wr; nrayfs;,Coy;, eph;thf rPh;NfL my;yJ ghhpa jtnwhd;wpidf; fz;L gpbj;jy;my;yJ mk;gyg;gLj;Jjy; vd;gd mlq;Fk;.60

kPsha;TnghJkf;fs; ghJfhg;G, r%f, fyhr;rhu> fy;tp kw;Wk; nghJkf;fs;ftdj;ij

,yq;if gj;jphpif Kiwg;ghl;L Mizf;FO Nguitapd;Kiwg;ghL njhlHghd xOq;F tpjpfs;1. ,yq;ifapy; ntspahFk; gj;jphpifnahd;wpy; my;yJ rQ;rpifapy; ntspahfpanra;jp/fl;Liu Gifg;glk; my;yJ NtWk; tbtikg;G %yk; egnuhUtUf;F ghjpg;G>fsq;fk; my;yJ mePjp Vw;gl;bUg;gjhf ek;g my;yJ epahakhd Mjhuq;fSld;ep&gpf;f KbAkhapd; mJgw;wp gj;jphpif Kiwg;ghl;L Mizf;FOTf;F (,.g.K.M.F)Kiwg;ghL nra;a KbAk;. Kiwg;ghLfspd; jd;ikf;F Vw;g %d;whk; jug;gpduhy;nra;ag;gLfp;d;w Kiwg;ghLfSk; Vw;Wf; nfhs;sg;gLk;.2. mt;thuhd Kiwg;ghnlhd;iw nra;gtH jdpg;gl;l Kiwapy; gjpTj;jghy;>kpd;dQ;ry;> njhiyefy;> njhiyNgrp my;yJ NtWk; njhlHG nfhs;sf;$batopKiw %yk;> Kiwg;ghL nra;gtH; mthpd; ifnahg;gj;Jld; Kiwg;ghL nra;aKbAk;. mt;thwhd Kiwg;ghl;il mjw;Fhpa tpz;zg;gg; gbtj;Jld; mDg;gpitg;gjhapd; kpfTk; nghUj;jkhdjhFk;.3. Kiwg;ghl;lhsUf;F ghjpg;ig my;yJ fsq;fk; cz;Lgz;zpajhf fUJk;gpuRuj;jpd; gpujpiaAk; ,izj;J mDg;g Ntz;Lk;.,yj;jpudpay; mQ;ry; my;yJNtWk; ,yj;jpudpay; topfspd; Clhf Kiwg;ghL nra;tjhapd; VO mYtyfehl;fSf;Fs; mjw;Fhpa tpz;zg;gg;gbtj;ijg; ngw;W G+uzg;gLj;jp ifnahg;gj;Jld;Fwpj;j gpuRuj;jpd; gpujpNahL Mizf;FOTf;F rkHg;gpf;f Ntz;Lk;.4. gpujk epiwNtw;W mjpfhhp (gp.ep.m.) Mizf;FOthYk; gj;jphpif epWtfj;jhYk;mq;fPfhpf;fg;gl;l>gj;jphpif MrphpaHfs; rq;fj;jpd; njhopy;rhH eilKiwf;Nfhitapd;ve;jg; gphpT my;yJ gphpTfis Fwpj;j Kiwg;ghl;Lf;F fhuzkhd gpuRuk;kPwpapUf;fpd;wJ vd;gij Muha;e;J mt;thwhd kPwy; ,lk; ngw;wpUg;gpd; kl;LNkmk;Kiwg;ghl;il tprhuiz nra;tJ njhlHghf eltbf;if vLg;ghH.5. ve;jnthU gpuRuk; njhlHghd Kiwg;ghLk; me;j gpuRuk; ntspahfpa jpfjpapy;,Ue;J ,uz;L tUlq;fs; fle;jpUe;jhy; mt;thwhd Kiwg;ghl;il gp.ep.m.ghprPyizf;F vLf;f khl;lhH.6. Kiwg;ghl;il tprhuiz nra;tjw;F jPHkhdpj;J xUehisf;fhtJ Kd;djhfgp.ep.m. Kiwg;ghl;lhsUf;Fk; mNj fbjj;jpd; gpujpnahd;iw Fwpj;j gj;jphpif my;yJ62

Q;rpifapd; MrphpaUf;Fk; mDg;gp mJ njhlHghf %d;W mYtyf ehlfSf;Ff;Fiwahj fhyg;gFjpf;Fs; gjpy; xd;iwg; ngw;Wf;nfhs;s eltbf;if vLf;f Ntz;Lk;.7. Fwpg;gpl;l fhyg;gFjpf;Fs; Fwpj;j gj;jphpif my;yJ rQ;rpif my;yJ ntspaPl;bd;MrphpaH gp.ep.m.f;F gjpy; xd;iw mDg;gj; jtwptpl;lhy; mjd; ngWNgwhf miktJFwpj;j Kiwg;ghL ,.g.K.M.F. tpd; tprhuizg;Nguitapd; tprhuizf;fhfrkHg;gpg;gjhf mikAk;. vt;thwhapDk; Mrphpauhy; my;yJ mtUf;F gjpyhffUkkhw;wf;$ba xUtuhy; NkYk; fhy mtfhrk; Nfhhp epahakhd Ntz;LNfhs;xd;iw tpLj;jhy; mjid ghprPyid nra;J Nkyjpf fhyj;ij toq;f gp.ep.m.eltbf;if vLf;f Ntz;Lk;.8. mt;thW Kiwg;ghnlhd;W fpilf;fg; ngw;W kpfTk; FWfpa fhyg;gFjpf;Fs;mjhtJ tprhuiz Muk;gpf;fg;gl;l ehspy; ,Ue;J ,Uthuq;fs; flf;f Kd;dH gp.ep.m.rkhjhdg;gLj;jy; kw;Wk;/my;yJ ,zf;fg;ghL %yk; ,Ujug;gpdiuAk;ey;ypzf;fj;jpw;F nfhz;Ltu rfy Kaw;rpfisAk; vLf;f Ntz;Lk;. jpUj;pjk;nra;jy;>jpUjpjj;Jld;/my;yJ kd;dpg;Gf; NfhuYld; /my;yJ gjpyspf;f re;jHg;gk;toq;fy; my;yJ mjw;F rkkhd ,zf;fg;ghl;Lf; Fl;gl;l jhFk;. Vt;thwhapDk;,j;jifa ,zf;fg;ghnlhd;Wf;Fk; Kiwg;ghl;L tprhuizg; Nguitapd; mq;fj;jtHxUthpd; Nritiag; ngw;Wf;nfhs;s gp.ep.m. eltbf;if vLf;f Ntz;Lk;.9. Mizf;FO Kd;dpiyapy; Kiwg;ghnlhd;Wld; njhlHGgl;l cld;gLk;f;fg;ghl;Lld; njhlHGila gj;jphpif my;yJ rQ;rpif kd;dpg;Gf;Nfhuy; kw;Wk;my;yJ tUj;jj;ij ntspg;gLj;jy; kw;Wk; my;yJ gjpiy gpuRhpf;Fk; NghJ me;jgpuRuj;ij nra;tJ Mizf;FOtpd; Kd;dpiyapy; vw;gl;l ,zf;fg;ghl;bd;mbg;gilapy; vd;gij Fwpg;gpl;l gj;jphpif my;yJ rQ;rpif tpN\lkhf Fwpg;gplNtz;Lk;.10. rkhjhdg;gLj;jy; kw;Wk;, my;yJ ,zf;fg;ghl;bd; %yk; jPHnthd;Wf;FtuKbahky; Ngha; tpl;lhy; mt;thW Kbahky; Nghd jpfjpapy; ,Ue;J,Uthuq;fSf;Fs; Kiwg;ghl;L tprhuizg; Nguit (rig) me;j Kiwg;ghl;iltprhuizf;F vLf;Fk;.11. mt;thNw fpilf;Fk; Kiwg;ghnlhd;iw tprhuiz nra;tjd; %yk; nghJkf;fs;eyd; my;yJ gj;jphpifj; njhopy;Jiwapd; eyd; my;yJ Kiwg;ghl;il nra;gthpd;eyd; NkypLk; my;yJ mt;thwhd eydpy; nry;thf;Fr; nrYj;Jk; vd;W gp.ep.m.fUJkplj;Jk; mtH me;j Kiwg;ghl;il Neubahf Kiwg;ghl;L tprhuizg;Nguitf;F rkHg;gpg;ghH.12. Kiwg;ghnlhd;W njhlHghf tprhuizg; Nguitapd; jPHg;G njhlHghf jug;gpdHcld;ghl;il njhptpf;f Ntz;Lk;.13. vg;NghJk; tprhuiz nahd;wpd;NghJ Nfhuk; gj;jphpif kw;Wk; gj;jphpif rhuhjmq;fj;jtHfspd; ngUk;ghd;ikAld; %d;whf ,Uf;f Ntz;Lk;.14. Kiwg;ghl;L tprhuizf; fTd;rpypd; cWg;gpdH xUtUf;F Fwpj;j tplak;njhlHghf jdpg;gl;l Kiwapy; tpN\l MHtk; ,Uf;Fkhapd; mt;tplak; njhlHghdtprhuizapd; NghJ mtH mjw;F r%fkspg;gjpy; ,Ue;J jtpHj;Jf;nfhs;s Ntz;Lk;.rhl;rpak;15. kj;jpa];j jPHg;gpd; NghJ jug;gpdH ep&gpg;gjw;F vjpHghHf;fpd;w tplaj;ijFwpg;gpl;L mjw;fhd Mjhuq;fisAk; Kd;itf;f Ntz;Lk;.16. kj;jpa];j tprhuizf; FOtpdhpd; Ntz;LjYf;fpzq;f Kiwg;ghL nra;Ak;my;yJ rk;ge;jg;gl;l jug;gpdH jq;fsplk; cs;s njhFf;fg;gl;l rhl;rpaq;fisAk;rkHg;gpf;f Ntz;Lk;.63

17. kj;jpa];j FOtpdH Njitg;gLk; vd;W fUJk; NghJ jug;gpdiurj;jpaf;fljhrpnahd;iw rkHg;gpf;FkhW Nfhu KbAk;.18. VjhtnjhU tplak; njhlHghf mjid ep&gpg;gjw;F ,yF topfs; ,Uf;ifapy;mtw;iw ehlhky; Kd;itf;fg;gLk; rhl;rpaq;fs; nghUj;jkw;wit my;yJ rk;ge;jk;,y;yhjit vd;W kj;jpa];j tprhuizf;FOtpdH fUJkplj;J mtw;iw epuhfhpf;fKbAk;.19. Kuz;ghL njhlHghf jug;gpduhy; Kd;itf;fg;gLfpd;w rfy tplaq;fSk; my;yJrkHg;gzq;fSk; ,.g.K.M.F. tpd; xOq;FtpjpfSf;fikthf ,Uf;f Ntz;Lk;.jug;gpdH ,j;Njitia jpUg;jpg;gLj;j jtUkplj;J kj;jpa];jHfs; Kiwg;ghl;ilepuhfhpf;f KbAk;. ,Ue;jNghJk; mjdhy; kj;jpa];j nray;ghl;Lf;F ,ilA+WVw;glhJ.20. Fwpg;gpl;l Kf;fpaj;Jtk; tha;e;j tplak; xd;W njhlHghf mt;tplaj;NjhLMskhd mwpTngw;w xUthpd; fUj;ij mwptjw;F jug;gpdH tpUk;GthHfshapd;kj;jpa];jHfSf;F mg;gbahd xUthpd; Nritiag; ngw KbAk;.21. jug;gpdH tprhuiznahd;Wf;F r%fkspf;fj; jtwpd; my;yJ cj;jutpw;Frhjfkhd epiyia njhptpf;fhik kw;Wk; mjw;F Vw;Wf;nfhs;sj; jf;f fhuzq;fisKd;itf;fhik vd;gd Nghd;w tplaq;fs; tprhuizfs; njhlHtjw;F ,ilA+whfmikahJ.epthuzk;22. jug;gpduhy; NtnwhU jPHit my;yJ epthuzj;ij ngw;Wj;jUkhW kj;jpa];jNguitf;F vOj;J %yk; NtzLNfhs; tpLf;fg;gLk; re;jHg;gq;fs; jtpHe;j Vidavy;yhr; re;jHg;gq;fspYk; Fwpg;gpl;l Kiwg;ghL njhlHghf kj;jpa];j nray;ghl;bd;NghJ kj;jpa];jUf;Fs;s mjpfhuk; Kiwg;ghl;Lld; rk;ge;jkhd gpuRuj;jpw;Fgjpyspf;Fk; tifapy; re;jHg;gj;ij Vw;gLj;jpf; nfhLj;jy; my;yJ jpUj;jk; gpuRhpf;fmy;yJ tUj;jj;ij ntspg;gLj;j re;jHg;gj;ij cUthf;fpf; nfhLj;jy; vd;gtw;Wf;Fkl;Lg;gLj;jg;gl;ljhf mika Ntz;Lk;.23. kj;jpa];j Nguitahy; tpN\lkhf Fwpg;gplg;glhtpl;lhy; Kiwg;ghl;ilMizf;FOTf;F rkHg;gpj;j jpfjpapy; ,Ue;J xUkhj fhyg;gFjpf;Fs; jPHg;igmwptpf;f KbAk;.24. jPHTf;F ,zf;fk; Vw;gl;lhy; mj;jPHthdJ Kiwg;ghl;lhsHfspd; tpUg;gj;jpd; Nghpy;Vw;gl;l kj;jpa];j jPHT vd;gij Nguitahy; mjd; jPHg;gpy; cWjp nra;a Ntz;Lk;.25. tprhuizapd; NghJ Kiwg;ghl;Lld; njhlHGila vy;yh tplaq;fSk; ey;yKiwapy; ghprPyizf;Fl;gLj;jg;gl;L cWjpg;gLj;jg;gl;l tplaq;fspd; mbg;gilapNyjPHg;G toq;fg;gLk;.26. kj;jpa];j Nguitahf KOikahd tprhuizf;FOTk; $ba re;jHg;gq;fspd;NghJ ngUk;ghd;ik tpUg;gj;jpd; mgpg;gpuhaj;jpw;fika jPHg;G mwptpf;fg;gLk;.27. Kuz;ghl;Lld; njhlHGila jug;gpdhpilNa tprhuizapd; VjhtJ xU gFjpmy;yJ NtWgLj;jpf; nfhs;sg;gl;l xU tplak; Fwpj;J my;yJ xU jug;gpdhpd;Ntz;LNfhspd; gb,d;DnkhU KbT my;yJ epthuz topapy; jPHkhdk; xd;iwvLf;f KbAk;.mt;thNw xU jug;gpdH jPHit/epthuzj;ij epuhfhpj;J vjpHg;Gnjhptpj;jhy; tpjp tpyf;fhd tplaq;fs; njhlHghf kj;jpa];j Nguitf;F mt;thWfUkkhw;w KbAk;.64

28. Kiwg;ghnlhd;W njhlHgpy; VjhtJ xU jug;gpdH xU gFjpapd; nghWg;ig Vw;Wf;nfhz;lhy; mJ njhlHghf Ntwhd jPHg;ig njspapl kj;jpa];j Nguitf;F KbAk;.29. kj;jpa];jk; eilngw;w ,lj;jpNyNa jPHg;ig mwptpf;f KbAk;. me;j jPHg;Gf;Fmy;yJ mwptpj;jYf;Fhpa rfy tplaq;fSk; cs;slq;f Ntz;baNjhL Njitf;Nfw;gkj;jpa];jH my;yJ kj;jpa]jHfs; ifnahg;gk; ,l Ntz;Lk;. kj;jpa]jH xUtHngUk;ghd;ikapdhpd; ifnahg;gk; ,y;yhkYk; $l KbntLg;gjw;Fgq;fhspahfpagbf;F cWjpaspj;J jPHg;nghd;iw mwptpf;f KbAk;.30. tprhuiznahd;wpd; Kbtpy; kj;jpa];jHfspd; jPHg;gpd; gpujpnahd;Wk; tprhuizmwpf;ifapd; gpujpnahd;Wk; ,.g.K.M.F.Tf;F rkHg;gpf;f Ntz;Lk;.jpUj;jk; my;yJ jPHg;ig khw;wk; nra;jy;31. jPHg;nghd;wpd; NghJ jtWfs; ele;jpUg;gjhf fUJkplj;J my;yJ MtzghpNrhjizfspd; NghJ njhpa te;jhy; jPUj;jq;fSld; jPHg;gpy; khw;wk; nra;aTk;kj;jpa];j Nguitf;F KbAk;.32. jPHg;nghd;iw toq;fp Kg;gJ ehl;fSf;Fs; me;j jPHg;G njhlHghf jPHkhdpf;fg;glNtz;bapUe;J mt;thW jPHkhdpf;fhj tplak; njhlHghf xU jug;gpdH Ntz;LNfhs;xd;iw tpLj;jhy; mJ njhlHghf jPHkhdk; vLf;f fTd;rpYf;F KbAk;.33. jPHg;nghd;W toq;fg;gl;L Kg;gJ ehl;fSf;Fs; xUjug;gpdH Ntz;LNfhs; tpLj;jhy;mJ njhlHghf tpsf;fkspf;f my;yJ njspTgLj;j kj;jpa];j fTd;rpYf;F KbAk;.34. ,Wjpj; jPHg;Gf;F tUKd;dH rk;ge;jg;gl;l jug;gpdUf;F mtHfsJ fUj;Jf;fisntspapl re;jHg;gk; toq;f Ntz;Lk;.jPHg;ig mKy;gLj;jy;35. VjhtnjhU tplaj;jpy; cld;ghl;Lld; my;yJ kj;jpa];jj;Jldhd jPHTf;Fcld;gl;L kj;jpa];jj;jpy; my;yJ tprhuizapd; NghJ mt;thW cld;gl;lepge;jidfSf;F ,zq;f jtWkplj;J Kiwg;ghl;lhsUf;F me;j kj;jpa];jj;ijmKYf;F nfhz;L tUtJ njhlHghf 1995 Mk; Mz;bd; ,zf;f rigrl;lj;jpw;fikthf Nky; ePjpkd;wj;jpy; Kiwg;ghL nra;a Nguit xj;Jiog;G toq;fNtz;Lk;.36. 1995 Mk; Mz;bd; 11 Mk; ,yf;f kj;jpa];j rl;lj;jpw;fika epthuzj;jpd;gbNky; ePjpkd;wj;jpy; nra;ag;gLk; Kiwg;ghl;Lf;F 14 ehl;fs; fle;j gpd;dH tUk;xUtUl fhyg;gFjpf;Fs; toq;fg;gLk; jPHg;ig mJ fhyhtjpahtjw;F Kd;djhfmika Ntz;Lk;.37. Mizf;FOtpd; Kiwg;ghl;L tprhuizg; Nguitapd; ve;jnthU jPHg;Gk;mwptpf;fg;gl;l gpd;dH Fwpg;gpl;l gj;jphpifapy; my;yJ rQ;rpifapy; jhkjpf;fhky;mtrukhf gpuRhpf;f Ntz;Lk;.38 ,.g.K.M. Nguitapd; mj;jifa epahaj;jPh;g;G 1995Mk; Mz;bd; 11Mk;,yf;f rl;lj;jpy; Fwpg;gPLnra;ag;gl;l eLj;jPh;g;G epaha rignahd;wpdhy;toq;fg;gLk; mspg;nghd;wpw;Fr; rkkhdjhjy; Ntz;Lk; vd;gJld; nrhy;yg;gl;lrl;lj;jpd; Vw;ghLfs; mj;jifa epahaj;jPh;g;gpd; tYTf;fplYf;F Vw;wkhw;wq;fSld; Vw;GiladthjYk; Ntz;Lk;.39. gp.ep.m. tpd; VNjDk KbT mj;Jld; my;yJ ,.g.K.M. Nguitapd;epahaj;jP;h;g;G vy;yh Nehf;fq;fSf;fhfTk; ,WjpahdJk; KbthdJkhjy;Ntz;Lk;: mjid ePjpkd;wjpd; Kd;dpiyapy; Ml;Nrgpf;f KbahJ.65

40 .gp.ep.m. vy;yh Kiwg;ghLfspdJk; ,zf;fk;> kj;jpa];jk;> eLj;jPh;g;Geltbf;iffs; vd;gtw;wpd; KbTfspdJk; gjpnthd;iwg; NgZjy; Ntz;Lk;vd;gJld; mjd;gpd;dh; Mizf;FOtpd; xU ntspaPL vd;w tifapy; nghJkf;fSf;Ff; fpilf;ftpUf;Fk; Mz;Lf; $w;nwhd;iw Mizf; FOTf;Ff;fpilf;fr; nra;tpj;jYk; Ntz;Lk;.41 ,e;j eltbf;ifKiw 2003 mf;Nlhgh; 15Mk; jpfjp my;yJ mjd;gpd;dh;ntspaplg;gl;l nra;jpj; jhs; xd;wpy; my;yJ rQ;rpifnahd;wpy; fhzg;gLk;gpuRhpf;fg;gl;l tplankhd;wpw;F vjpuhd Kiwg;ghl;bw;Fg; gaDWjpAilajhapUf;Fk;. ,yq;ifg; gj;jphpif epWtfj;jhy; Vw;wq;fPfhpf;fg;gl;lthW,yq;ifg; gj;jphpifahrphpah;fspd; xd;wpaj;jpd; cah;njhopy;rhh; eilKiwf;Nfhit,yq;if gj;jphpif Kiwg;ghl;L Mizf;FOthy;fz;fhzpf;fg;gLfpd;w ,yq;if gj;jphpif Mrphpah; rq;fj;jpd;xOf;ff; Nfhit42 ,yq;ifg; gj;jphpif epWtfj;jhYk; ,.g.K.M. tpdhYk; Vw;Wmq;fPfhpf;fg;gl;lthW ,yq;ifg; gj;jphpifahrphpah;fspd; xd;wpaj;jpd; cah;njhopy;rhh; eilKiwf;Nfhitapd; nghUs;Nfhly; ,e;j tpjpfspd;fPo; vy;yhVw;ghLfisAk; epiwNtw;Wk; Nehf;fj;jpw;F Nguitf;Nf chpj;jhdjhap Uj;jy;Ntz;Lk;.,.g.K.M. tpd; Ngr;rhsh;43. fk;gdpapd; nfhs;if rk;ge;jg;gl;l vy;yh tplaq;fSf;Fkhd Ngr;rhsh;,.g.K.M. tpd; jtprhsh; my;yJ rigapd; rhh;gpy; ciuahw;Wtjw;Frigahy mjpfhukspf;fg;gl;l vtNuDk; cWg;gpdh; Mjy; Ntz;Lk;.44. gpujk epiwNtw;W mYtyNu (gp.ep.m.) Nguitahy; ngwg;gl;l vy;yhKiwg;ghLfSf;Fk; mj;Jld; nra;ag;gl;l KbTfSf;Fk; Ngr;rhsuhf,Ug;ghh;. Mapd; vt;thwhapDk; mt;thW nra;tJmwpTilikahFkplj;J gp.ep.m. Nguitapd; jtprhsiuf;fye;jhNyhrpf;fyhk;. vdpDk; vJ tplaj;jpYk; eilngw;WtUk;tprhuizfs; gw;wp gj;jphpiff;F mj;Jld; my;yJ ,yj;jpudpay;Clfj;jpw;F mj;Jld; my;yJ nghJkf;fSf;F tptuq;fs;toq;fg;gLjyhfhJ. mj;Jld; Nguitahy; nra;ag;gl;l vitNaDk;epaharig mspg;Gfs; gw;wpa nghUs;Nfhly; vJTk; Nguitapd;jtprhsUlhd mj;Jld; my;yJ eLj;jPh;g;Gf; FohKldhdfye;jhNyhridapd; gpd;dNu gp.ep.m. My; nra;ag;gLjy; Ntz;Lk;.45. ,.g.K.M. tpd; gzp njhlh;gpy; fl;Liunahd;iwf; nfhLj;Jjt my;yJ,yj;jpudpay; Clfj;jpy; VNjDk; Clf ciuahlypd; Xh; mq;fkhf,Uf;f tpUk;Gk; ,.g.K.M. cWg;gpdh; vtUk; gp.ep.m. ,d;Kd;dq;fPfhuj;ij vOj;jpyhapd; ngWtJ tpUk;;gj;jf;fJ> ngWjy;Ntz;Lk;. Mdhy; vJ tplaj;jpYk; nfhs;if rk;ge;jkhd vitNaDk;fUkq;fs; gw;wp ciuahLtjpypUe;J mj;jifa mYtyh; GwePf;fk;nra;ag;gLfpd;whh;. ,J gzpg;ghsh; rigapd; rpwg;GhpikahFk;.46. vy;yhg; gj;jphpif mwpf;iffSf;Fk; ,g.K.M. jtprhshpd; Kd;dDkjpNjitg;gLk;. mit Kiwg;ghL rk;ge;jg;gl;l VNjDk; tplak;njhlh;gpyhdjhf ,Ug;gpd; mjw;Fg; Nguitapd; jtprhsUilamjpfhukspg;G Njitg;gLk;.47. ,e;j xOq;Ftpjpfs; gpujk epiwNtw;W mjpfhhpahy; tUlhe;jk; my;yJNjitg;gLk; NghJ jpUj;jk; nra;ag;gl;L Kuz;ghl;Lj; jPh;Tf;FO66

mq;fj;jth;fspd; mq;fPfhuj;jpw;fhf xg;gilff;g;gl;L ,yq;if gj;jphpifKiwg;ghl;L Mizf;FOtpd; gzpg;ghsh; rigapd; mq;fPfhuj;Jld;mKy;gLj;jYf;fhf rkh;g;gpf;fg;gLk;.Kw;Wk;Kiwg;ghl;L tpz;zg;gg;gbtk;KOg; ngah; :……………………………………………………………………………Kfthp :…………………………………………………………………………………njhiyNgrp ,y :………………..ngf;]; ………………..nkhigy;…………………< nkapy; :……………………………………………………………………………….gj;jphpif/rQ;rpifapd; ngah; ::…………………… gpuRukhd jpfjp .........................jiyg;G :………………………………………………………………………………….cq;fsJ ghh;itapy; gj;jphpifj; JiwapdUf;fhd xOf;ff;Nfhitapd; ve;jg; gphpTmy;yJ gphpTfs; kPwg;gl;Ls;sd vd;gijf; Fwpg;gplTk;. (Fwpj;j gphptpd; ,yf;fj;ijf;Fwpg;gplTk;) ………………………………………………………………,e;j tpz;zg;gg; gbtj;jpy; ifnahg;gkpLtjd; %yk; ehd; gpd;tUk; epge;jidfSf;Fcld;gLfpNwd;.• Kiwg;ghL njhlh;ghd gpzf;Ffisj; jPh;f;Fk; tifapy; ,yq;if gj;jphpifKiwg;ghl;L Mizf;FO gpd;gw;Wk; tpjpKiwfSf;F ehd; ,zq;FfpNwd;.• Fwpj;j Kiwg;ghL njhlh;ghf vdf;Fk; gj;jphpifap;d MrphpaUf;Fk; ,ilapy;gj;jphpif Kiwg;ghl;L Mizf;FOtpd; Clhf Vw;gLj;jg;gLfpd;w jPh;Tf;F ehd;,zq;Ffp;d;Nwd;.• Kiwg;ghl;Lf;Fhpa gpuRuj;jpd; gpujpiaAk; mJ njhlh;ghd vdJ fUj;ijAk;,j;Jld; ,izj;Js;Nsd;.67

jPh;it miltjw;fhf ,.g.K.M.F. Kiwg;ghl;L xOq;F tpjpfSf;fikar; rpytpjpKiwfisf; filgpbf;fpd;wJ vd;gijf; ftdj;jpw; nfhs;sTk;. Mjd; gpufhuk;Kiwg;ghl;L xOq;F tpjp 38 ,w;fika ,e;j Mizf;FOtpd; Kuz;ghl;Lj; jPh;Tf;FO 1995 Mk; mz;bd; 11 Mk; ,yf;f gpzf;Ffisj; jPh;j;J itf;Fk; ,zf;f rigr;rl;lj;jpw;fika toq;Ffp;d;w kj;jpa];j rigj; jPh;g;ghdJ cah; ePjpkd;wj;jp;ynry;Ygbahfj; jf;fjhFk;.Kuz;ghl;Lj; jPh;Tf; FOTk; Mizf;FOtpd; gpujk epiwNtw;W mjpfhhpAk; vLf;Fk;jPh;g;G ,Wjpj; jPh;g;ghf miktNjhL mjid ve;jnthU ePjpkd;wj;jp;d Kd;dpiyapYk;vjph;j;J rthy; tpl KbahJ vd;gij ftdj;jpy; nfhs;sTk;.………………………….jpfjp…………………………….ifnahg;gk;ey;ypzf;fkhdJ Kuz;ghl;ilj; jPh;g;gjw;fhd Kjy; Kaw;rpahf miktNjhL mjd;%yk; jPh;T fhzKbahjNghJ me;j Kiwg;ghL Kuz;ghl;Lj; jPh;Tf; FOtpd;Kd;dpiyapy; kj;jpa];j jPh;Tf;fhfr; rkh;g;gpf;fg;gLk;96 Kirula Road, Colombo 05, Sri Lanka - Tel: (94 11) 5353635, Fax: (94 11) 5335500Mobile: (94 11) 0777-304092 - e-mail: srockwood@pccsl.lk - Web: www.pccsl.lk68

PRESS COMPLAINTS COMMSSION OF SRI LANKAAnnual Report 200770

Press Complaints Commission of Sri Lanka96, Kirula Road,Colombo 5,Telephone: (00 94 11) 5353635; 5333002Fax: (00 94 11) 5335500E-mail: pccsl@pccsl.lkWebsite: www.pccsl.lkMessage from the Chairman of thePress Complaints Commission of Sri LankaThe Press Complaints Commission of Sri Lanka (PCCSL) completes its fourth yearoffering itself as the forum for conciliation, mediation or arbitration between the publicand the print media of this country.The voluntary self-regulatory Commission was the industry’s answer to the statutoryPress Council that was in existence for over twenty five years with Governmentappointed nominees dishing out judgements against newspapers.Today, the industry – and the public, have an independent Dispute Resolution Councilheaded by an eminent civil servant and comprising five representatives from the Pressand five representatives from civil society that will go into any complaint by any memberof the public concerning a violation of the Code of Professional Practice drafted bynational newspaper editors themselves, and offer justice - fast, free and fair.We have a Secretariat that is at hand to lend any assistance to members of the publicwho wish to bring a complaint or make contact with a newspaper editor over a disputethey may have with some material published in the national press.This service is the industry’s contribution to responsible journalism in this country; theEditors’ Code being the basis for professional journalists to maintain the high standardswe, and the country expect from them in the everyday conduct of their duties.Being a self-regulatory mechanism, and voluntary, we are unable to mandate anynewspaper house to join in the process and be participants in the rules and proceduresof the Commission. Suffice to say that the clear majority of newspaper houses areparticipatory members of the Commission and lend their complete support to thisventure that is now being studied by many other countries, especially those in theregion.The work of the Commission has, however, not risen to the expectations we had at thelaunch of this exercise. We would have liked our message to have spread wider andpenetrated further. The initial exposure the Commission received has waned in recentmonths, and there is an urgent need to mobilise the support of the wider public, andachieve much greater acceptance for this venture.71

I am confident that the new Chairman and Board will carry forward the initial work thathas been done by the Commission in establishing a new media culture in the country,and I earnestly urge all publishers, editors, and journalists to lend their fullest support toour endeavour to promote good and responsible journalism.While thanking those in the industry who have co-operated, others might well considerthis exercise as at least the ‘lesser evil’ to a statutory body which has the powers toimpose penal punishment on publishers, editors and journalists.I take this opportunity to thank the Chairman and members of the Dispute ResolutionCouncil for giving their valuable time voluntarily to us.I wish to also thank the donors and supporters of the Commission.I thank the PCCSL Secretariat and those of the Sri Lanka Press Institute and the SriLanka College of Journalism for their wholehearted support to the Commission.R.S. WijewardeneMessage from the Chairmanof the Dispute Resolution CouncilThe Press Complaints Commission has shown some improvement both in itsspeed and efficiency in resolving complaints and in getting the editors to be waryof carrying articles that are detrimental to the public interest.The Editors’ Guild of Sri Lanka which is responsible for amending the Code ofProfessional Practice that the PCCSL is bound by, commenced work on revisingthe Code and making necessary changes. It is the duty of all editors to rallyround and get this enterprise finished.There however remains the perception that less complaints is partly because ofthe general unawareness of the PCCSL process and also of newspapers notcarrying stories that violate the Code. This perception is not entirely correct sincethe PCCSL has strived to pass the message on to the general public that it is aninstitution that exists to help solve problems with the print media.In respect of newspapers not violating the Code, publishing inappropriatephotographs or referring to alleged offences by race must be stopped with editorshaving a closer supervision with their out put.As the PCCSL moves forward into its fifth year of existence let me take thisopportunity on behalf of us of the DRC to wish the PCCSL all success.Sam S. Wijesinha72

Annual Review 2007IntroductionThe PCCSL is the outcome of the Colombo Declaration on Press Freedom and SocialResponsibility of 1998, which followed an international seminar held in Colombo organized by theNewspaper Society of Sri Lanka, The Editors' Guild of Sri Lanka and the Free Media Movementin association with the Sri Lanka Working Journalists Association, the World Association ofNewspapers, the Commonwealth Press Union, the International Press Institute, Article 19 and theMedia Institute of Southern Africa.The PCCSL is a self-regulatory mechanism set up by the Newspaper industry of Sri Lanka, whichcomprises the Newspaper Society of Sri Lanka, The Editors' Guild of Sri Lanka and the FreeMedia Movement.It works on the principles of conciliation, mediation and arbitration under the Arbitration Act No 11of 1995, and is largely modeled along the lines of the Press Complaints Commission of UK,Sweden and South Africa. The High Court of Colombo enforces the PCCSL arbitration award, inthe event a newspaper fails to publish the decision, and if a complainant decides to pursue thematter to a conclusion.The Press Complaints Commission of Sri Lanka entered its fourth year in 2007. Significantprogress has been achieved yet several challenges remain. Foremost among them is to securethe participation of a section of the press, particularly the Sunday Leader and Sunday Observer,Morning Leader and Irudina newspapers. These newspapers have not subscribed to industryefforts to establish a self-regulatory mechanism for the dissemination of news.However, we are pleased to record that in the case of other newspapers that belong to the LakeHouse Group viz., Daily News, Dinamina and Thinnakaran, there is full co-operation with thePCCSL process.Although newspapers have been printed in Sri Lanka for well over 150 years, the self-regulatorysystem is new to the country. In this respect the PCCSL continues to carry out workshops withjournalists on the Editors’ Code of Professional Practice and the PCCSL process, in order tocreate awareness in the newsrooms.The impact of the PCCSL can be measured in many ways. One is the number of complaintsreceived and the attention given to those complaints by the Commission, which is tabled below.Another impact of the PCCSL is the increased number of corrections, right of replies andapologies published by Sri Lankan newspapers without formally involving the PCCSL. The73

advocacy work done by the Commission has made readers write direct to editors and have their‘right of reply’ printed outside the PCCSL process, which is positive and helps reaching theobjective of a professional media.To mark the fourth anniversary of the PCCSL, the PCCSL along with the Ministry of Educationconducted an All Island Essay Competition in all the three languages on Saturday, September 15in the Sri Lanka Press Institute. The fist part of the competition was conducted by the Ministry ofEducation where 72 Grade 12 students who came first, second and third in each of the eightProvinces (North-East been one Province) were selected to come to Colombo and write a 750-word essay from one of five topics within 1 ½ hrs. They were treated to breakfast and so weretheir parents. From each language three winners were selected with the nine winners receivinggift vouchers from Ms. Lindsay Ross, Executive Director of the Commonwealth Press Union. Theprizes consisted of book vouchers. First Prize was for Rs. 5,000, second for Rs. 4,000 and thethird for Rs.3,000. The prize winners along with one guardian were paid a traveling stipend.Newspapers have also improved their content with better laid out pages, clear and simpleheadlines that could be easily understood, less disturbing photographs and especially in theEnglish-language newspapers, the stories are sourced which gives that newspaper greateramount of respect and credibility. The Tamil newspapers have also shown a great degree ofresponsibility in accurate reporting. Unfortunately, statistics show that most complaints of Codeviolations come from the Sinhala print media.Gender issuesIt is unfortunate that at all the training programs for journalists and civil society workshops,participation of women was limited. The ratio of women to men at such workshops was 3:20 atbest. One of the reasons for this could be attributed to the distance to travel from their home tothe point where the program is being held. Another factor was that women journalists were notencouraged by their parents/husbands to participate in residential training programs which lastedthree days and two nights on an average.Moves to re-activate Press CouncilIn August 2007, the PCCSL met the Director of Information, Mr. Anusha Pilapitiya where thebackground leading to the setting up of the PCCSL and its present role was discussed. This wasa follow up to media organizations and the SLPI making representations to the Ministry ofInformation and Mass Media against an attempt to reactivate the Press Council.ComplaintsDuring the period under review (January to December 2007) the PCCSL received 161complaints. The following is a breakdown of the complaints as against each language newspaper.• Against the Sinhala language press: 93 complaints.• Against the Tamil language press: 17 complaints.• Against the English language press: 25 complaints.• In general and TV: 26 complaints.As the breakdown indicates the most number of complaints received is against the Sinhalanewspapers which also enjoy the largest readership in the country.The Sinhala language media comprise 70 per cent of the daily and weekly newspapers in thecountry and the PCCSL has had some success in winning the cooperation of the Sinhalalanguage editors to comply with the Code. While the Commission has had full cooperation fromthe Editors of the Tamil language newspapers, three of the English language newspapers chosenot to comply with the Rules and Procedures of the PCCSL.Given below is the break down of the types of complaints received during the period underreview:(1) Types of complaints received:74

• Dismissed: 129 complaints. These complaints fell outside the Code of ProfessionalPractice for example complaints against advertisements, the positioning ofadvertisements beside serious articles and mix up of articles written on the same subjectby a news room reporter and a provincial journalist, Complaints before courts: Sub-judiceand complainants not following the PCCSL process.• Resolved: 32 complaints. This is an improvement when compared to 2006.(2) Complaints were received against the following newspapers:• The Associated Newspapers of Ceylon Limited: ANCL (Lake House) Newspapers: DailyNews, Dinamina, Sunday Observer, Silumina and Thinakkaran.• Wijeya Newspapers Limited: Sirikatha, Lankadeepa, Irida Lankadeepa• Upali Newspapers Limited: The Island, Sunday Island, Divaina and Irida Divaina.• Sumathi Newspapers Limited: Lakbima and Irida Lakbima.• Ravaya Publishers Limited: Ravaya.• Leader Publications (Pvt) Limited: Sunday Leader• Mass Media Syndicate (Pvt) Limited: Sudar Oli and Uthayan.• Rivira Media Corporation (Pvt) Limited: The Nation.• Express Newspapers Ceylon Limited: Virakesari.• United Newspapers Limited: Thinakkural.(3) Other complaints:The PCCSL also received a few complaints against advertisements published in newspapers,editorial mix up of articles sent by provincial correspondents, Non-payment of salaries as well asnews items and other programs in the electronic media. These were forwarded to the relevantauthorities.(4) Rights of readers:The "Rights of Readers" announcement was sent to all newspapers for publication. TheWijeya Newspapers, Express Newspapers, United Newspapers and the Sumathi Publicationscarried the announcement. The same was published as a news item in the Thinnakaran of LakeHouse.Dispute Resolution CouncilThe Dispute Resolution Council (DRC) met on nine occasions and it was decided to have onemeeting once in two months. The Chairman of the 11-member Dispute Resolution Council isformer Secretary General of Parliament and Ombudsman Mr. Sam Wijesinha. At the AnnualGeneral Meeting held in October, the one-off three year term of office of the Chairman of theDRC was extended to two, three year terms. The press representatives on the DRC are: Ms.Mallika Wanigasundera Mr. Siri Ranasinghe, Mr. G. S. Perera, Mr. Jayatilake de Silva, and Mr.Pramod de Silva. The non-press representatives on the DRC are: Ms. Sithie Tiruchelvan, Dr.Devanesan Nesiah, Mr. Lucille Wijewardene, Mr Javid Yusuf and Mr. Dion Schoorman.Code of Professional Practice Review CommitteeMr. Ian Beales, Secretary of the British Editors’ Code Committee was in Sri Lanka from October17 to 23, 2007 as a guest of the Sri Lanka Press Institute (SLPI) and the Editors’ Guild of SriLanka (TEGOSL). He re-visited the Code of Professional Practice and submitted his report to theGuild, which in turn circulated it among the key players of the Industry, including the PCCSL (Acopy of which is annexed to this report – Annexure 01).A parallel review committee was also appointed by the PCCSL on a request made by the Guild toreview the three-year old Code of Professional Practice for print media journalists. TheCommittee comprised Ms. Sithie Thiruchelvam, member of the Dispute Resolution Council(DRC), Mr. Javid Yusuf, member of the DRC, Mr. Ayub in place of Mr. Nisthar Cassim, Editor of75

the Daily Mirror at the time and now editor of a business weekly Bottom Line and Mr. UvinduKurukulasuriya, member of the Free Media Movement (FMM) and Board member of the PCCSL.The Parallel Code Review Committee was appointed in view of the original Code Committeechaired by Judge Christopher Weeramantry and comprising several eminent members of civilsociety, and senior media personnel were unable to provide the Editors’ Guild with anyrecommendations. That Committee had met once but due to several reasons, especially itsmembers being overseas on official work, not been able to file a report.The Editors’ Guild took both reports viz that of Mr. Beales and the Parallel Review CodeCommittee Report in making their final review (A copy of which is also annexed herewith –Annexure 02).Code of Professional Practice for TV journalistsThe PCCSL, through the Sri Lanka Press Institute, facilitated meetings with MTV, ITN, ETV,Swarnavahini, TNL and Derena TV Stations to formulate a Code of Professional Practice fortelevision journalists. While the PCCSL is not mandated to draft a Code for the TV industry, it wason the request of TV stations that the PCCSL lent its good offices to facilitate this process.Membership of PCCSLFollowing the death of Mr. Ajith Samaranayake Editor-in-Chief of Lake House English languagepublications, Mr. Bandula Jayasekera, Editor of the Daily News was nominated by the Guild tothe general membership of the PCCSL. However, Mr. Jayasekera resigned his post as editor andas a result the position fell vacant. Mr. Kamal Liyanaarachchi, the Free Media Movementnominee as a member of the PCCSL resigned to join the PCCSL as the new Sinhala languageComplaint’s Officer. His vacancy was filled by Ms. Tharidi Fonseka. The membership of thePCCSL stands at 49 as of December 31, 2007.Awareness ProgramsPCCSL Promotion Campaign:• A promotional campaign was submitted for approval by the PCCSL Board. It included abrochure of the PCCSL, A “Right of Reply” advertisement to be published as a publicservice notice, a radio and Television ad campaign, a newspaper ad campaign and thedisplay of four hoarding board ads in Bambalapitiya, Kirullapone, Pettah and the KandyRoad.• Translation of a brochure of Frequently Asked Questions (FAQ) about the PCCSL hasbeen finalized and will be printed.Workshops/Seminars:• Several presentations on the role of the PCCSL were held for members of the public inBandarawela, Badulla, Ratnapura, Kegalle and Chilaw. These programs were fairly wellattended by teachers, government officials, local government institutions, academics anddoctors. They were eager to know more about the PCCSL and how it works.• Two-day workshops on media ethics for provincial journalists were also held inBandarawela, Badulla, Ratnapura, Kegalle and Chilaw.• Workshop for Inter-news and Radio journalists was held in Matara on Media Ethics.• A presentation was made to the synod of the Diocese of Colombo, Church of Sri Lankaon the role of the PCCSL. This took the form of a power point presentation where theaudience was taken through the process of solving complaints.• Presentation to the International Federation of Red Cross and Red Crescent Societies –Movement Coordinators on the role of the PCCSL.• Presentation to the Consortium of Humanitarian Agencies (CHA) on the role of thePCCSL. A program similar to the above was presented to them but the audience wereadvised to exercise great caution when addressing journalists as they could be oftenmisquoted and therefore to rely on press releases.76

Orientation/training:• From September 18 to 22, the CEO attended the Alliance of Independent Press Councilsof Europe Conference (AIPCE) in Edinburgh, Scotland on an invitation by the BritishPCC. The CEO presented the Annual Report of the PCCSL for 2006.• In September following the AIPCE Conference, the Chief Executive Officer visited thePress Complaints Commission of the UK for an orientation.Visit to Editors:During this period the CEO and his three Complaints Officers visited newspaper offices and helddiscussions with editors and news room staff on the Code and the activities of the PCCSL.Website of PCCSL:A website designed along the lines of the UK Press Complaints Commission which has been inoperation since the latter part of 2006 was updated. Complaints can now be lodged online. Theweb page gives the Code of Professional Practice as well as steps taken in resolving complaints.AGM and Board meetingsThe PCCSL Board of Directors continued to meet once every month. The Annual GeneralMeeting (AGM) took place on October 02, 2007. All the nine directors were re-elected to serve onthe Board of Directors of the PCCSL for another 12-month.An amendment was passed in the Memorandum of Association of the Press ComplaintsCommission of Sri Lanka Article 65 D where the Office of the Chairman of the Dispute ResolutionCouncil (DRC) was extended to cover two three-year terms.Board members: Mr. Ranjit Wijewardene (Chairman, nominee of SLPI), Mr. Nimal Welgama(nominee of the Newspaper Society of Sri Lanka), Mr. Sinha Ratnatunga (nominee of the Editors’Guild of Sri Lanka), Mr. Uvindu Kurukulasuriya (nominee of the Free Media Movement) Mr. Manikde Silva and Mr. Waruna Karunatilleke (nominees of the SLPI), Ms. Namini Wijedasa, Mr. M. N.Ameen and Mr Sundara Nihathamani de Mel elected by the general membership of the PCCSL.Staff membersThe year 2007 saw the PCCSL running at full strength, with regard to its staff, with SukumarRockwood, joining as the CEO, and Kamal Liyanaarachchi recruited as the Sinhala ComplaintsOfficer. The two vacancies had occurred with the resignations of its first CEO Manique Mendis in2005 and Consultant cum Sinhala Complaints Officer S. Dammulla in December 2006.In November 2007,Ms. Kshama Ranawana, the English Complaints Officer, was transferred tothe SLPI as Manager, Advocacy and Media Freedom and handling of English complaints wasassigned to Mr. Rockwood. Tamil press complaints are handled by Mr. Ameen Hussain.Sukumar RockwoodChief Executive Officer77

ANNEXURE 01Executive SummaryPress self-regulation in Sri Lanka: A reviewIan Beales: November 2007The original purpose of my October visit was to assess the current PCCSL Code of Practice andassist in necessary revisions. However, it rapidly became clear that the Code was not theproblem. Sri Lanka’s promising start down the road to press self regulation appears stalled due toa fundamental misunderstanding of its ultimate purpose. That is, to set up an acceptable, lighttouchregime providing an adequate remedy to the public’s legitimate grievances againstnewspapers and magazines, without resorting to - or imitating - the worst excesses of statutoryregulation, which are inimical to press freedom.Due, perhaps, to changing personnel and circumstances within the PCCSL, the Editors’ Guild,and the industry at large, that objective seems to have been lost. The PCCSL feels ignored andthat tougher rules are the remedy. Not only is that strategy against the voluntary spirit of selfregulation,it is also likely to have the reverse effect: driving editors out of the camp, rather thanenticing them in.The self-regulatory project needs revamping urgently if it is to get back on track. It will take amajor effort – virtually an unannounced re-launch – to regain lost ground. It would need a freshcommitment by the PCCSL, its secretariat and the Editors Guild to re-identify the common aimsbehind the original launch:• The PCCSL should re-evaluate its purpose and initiate a twin track educational campaignto raise its profile both with the public and the industry. Persuasion - by flagging upenlightened self-interest - should be used, rather than coercion or threats.• The industry, at both publishers and editors’ level, should work to embrace changes thatwould make the current self-regulatory regime more acceptable to those remainingoutside it, and thus provide the universal (or at least majority) compliance that wouldmake it credible. This should include establishing a more inclusive Code Committee toreview, revise and write the Code.The political climate makes the goal more difficult, but success more urgent. The currentvacuum could allow the state to reverse its current support for self regulation and78

einstitute a press council. A failure by the industry to offer full-hearted commitment to thecurrent project would be a setback that might also have long-lasting repercussions forfuture bids for donor funding.And, of course, a genuine opportunity to provide a lasting symbol of self regulation inaction would be lost to the region, where Sri Lanka is still its only major flag-bearer.1. IntroductionThe PCCSL has been in place for four years. In the context of self-regulatory regimesinternationally, that alone is cause for congratulation. Some systems wither and die, or aresnuffed out by apathy, neglect, poor leadership, internecine industry wrangling, lack of funding orgovernment pressure – or a combination of all of those - within months. So mere survival,especially against the background of a worsening political situation, is no mean achievement. Butit is not enough. If it is to be effective in the original aim of providing a viable alternative topotentially oppressive state intervention, or long, expensive and often hostile judicial proceedings,the PCCSL can’t simply plant a symbolic flag in the moral high ground of free expression. It hasto erect upon it a defensive wall of free, fast, fair and independent measures that provides thepublic with effective redress for genuine grievances against the press.This should command wide public support, sufficient to deter all but the most determined andoppressive governments - which would fear neither internal odium nor international isolation -from meddling in the principles of freedom of expression. That is self- regulation’s ultimatepurpose.Without the people’s support, the press can be little more than another self-interested commercialpressure group. Yet together they form a formidable coalition. An authoritative and respected selfregulatorysystem provides an important basis for such an alliance, in which the public identifies apowerful self-interest in having an independent press regulator rather than an intervening stateagency, which undermines trust in what is published.That is never more important than when there is internal conflict and ethnic polarity, which can beexploited by either side.Yet, despite a promising start, the PCCSL appears not to have established itself as such achampion of press and people. There is no obvious coalition. After four years, the self-regulatoryprocess has become becalmed. A low level of complaints suggests low public awareness andconfidence. At the same time, the PCCSL’s relations with the industry seems uncertain and itsrole unclear.There are also alarming signs of distrust and disinterest within the industry, which arguably hasmost to gain from a successful self-regulatory regime. If the system is trusted neither by thepublic, whom it is meant to protect, nor the industry that created it, what future has it? Why is itthere?These issues need to be addressed and remedied urgently, if the PCCSL is to succeed. It is nottoo late. But time is running out.2. What is going wrong?It is impossible, in a brief visit, to be certain of the cause of the malaise. But it emerged very soonthat – whatever else was wrong - it was unlikely to be the Code of Practice, which simply had notbeen sufficiently tested by adjudications for significant weaknesses to be exposed. Lack ofcompliance was certainly cited as a problem – but that seemed due not to what the Code said,but the manner in which it had been adopted. Ignorance of the Code was also a difficulty, but thisappeared to be simply part of a wider lack of understanding of the precise reason for, and role of,the PCCSL itself.While a failure to review the Code is remiss, it is not catastrophic. The document remains relevantand robust – although would be certainly more so if updated.(Some suggestions are included in Appendix B). However, the failure to review annually appearsto be only a symptom of the problem. For the disease itself, we must look elsewhere.A random survey of opinions – some undoubtedly less representative than others – suggests thesystem is suffering from many of the symptoms that have proved terminal in other fledgling selfregulatoryregimes: apathy, internecine wrangling and lack of direction.79

There is evidence of widespread confusion inside and outside the newspaper industry, and withinthe PCCSL itself, of what it is there for. Some sample views (often contradictory) below indicatethe extent of misunderstanding:• It hasn’t made enough impact. Ordinary people don’t know about it, so there are too fewcomplaints.• No one has told the journalists why we need it – they don’t know.• Editors routinely ignore their own Code. Why should anyone else follow it?• Non-Guild Editors aren’t bound by it, so universal compliance isn’t possible.• Why should it be the Editors’ Code anyway – and not the journalists’ code?• The Code isn’t explicit enough and should be expanded.• It’s too long – it needs to be shorter.• The PCC doesn’t communicate with editors.• The Editors don’t communicate with the PCC.• Neither of them communicates with ordinary journalists!• The PCC is overstaffed and too expensive for the industry to maintain, once the currentfunding runs out. And, most worryingly…• What was wrong with the old statutory Press Council anyway?These are just sample comments. However, there is supporting evidence for some of the morerelevant assertions.First, a lack of universal compliance, with some editors boycotting the PCCSL altogether whileothers opt in and out inconsistently, suggests a lack of identity with, or confidence in, the system.Second, the Editors’ Guild, while generally supporting the organization that it was so instrumentalin creating, has not sustained the level of its original enthusiasm. A symptom of that is the failureto review regularly the Code, of which it has ownership. An external review by the Parallel CodeCommittee was not successful and, indeed was a risky departure. While external endorsement ofthe Code can give it greater authority and credibility within civil society, that is easily neutralized ifit simultaneously reduces confidence (and compliance) within the industry. Ownership of theCode by the industry – through an Editors’ Code Committee or similar body - is traditionally a wayof encouraging compliance.Thirdly, newspapers are disunited even on the need for self regulation. The State Lake Housenewspapers seem divided, with the Daily News taking part, and The Observer, not. Elsewhere,the Leader newspaper appears to remain opposed. All this undermines credibility with the public.It suggests that the newspapers themselves do not really know why the system is there; norindeed that they are intended to be protected by it! For the avoidance of doubt, we should state ithere: The PCCSL is meant to be a conciliator – admittedly with ultimate adjudicating powers –rather than a policeman. The object of the operation is to provide a viable alternative to stateintervention, or long, expensive and often hostile judicial proceedings.However, the PCCSL itself appears to be not always aware of that. The response of ComplaintsOfficers to low levels of co-operation by newspapers was to suggest making the Code tougherand more explicit – essentially punishing editors, rather than persuading them. That indicates alack of understanding of the nuances of the system.To compound the problem, journalists from the free media movement and unions complain thatordinary journalists feel excluded from the system: that they are neither educated in it, norconsulted upon it. They also accuse editors of cynically ignoring their own Code and even ofencouraging their staff to do the same.There are clearly risks of blatant axe-grinding in these comments, and of people advancing highlypoliticised personal views. However, this is at base a hearts and minds operation and a systemso fragmented and confused has little chance of inspiring the public confidence so necessary forsuccess.3. What are the solutions?As previously suggested, all this is cause for alarm, although not yet necessarily for panic. Thedevelopment of a relatively new concept such as a self-regulatory regime that aims to provide anon-legalistic, free conciliation service to give redress to people who feel they have beenwronged by the press is not going to happen overnight. It needs to be explained. Perception isoften reality, and popular misconceptions need to be corrected. There is probably a need for80

some cultural change, too. People should be coaxed and persuaded, rather than ordered orcajoled – as in the old state system.But if this is truly a hearts and minds battle, there are too many people who are not aware of whatself-regulation is and why it is important; or indeed how it works for them, whether they arecomplainants with a grievance against the press, or an editor or journalist. Much more progressshould have been made in the last four years. There is a lot of catching up to do.Urgent action needs to be taken separately and jointly by both the industry and the PCCSL. Atthe centre of it should be an educational programme:• Explaining the proper role of self-regulation in a democratic society, and outlining how ithelps the public, protects the press and, indeed, is a sign of good governance.• Spelling out the price of failure: the risk of exposing the press to state controls, morefines, lengthy and expensive court cases and depriving the reader of a cheap, accessiblealternative remedy to the courts.• Flagging up how any perceived failure of commitment to success on the part of thepublishers and editors could damage the standing of the Sri Lankan media with thedonors who have supported the self-regulatory exercise with their cash.These messages need to be conveyed at all levels:1. within the industry itself, so that it can combat stubborn or unthinking resistance and try tocreate a semblance of unity and cooperation. This would need to be driven from the top down –from publishers via editors. To combat accusations of elitism, it would make sense to ensure thatthis time the process is more inclusive. A Them and Us culture, either in the newsroom orbetween rival editors, could be corrosive. Specific recommendations on possible ways to achievethis and make the Code and the system of drafting it more inclusive are listed below in AppendixA.2. within the PCCSL, where staff changes have meant that the original culture of self-regulation– as principally a conciliation service, rather than an adjudicatory system - has not becomeingrained. Any notion that the Commission should be some sort of Thought Police is alien andmust be discouraged. The PCC should be a robust, independent arbitrator – more a critical friendof the press than its natural enemy. See Appendix A for specific recommendations.3. to the public and civil society at large. Clearly this is mainly the role of PCCSL staffmembers, who need to be retrained to perform it convincingly. The public relations exercise canbe successful only once the staff understands fully what they, and the PCCSL, are supposed tobe doing. They could then embark on a campaign of awareness-raising, via the publication ofeducational literature, including answers to frequently-asked questions (Sample questions aredetailed below in Appendix C); and road shows to meet the wider community.THE TIMETABLE is largely self-determining. There is a sequence in which the retraining of staffand the public and industry-wide educational initiative must proceed, and this needs to dovetailwith the reforms to the Code Review process. This would take a little time.However, a possible schedule to speed matters would be for:• The Editors’ Guild to quickly reform the Code Committee to make it more inclusive, andthen invite suggestions from the public and industry on how the Code might be revised inits first major Review.• At the same time, the PCCSL should be setting its house in order in readiness to launchits public awareness campaign soon after.• Changes to the Code – with the benefit of the public’s suggestions - would follow in duecourse, giving a timely lift to the campaign, and keeping it in the public eye.APPENDICESThe Appendices below spell out in detail specific recommendations for changes to the PCCSLand to the Editors’ Guild’s Code review Process; possible changes that might be considered bythe Code Committee; and answers to Frequently Asked Questions which would be as valuable tomany members of the industry as to civil society at large.81

IMB: 07.11.2007Appendix ASpecific recommendations to the PCCSL and the Editors’ Guild1. The PCCSL Secretariat: The secretariat lacks authority and confident leadership. This isprobably due in part to the change of staff since the inception of self-regulation four years ago.The original credo has not been passed on intact and the experience of industry non-cooperationhas created a gulf between the staff and some editors. Bridges need to be repaired.• The director and staff (and probably the Commissioners themselves) need to bereminded of the original aims.• The current process of trying to raise public awareness in order to promote confidence,trust – and complaints - should be stepped up via a concerted campaign of road showsand public meetings, supported by advertising and news releases. This initiative shouldbe matched by a parallel charm offensive with editors. The aim should be to reacquaintthem with the culture of self regulation, remind them of its benefits and try to help themhandle the code, rather than see it as a threat. This should be done on two levels:• First, with individual editors, informally on a one-to-one basis, where they could beencouraged to seek help and guidance on Code issues.• Second, and perhaps more formally, via regular meetings with the Editors Guild andsimilar organizations. Again the aim should be to instill confidence and trust and convincethem that there is a mutual advantage in the PCCSL succeeding.2. The Editors Guild: The Guild has played a crucial role in setting up the system of selfregulationand producing the Code of Practice. However, for various reasons, it has had difficultyin maintaining the necessary oversight of the regime at the required level. This has two effects. Itundermines the system by, for instance, not maintaining the obligation to review the Codeannually; and it also exposes the process to objectionsfrom editors who, for whatever reason, are not Guild members. It is dangerous for the Code toappear to be in sole ownership of the Guild, especially while it does not command 100pcmembership of Sri Lanka’s editors. The Guild might therefore consider:• Setting up a separate, free-standing Editors’ Code Committee, comprising both its ownmembers and non-members. This would appear fairer, more representative andstatesmanlike. It could also, in the long term provide a way of bridging the gap betweenits own members and those outside the Guild.• Inviting, as a further refinement, Code Committee membership from selected seniormembers of leading journalistic organizations, which again might contribute to a moreinclusive approach to self-regulation.• Working with the PCCSL to organize regular workplace seminars on the operation of theCode and of self-regulation.End82

ANNEXURE 02Background:Report of the Editors’ GuildCode of Practice Review CommitteeIn or about 2002/03, the Members of The Editors’ Guild of Sri Lanka unanimously approved aCode of Professional Practice, also referred to as the Code of Ethics for Journalists.A different Code was already in existence, but few knew about it, and fewer ever implemented it.This was the Code of Ethics that was framed by the statutory Press Council, sometime in theearly 1980s, which had been then Gazetted under the Press Council Law. In fact, it was the lawof the land, though in deed, it was almost never practiced.The Editors’ Guild framed a Code taking into consideration the Press Council Code, variousforeign Codes for Journalists, and on the prevailing media culture in Sri Lanka. The Code wasalso based on the principles enunciated at the 1998 Colombo Declaration on Media Freedom andSocial Responsibility.The Code followed a pledge made by the signatories to the Colombo Declaration, in answer to ademand by politicians and the public, that the Journalists have a set of guidelines for themselves,to be implemented by a self-regulatory mechanism, in return for the repeal of criminal defamationlaws.In 2002, Parliament unanimously repealed criminal defamation laws, and The Editors’ Guild kepttheir part of the ‘bargain’ by enacting a Code. The newly established Sri Lanka Press Institute setup the Press Complaints Commission of Sri Lanka to implement the Code.The Editors’ Guild Code, and the establishment of the Press Complaints Commission of SriLanka has negated the need for the implementation of the Code under the statutory PressCouncil Law. It has also, made the Press Council itself functus, and non-operational since 2002.Present situation:The Editors’ Guild Code provides for an annual review of the Code. It might be pointed out thatthis is a review, and not necessarily a compulsory revision of the Code. It must be howeverconfessed, that no proper review has been done by The Guild since 2002. In 2005, The Guildappointed a Code Review Committee headed by Judge Christopher Weeramantry, retired VicePresident of the International Court of Justice, and a prolific writer on press freedom issues. This83

Committee comprised several key personalities in civil society, and from the press. They weremandated to recommend to The Guild any revisions that may be required to the Code.This Code Committee met, and exchanged views, but was unable to provide The Guild with anyrecommendations for nearly two years, thus delaying the process of a proper review of the Code.In 2007, The Guild wrote to the Press Complaints Commission and requested them to appoint aparallel Code Review Committee to make recommendations, which they proceeded to do. Thepublic was also invited to make recommendations to this parallel Committee. Judge Weeramantrythen informed the Press Complaints Commission that it was not in a position to submit a report.About the same time, The Guild also appointed a Code Review Committee of its own Members tostudy these recommendations and to submit a report to The Guild with a view to revising, i.e. ifany revision was necessary, to the Code.One of the steps taken by The Guild’s Code Review Committee was to request the Sri LankaPress Institute to invite the Secretary of the UK Editors’ Code Committee, Mr. Ian Beales to SriLanka to assist the Committee in their work. Mr. Beales was familiar with The Editors’ Guild Codeof Professional Practice and had been one of the important persons who helped in the setting upof the Press Complaints Commission of Sri Lanka in its early stages, especially through the aegisof the Commonwealth Press Union.Mr. Beales arrived in Colombo on October 16, 2007 and met the Code Review Committee andseveral others during a week-long stay in the country, among them, the Chairman and membersof the Dispute Resolution Council of the Press Complaints Commission, the Secretariat of thePress Complaints Commission and office-bearers of several media organisations, including theSri Lanka Working Journalists Association (SLWJA).Useful discussions were held between Mr. Beales and The Guild’s Code Review Committee, andon his return to the United Kingdom, Mr. Beales has, on a request by the Committee sent us hisrecommendations. This report has been carefully considered by the Code Review Committee,and the Members of the Committee are pleased to submit the following recommendations to theMembership of The Guild for discussion and adoption as amendments to The Guild’s Code.Recommendations on possible changes to the Code:The fact that the Code has not been reviewed annually may be regrettable, but it is not a disaster.A requirement to review does not imply automatic changes. Revisions should take place only onspecific evidence that there is a gap that needs to be filled. Too many changes made toofrequently cause confusion, indicate a lack of decisiveness, and result in non-compliance.The views given by the PCCSL Parallel Committee made some suggestions that were ratherpunitive in intent. (The previous suggestions from the PCCSL appear designed to toughen up thesituation to teach recalcitrant editors a lesson. It was not the right approach, we thought. TheCode is already tough. If it is not being implemented, then the PCCSL should put persuasionabove coercion.)Possible Code changes that might be considered:1. Insert a clause into the preamble, requiring co-operation with the PCCSL. A similarparagraph in the UK Code says: Editors should co-operate swiftly with the PCC in theresolution of complaints. Any publication judged to have breached the code mustprint the adjudication in full and with due prominence, including a headline referenceto the PCC. Although much of this is already a moral obligation on Sri Lanka editors,it is not codified.1A. Delete the reference to “International” in the wording in the English text “….whilemaintaining the highest international standards of journalism”. There is someconcern about international journalism practices, and we could do without such areference provided we maintain our own high standards. The Sinhala text does nothave this reference somehow.2. Insert a restriction on reporting of suicide, a fairly important issue in Sri Lanka. TheUK Code, for instance, was recently revised to say: When reporting suicide, careshould be taken not to give excessive detail of the method used.3. Make clear that the Code applies to online, as well as print, versions of publications,giving a moral advantage over other online publishers.4. There have been suggestions that the Code should be extended to curb particularlygraphic reporting and pictures, often in the local language press. However this is adifficult area, and would appear to be covered by the current clause 6.184

equirements for newspapers to present the relevant information with due sensitivityand discretion, subject to its duty to publish in the public interest.5. The Tamil press has indicated that the upsurge in terrorist incidents by Tamilterrorist groups has led to suggestions of an increase in editorial discriminationagainst Tamils, which has been considered. However, this would appear to becovered already by clause 6.3, which bans the knowing or wilful promotion ofcommunal or religious discord or violence. Also, Clauses 6.4i and 6.4ii banpejorative or irrelevant references to race or religion concerning named individuals.The Code covers all ethnic groups and cannot be applied selectively. Any changesshould take this into account.6. Questions about the Code's length might be considered. Some critics suggest it istoo long and prefer the brief general principles of the IFJ Code. Others say the Codeneeds to be expanded to be more specific, which would make it longer. The IFJdocument is a code" of ethics, broad in thrust, and based on theory rather thanpractice, and is not subject to adjudication. The current Editors' Code is tailored tospecific Sri Lankan circumstances, is designed to be adjudicated upon, and isshorter than many similar documents. Extending it would inevitably make it lessreadable, and less read, which would be retrogressive.However, an option is to consider a supplementary pamphlet or booklet that answersfrequently asked questions, based on experience of previous PCCSL adjudications orguidance. Such a booklet would probably need to be a joint publication with the PCCSLand address other frequently answered questions. The Code Committee will publishthrough the PCCSL such a FAQ (Frequently Asked Questions) pamphlet for editors andjournalists to enlighten them on the provisions of the Code and the workings of thePCCSL.The Code Committee also went into the aspect of an issue that has been raised from time to timeon a Code of Ethics for the Publishers. The Committee was of the opinion that this was a matterfor the Newspaper Society to consider. While The Editors Guild could convey the need for such aCode to the Publishers, it was felt that relations between a Publisher and an Editor is essentiallyone of an industrial relation and that industrial relations, or inter-personal relations cannot becovered by a Code. We note that the UK Code steers clear of any such contractual obligations. Ifsuch a provision is included, it could be argued, that as an extension, a journalist could havecertain rights on editorial independence over an Editor. This might lead to anarchy in the newsroom. Where one draws the line in such situations, is the question.The Committee is strongly of the view that Publishers should however be requested to includecompliance of the Code by its editorial staff as part and parcel of their respective contracts –including those of their editors, with a request to the Publishers seeking their support for theimplementation of the Code. The Code Committee also recommends the appointment of a moreinclusive Committee, inviting suggestions from the public and industry on how the Code might berevised in the future.This new Code Committee will be a free-standing comprising its own members and nonmembers:Upali Tennakoon, Manik de Silva, Siri Ranasinghe, A. Sivanesaselvan, SinhaRatnatunga, T. Kuruwita Bandara, Jatila Wellaboda and V. Thevaraj.END85

Complaint Summary for the Month of January 2007Complaint ComplaintNoOfficerComplainant001/01/2007 Ameen PrincipalNallathanni Tamil MahaVidyalaya, NallathanniNewspaperCodeClausesHeadlineThinakkural 2 O/L manawarkalukkuseeruday viniyogam...002/01/2007 Ameen Mr. Suranga Fernando 268,Murukandiya, Bingiriya003/01/2007 Ameen Mr. T. Ariyarathna 174/4Dewalaya Road, Pamunuwa,MaharagamaLakbima 2 "Idiriyen peminiyathuru padhiya mapadawagena aaMotor rathaye gatuna"Irida Divaina 10 "Idiriyen peminiyathuru padhiya mapadawagena aaMotor rathaye gatuna"004/01/2007 Ameen Mr. T.S.P. SamarasingheSri Lanka Navy HeadquartersColomboMawbima 2 arakshaka kalapayacolumn86

005/01/2007 Kamal Mr. C.H. T. Gamage454/30,DutugamunuMawatha, Thalangama,BattaramullaIrida Lakbima 2 kadukaraye nayayamsamagama ratbeviduli balagarayatamokada uneComplaint Summary for the Month of February 2007ComplaintNoComplaintOfficer001/02/2007 Kshama Mr. Sunanda Deshapriya 24/228th Lane, off Flower RdColombo 7006/02/2007 Kamal Dr. A. I. Vidanagamage 4/88High Level Road,Maharagama002/02/2007 Kamal Mr. U. S. Attanayaka 12/14,Purana Vihara Road,Colombo 06 - 6003/02/2007 Kamal Mr. U.S. Attanayaka 12/14Purana Vihara Road,Colombo 06Complainant Newspaper CodeClausesHeadlineThe Island 2 FMM seeks release ofRailway unionistsDinamina 2 Sulu diya duradiga yaiDivaina 2 jathika samamandalaye girithalewadamulusanvidayakaintapirisak paharadethiLakbima 2 Jathika sama mndalegirithale wadamulusanvidayakaintapirisak pahara dethi004/02/2007 Kamal Mr. R.K.J Senadeera Divaina 2 Ellum gasen basamaha rathriye gedarayai005/02/2007 Ameen Mr. M.M.M Ibraheem 14Colombo Road,MadurankuliyaComplaint Summary for the Month of March 2007Priya 10 Ellum gasen basamaha rathriye gedarayaiComplaintComplaintNoOfficer Complainant Newspaper001/03/2007 Kshama Mr. Kanchana Perera, 35Galle Road, Matara002/03/2007 Ameen Mr. M. M. M. Ibrahim 14Colombo Road,Madurankuliya, PuttalamThe Island 4CodeClausesJanani 10 obsceneHeadline003/03/2007 Ameen Mr. M. M. M. Ibrahim 14,Colombo Road,Madurankuliya Puttalam004/03/2007 Kamal Mr. N. C. Sarath Navaratna,Thiranagama Maha VidyalayaKohile Gedara, Kurunagala005/03/2007 Kamal Dr. R. W. S. GunawardanaParana Kottawa Road,NawinnaMaharagamaVanavil 10 Obscene articlesLakbima 2 Obscene articlesIrida Divaina 2, 4 waidya sabaweliyapadinchiya athathnathath mataprathikara karannapuluwan87

006/03/2007 Kamal Mr. B. A. B. MullegamaMahawali Project, UnitManager’s Office, HobariyawaGirandurukotte007/03/2007 Ameen Mr. K. Thiruchchelvam BarathiVasahar Vattam (Library) WeliOya, Upper Division, Hatton008/03/2007 Kamal Mr. A Rathnasiri84/1,RanmuthugalaKadawatha009/03/2007 Kamal Mr. S. Kulathunga 120Kuruppumulla Road,PanaduraDinamina 2 Anangayata thanikndoshayakThinakural 4 "SeveySeykintravarkalMeethuthan SetrayVary Ireypparkal"Divaina 2, 9 Thapale horu matakala deLankadeepa 7 Thapale horu matakala de010/03/2007 Kshama Mr. S. S. Ranasinghe SriLanka Navy HeadquartersColomboSunday Leader 4 Navy in tender benderComplaint Summary for the Month of April 2007ComplaintOfficer Complainant NewspaperComplaintNo001/04/2007 Kamal Mr. K. R. ThilakarathnaRichmond College, GalleCodeClausesHeadlineIrida Divaina 2, 4, 9 Lamun pasala sadahanowe.Janadipathithumani Hamudapalanayen apedaruwan bera denna.002/04/2007 Kshama Mr. S. L. Weerawardhana Daily Mirror 3 The politics of harmand hate003/04/2007 Kshama Mr. K. Balendran Sunday Times 2 Interpol hunts for bigTiger moneylaunderers004/04/2007 Kshama Mr. Rohan Perera Maubima 2, 4 Hora Police005/04/2007 Kshama Dr. Jayalath Jayawardena 555Wewela Church Road,Weligampitiya, Ja Ela006/04/2007 Kamal Mr. A. AbewickramaAkurassa, Matara007/04/2007 Kamal Mr. K. B. NishshankaTheripaha, Nuwara Eliyaharaha008/04/2007 Kshama Mr. Group from meegoda,kandewatte, homa gamamarket009/04/2007 Kamal Mr. T Wikkramasinghe 191Veluwana PlaceI.T.N. - TV 4 speech made by HonHemakumaraNanayakkara inparliament which wastelecast over ITNIrida Lankadeep 2, 3 Aurudu samayejanapathi rate nahaLankadeepa 6 Aurudu samayejanapathi rate nahaRivira 2 Assault on tissaravindra perera's wifeLankadeepa 4 Paper is Not PublishHim News and88

Colombo - 09010/04/2007 Kamal Mr. K BandaranayakaGalmaduwa R DKundasaleArticlesSilumina 4 Pataka Aithiya011/04/2007 Ameen Mr. A. L..M Athaullah Virakesari 2 "PerinavathaweeklyNO 157, Peoples' Bank RoadMuttukkatteykaleyAkkaraipaththu -1MuriyadipparaFeriyal"012/04/2007 Kamal Mr. K. S. Pathirana, Policestation, MaskeliyaLankadeepa 2, 3 Anawasara wali godadamim nisamaussakaletabarapathala hani013/04/2007 Kamal Mr. K S D Silwa Dinamina 2 Ekama bim kattiya628/E Galwala JunctionMakola RoadMakola014/04/2007 Kshama Mr. Aslam Othman 149 KewRoad, Colombo 2thundenekuta vikunadepala samagamakatty paniDaily Mirror 10 Would you like to beslaughtered the halalwayComplaint Summary for the Month of May 2007Complaint ComplaintCodeNoOfficer Complainant Newspaper Clauses Headline001/05/2007 Kamal Miss. N Krishanthi Dinamina 2, 3, 7 vikasitha wasanthaya75/2 kalahugaswila mukulitha nowne audara minisuntaNittabuwapinsiduwannataya002/05/2007 Kamal Mr. R M A Rathnayaka T21/A1Dinamina 9 Dinamina andsarasaviyaGnanawimala R DNewspapers notDematagoda - colombo - 9publish Book Riwive003/05/2007 Kamal Mr. L Gunathilaka Lankadeepa 2 H P PariganakaNo-70Kirindivita Gampaha004/05/2007 Ameen Ms. philomonaHadiyahkuwait005/05/2007 Ameen Mr. S Jeganathan 26Panchimola Elkaduwa RoadVirakesari 10 picVira kesariweeklyAlaviye mulikathwayadinapala samuhayata10 not relevant to anypublished materialWattegama89

006/05/2007 Kshama Mr. Stephen Champion, 9Stedham Chambers Coptic StLondon, UKThe Island 10 What is the JVP'sagenda?CP007/05/2007 Kamal Mrs. S. WeerasinghePilimatalawaDinamina 7 PilimathalaweNithtyata sambandaCPanangayek008/05/2007 Ameen Mr. S Arulpirakasam General 10 Publishing CNo 1 A Kattukale, lake RoadKandy009/05/2007 Kamal Mr. G Jayathissa 196/2/1 General 2, 7 Bawdda ha PaliwishwawidyalayeGampaha R,DDushitha registarJaelawaraykCj010/05/2007 Kamal Mr. H. P. Nishantha Pathirana149/3Pinnakalewatha DivulapitiyaDivaina 2, 7 wiyaparikayakugebiriyagen kappamganimata thathkalasakakaru polis daleCj011/05/2007 Kamal Mr. W Dayawansa AttampityaNational School, Attampitiya012/05/2007 Kamal Mr. S. ThennakoonThihariyaGampahaDivaina 4 Viduhalpathywarayageakkaryakshamathawaya nisa attampitiyaviduhale addyapanayakadawatilaDivaina 10 Publish the photograf CpCPP013/05/2007 Kamal Miss. W. P. Wishwa Lankadeepa 2, 3 Pare awahiraya CPriyadarshani 56/4 JayaweeraMawatha, Gonawala,KelaniyaBalimata idiriyata giyamahaththaya ihalinthibu pas kandakadawati yatawanawa014/05/2007 Kamal Mr. d Kumara 200/1Kahatgolla Watte, Mihirigama015/05/2007 Kamal Mr. J. A. Gamini, Ananda SriMaha Baddrakali AmmanDewalaya, KandydakkaLankadeepa 2, 3 wathura higayatapiliyamak nathuwakahatagolla waththewasiyo gam athharayanna patanaranDinamina 2 Galethanna mahadewalaye sthreedutionayakRRCj016/05/2007 Kamal Mr. S Jayasingha 831/4 bThumpaliya Road, Ja-elaIridaLankadeep10 Artical not publish CP017/05/2007 Kshama Mr. Fazal Mohamed Sri LankaRugby Football Union7c Reid AvenueColombo 7Daily Mirror 2 Sri Lankans routed inDubaiCP90

P018/05/2007 Kamal Mr. W. S. Basil Fernando, Maubima 10 Wadan sawiya CSamatharangaMaha WewaP019/05/2007 Ameen Mrs. Cader Thinakural 2 "kalluri Sarpaha CKalmunai Zahira CollageKalmunaiManawarkalidamPanam Arwittu varumpahuthith thaleywar"020/05/2007 Kamal Mr. M Sirisena 61/30 Irida Lakbima 10 Mama marennaBayana eth MagePannipitiya RoaddaruwaBattaramulla021/05/2007 Kamal Miss. M. Saumta SubodiniPubudupuraAnuradhapuraMaubima 10 Danuma wadanprehelikaCPCP022/05/2007 Kamal Mr. D Piyasiri20/10 D, AbahenawattaJathika Niwasa, GanemullaKaluwala rd, Ganemulla023/05/2007 Kamal Mr. O. Karunadasa 258Deerananda MawathaMahawaskaduwa,Dinamina 2 Niwasa adikariyelokkek gamwasiyekutapene pumbaiGeneral 10 Niwasa adikariyelokkek gamwasiyekutapene pumbaiRRCPWaskaduwa024/05/2007 Kamal Mr. W Candrasiri DisanayakaUdara NiwasaHanthanangodaLunuwatta025/05/2007 Kamal Mr. N Sosindra hadunge 34 aKuruduwaththaIsadin Town, MataraGeneral 10 E P F Case CPLankadeepa 2, 3, 7 Dakunu palath sabaweandu pakshamanthriwaru dedenekguty anaganithiRR026/05/2007 Kamal Rev. Rangalle UdithasiriSri Visuddharama PuranaViharaya, GotimbaragamaRannaLankadeepa 10 Nayaka himinamaathadanguwataCj027/05/2007 Kamal Mr. P. Piyathilaka AlugollaMakaduraGonavila028/05/2007 Kamal Mr. T K H K Pathirana 55,lindugawaththa labuduwa Gall029/05/2007 Kamal Mr. T. K. H. K. Pathirana 55 ,LabuduwaGalleDinamina 10 Dayaka saba rasvimavidio kala sakakarurimandLankadeepa 2, 3 Wasikiliwale watunaaliya beragannawanajiviyen noawatagamiyo udgoshanayeLakbima 2, 3 Wal aliyek walakatawati marutaCjRRRR91

030/05/2007 Kshama Mr. Pujitha Wijeratne222 Sunethra Mawatha,Pepiliyana, Borelasgamuwa031/05/2007 Kamal Mr. H. A. Jayasena UdawelaOpanayaka032/05/2007 Kamal Mrs. H. R. SagarikaPremasara 62, PathiragodaRoad, PamunuwaMaharagamaGeneral 7 Incorrect informationand byersLankadeepa 2 Sammurdiyen le dandundaLankadeepa 2 Nugegoda SanthaJosap BalikaweDalpandu awlajanapathi Lagata yaiCPRRRR033/05/2007 Kamal Mr. P. K. Gavinda Ariyarathna136/1 Temple RoadMaharagama034/05/2007 Kamal Mr. Sunil HettigeKalugalahenaDeniyayaIrudina 10 Competition FrompaperDinamina 10 Competition FrompaperCPCPComplaint Summary for the Month of June 2007ComplaintComplaintNoOfficerComplainant001/06/2007 Kamal Mr. Clarance Perera 1026,Maeliya Ja-ela002/06/2007 Kamal Mr. Jayantha samarasinghaSri Gnanendra road,RatmalanaCodeNewspaperClausesGeneral 10General 10Headline003/06/2007 Kamal Mr. A. H. A. Nisal ChinthakaAsurawasa,NaranowitaPorawagama004/06/2007 Ameen Mr. R. Satheeskaran 79Messenger Street ColomboIrida Lankadeep 10Uthayan 10 About PublishedAdvertising005/06/2007 Ameen Mr. S Arul Pragasam 1/A Virakesariweekly10 "SirupanmayinarukkuEthirahaKatukale Lake RoadParappappadumVisakKandyKaruththukkal"006/06/2007 Kshama Mr. L. S. W. Ponniah General 10 unknown86 College Street,Kotahena007/06/2007 Kamal Mr. Sabnam Mussamil Sunday Leader 9 unknown92

008/06/2007 Kamal Mr. Padmasiri DasanayakaHenegamaPohuwawitaHoranaGeneral 10 unknown009/06/2007 Kamal Mr. K.A.D. Walter Perera General 10 unknown015/06/2007 Kshama Mr. Pandu BandaranaikeMadugas Walawwa, YakkalaThe Nation 2, 9 Minister ditches youthin Japan64/7 ModaravidiyaColombo- 15010/06/2007 Kamal Mr. Gunapala Costa Irida Lankadeep 2 Vass dan suwaathataWadumullaDewalapola011/06/2007 Kamal Old Girl’s AssociationSwarnamali BalikaVidyalaya,Anuradapura012/06/2007 Kshama Mrs. Indumati GunewardenaDuncadawa Block H Estate,Nattandiya013/06/2007 Kamal Mr. H. M. K. Darmasena 238A - 27 HansagamaKalanimulla , Angoda014/06/2007 Kamal Miss. A. R. M. Chandrika 51,BatekumburaGodawela, PolgahawelaGeneral 2, 3 EkolosdahakLankadeepa 6 not stateNodunnai LamayaPasalata Aragena naDivaina 2, 7 Princege GolayathMarumkaiLankadeepa 2, 7 Baharenaye SrilankikaGruhasevikawakamaradala93

016/06/2007 Kamal Mr. H. D. Sanjiwa Dilruk36, Dobawala,Udugampola017/06/2007 Kamal Mr. H. D. Sanjiwa Dilruk 36,Dobawla. Udugampola018/06/2007 Kamal Mr. Mohomad HusenWeligama Urben CouncilWeligama019/06/2007 Kshama Dr. Rajiva Wijesinha block 5,BMICH BauddhalokaMawatha, Colombo 7020/06/2007 Kshama Mr. Ranjit de Soysap o box 4066 Mulgrave VIC3170Australia021/06/2007 Kamal Mr. Ranjith RathnayakaPalanwaththaPannipitiya022/06/2007 Kamal Mr. D G WijesiriInamaluwaDabulla023/06/2007 Kamal Mr. W. W. AbegunawardanaCentral Office Kundasale024/06/2007 Kamal Mrs. G SomawathiGalagamuwa WaddagalaKalawana025/06/2007 Kamal Mrs. M. Malika SangeewaniMaduwage Xl ,15PalamkaduraUhana, AmparaDivaina 2, 7 Rimand Baraye sititharunayadivinasagaththe siyavibagayata yamatanohakiweyai sithvedanawenLakbima 2, 7 Outida pethi WadiPramanayak gilamigamuwarakshithaye radviyamarutaLakbima 2 Palath sba manthriviwrtha kala basnawathumaNagaradipathi yaliviwrtha karalaDaily Mirror 2 Abductions in theEast, forces involvedAssociatedPress6 bomb kills threepassengers on a busin northern sri lankaLankadeepa 10 bomb kills threepassengers on a busin northern Sri LankaGeneral 10 bomb kills threepassengers on a busin northern sri lankaLakbima 2, 4 Kundasale KrutheemasinchanaMadyasthanayeAkkramikatha allasdutionaKommisamataGeneral 10 Kundasale KrutheemasinchanaMadyasthanayeAkkramikatha allasdutionaKommisamataGeneral 10 Kundasale KrutheemasinchanaMadyasthanayeAkkramikatha allasdutionaKommisamata026/06/2007 Kamal Mr. K. K. Aruna Shantha Divaina 2 Paharadimakata lakuYadapitiyaBellana027/06/2007 Kamal Mr. N. H. L. Jayantha DamikaFilling Station,sunitharathana himirohaleGeneral 10 Paharadimakata lakusunitharathana himi94

Uhana,Ampara028/06/2007 Kamal Mr. H K DayarathnaOlcott Avenue, GalleComplaintOfficerComplaintNo.001/07/2007 Kamal Mr. N. Premarathna Perera735/11 Piyawara,Anuradhapura002/07/2007 Kshama Mr. Nishan de Mel,Trinity College, Broad StreetOxford , UKrohaleDivaina 10 Galla adyapanakalapa karyalayeparipalananiladariwarayatapraharayakComplainant Newspaper CodeClausesLankadeepa 10HeadlineThe Island 2, 10 Where do theseinnocent peoplebelong?003/07/2007 Kshama Mr. Sudath KarunanayakePeliyagoda WarehouseComplex Co.Ltd 3 Alwis PlaceColombo 3004/07/2007 Kshama Prof. Rajiva Wijesinha SCOPPBlock 5 BMICH BauddhalokaMawatha,Colombo 7Sunday Leader 2, 4 UDA subsidiary a denof corruptionSunday Island 4 GOSL versus theRest of the WorldComplaint Summary for the Month of July 2007005/07/2007 Kamal Dr. Danistor L, Perera Irida Divaina 2, 3, 7 LekakadikariwarayaAyurvedic Medical Council OldKottawa Road , NavinnaMaharagama006/07/2007 Kamal Rev. Kristhurajayananwahanse007/07/2007 Ameen Mr. Mohamed AslamUyanwattaDewanagala008/07/2007 Kamal Mr. Doctor D. SrinathParanayapa, 263 A, DewalaRoad,yai kiyagannaniladariyaSilumina 10 Isiwarun lesa namdara hora wedun atharata puraThinakaran 2 "SabaragamuwaMahana MeeladhVila"Divaina 2 Dosthara Weyajasaha niyamaKoswattaBattaramulla009/07/2007 Kamal Rev. Rathnapure Piyarathana Lankadeepa 2 Malwathu mahaThero, Yakgirilen RajamahaViharaya, Seruwawa, ThalvitaKurunagalanahimiyangemadihathwimenYakgirilenasangawasaye vadaawasan95

010/07/2007 Kamal New Euro Nippon, 262,GalleRoad, Thalpitiya North,Wadduwa011/07/2007 Kshama Prof. Rajiva Wijesinha block 5Bauddhaloka Mawatha,Colombo 7012/07/2007 Kshama Prof. Rajiva Wijesinha block 5BMICHBauddhaloka Mawatha,Colombo 7013/07/2007 Kamal Miss. Gareesha BatugedaraSunethra,Hadapangoda014/07/2007 Kamal Mr. S. M. Chandrasena 4thFloor Sethsiripaya,BattaramullaDivaina 2 Thalpitiya pudgalikaarakshakayek giniaviya paththuveethuwala labaiDaily Mirror 4 Mystery and muddleover SLMMspokesmanDaily Mirror 2 Chains for NGO's infreed areasLankadeepa 2 Samaja katagasmaAxshaka 360Irudina 2 Kollakapu amathisaradiyella015/07/2007 Kamal Mr. S. M. Chandrasena Lankadeepa 2 Wncha kalai kiyana4th FloorSethsiripaya, BattaramullaMudal amathi biriyagebanku ginumwala athibawata pethsamakComplaint Summary for the Month of August 2007Complaint ComplaintNoOfficer Complainant Newspaper001/08/2007 Kamal Mr. M.M.P.A.J. StanleyFernando 358, Main StreetColombo002/08/2007 Kamal Mr. Mahinda DelgodaT 65, Third Avenue,MihindugamaSevanagalaDivaina 2Lankadeepa 10CodeClausesHeadline003/08/2007 Kamal Mr. K D Lakshman SarathRupasingha no- 50,ThalagamaAbepussaGeneral 10004/08/2007 Kamal Mr. R Veerasooriya No- 115,Radum MaddaysthanayaMahajana kreedanganayaPoramadulla, RikillagaskadaRavaya 2 Nayayamawadaname aththakumakda?JanadipathithumaDunna Poronduwalatamokadaune005/08/2007 Kamal Mr. R. Veerasooriya Silumina 2 WalapaneRadaum MadyasthanayaMahajana KreedanganayaPoramadulla, RikillagaskadaHagurankethaNayayamen AwathanJanathawa Thawama96

Kadauruwala006/08/2007 Ameen Mr. N. M. Rasik Thinakaran 2 "AthiparinNo 12Neerella Maha VidyalayaAkurana007/08/2007 Kamal Mr. Ranjan Jayatissa140 J, Samagi Mawatha,KadubodaDelgoda008/08/2007 Kshama Mr. Premasara Epasinghe 33Wijerama Lane, GangodawilaNugegodasiraththeyyal thondarasiriyarkal pathippuGeneral 10 "Athiparinsiraththeyyal thondarasiriyarkal pathippuSunday Times 3, 6 The Trojan Horse,Please Help Me, Alimadiwata harak009/08/2007 Kamal Mr. M B Madugallamapa/thel/Gamini disanayakaadarsha vidyalayaGeneral 2 The Trojan Horse,Please Help Me, Alimadiwata harakComplaint Summary for the Month of September 2007ComplaintOfficer Complainant NewspaperComplaintNo001/09/2007 Kamal Mr. K.P.D.P Gunathilaka 89,2/1 Koasala Street,Colombo 8CodeClausesHeadlineLakbima 2 Mawak Oya GagaRakshithaye IdikerenaSancharakaniwahanata JanathaVirodaya002/09/2007 Ameen Mr. J. Aman A/AsariggamaM.V. Gmbirigaswewa,AnuradhapuraThinakaran 2 "Asarigama VidyalayaAthiparinKawanaththitku"003/09/2007 Kshama Mr. Raju Sally Daily news 10ColomboNo details given004/09/2007 Kamal Mr. Bertram Nihal 136/1,Elhena Road, Maharagama005/09/2007 Kamal Mr. Bertram Nihal 136/1,Elhena Road,MaharagamaLankadeepa 2 BahinbasvimakDuradigagihintalinatya sahayaadyakshakatapaharadeelaDivaina 2 Teli adyakshakagensahaya adyakshakataamanushikapraharayak97

006/09/2007 Kamal Mr. H. N. L. Fernando, Officeof the Governor, Uva ProvincalCouncil, Raja Veediya,Badulla007/09/2007 Kamal Mr. Bandula SarathkumaraDigavapi Rajamaha ViharaBaudda Sangamaya 231,Waga Anshaya, Digavapiya.008/09/2007 Kamal Mr. M. Christ Bonatpu/Ihalakolaeliya RajayeVidyalaya Surakeeme SanviKolaeliya009/09/2007 Kamal Mr. P. V. M. 115, RadumKadaura,Mahajana Kreedanganaya, PoramadullaRikilligaskanda010/09/2007 Kamal Mr. Dewage Ariyadasa 371,Pansala ParaThalawathugoda011/09/2007 Kshama Mr. A M Abdul Majeed Al-Hairath Rd Pottuvil 15012/09/2007 Kamal Mr. Rukshan Bellana BaseHospital, Karawanalla013/09/2007 Kamal Mr. Sangeewa BelikotuwaSadisa Sanwardana Jalaya292, Horana Road,Pamunugama, AlubomullaLakbima 2 Uva andukarakaryalaye wahanaawa bavithayaLankadeepa 2 Deegawapiye akkra12572 ka bumiya dan655 ta BahalaDivaina 2 Kolaeliya viduhalavaseemata viruddawapradeshavaseenUdgoshanaviyaparayakaDinamina 2 WalapaneHagurnkethaNayayamen AwathanJanathwa ThawamakadauruwalaSilumina 2, 3, 7 Rajakale SuddanMella kala ApeangamporaSunday Times 6, 9 Pottuvil's pot pourisimmersDivaina 2 Karwanalla RohalSanwardana kamituwaWisurawaiLankadeepa 10 Upan hatiye bilidudaruwa kalayatavisikara mawapalagihinComplaint Summary for the Month of October 2007ComplaintOfficer Complainant NewspaperComplaintNo001/10/2007 Ameen Mr. J.M. AmanA/Asariggama MuslimVidyalaya, GambirigaswewaAnuradhapuraCodeClausesHeadlineThinakaran 2 "Vilayattu MaithanamAmeyththu tharumaruVendukool"002/10/2007 Kamal Mr. L. A. Gunarathna, Fort,GalleDivaina 2 Police ParikshakaGunarathnaWaradakaruwey003/10/2007 Kamal Mr. U. K. P. Kumaranayaka191/32, ThimbirigasyayaRoad, Colombo 05Lakbima 10 Dostharamahaththayatakiyanna epa Ethakotamata gedara yannabariwei98

004/10/2007 Kshama Mr. Lloyd L. Silva, Trees1/6, 2nd Lane AnuraMawatha, Kalubowila,Dehiwela005/10/2007 Kamal Mr. M Kristy Bonat Pu/ IhalaKolaeliya Rajaye VidyalayaSurakeeme SanvidanayaKolaeliya, Pallama006/10/2007 Kamal Mr. M. Christie Bonat, Pu/IhalaKolaeliya Rajaye VidyalayaSurakeeme SanvidanayaKolaeliya ,Pallama007/10/2007 Ameen Mr. U. L. M. N. MubeenUrban Council, Kaththankudy008/10/2007 Kshama Mr. S. Arulthasan 6 MoorRoad,Colombo 6009/10/2007 Kamal Mr. J. S. Perera 13/9 ColomboRoad, ChilawDaily news 4 Nursing Home woesLankadeepa 2 Kolaeliya ViduhaleViduhalpathige Vadathahanam KalayPasale VadaAdapanawelaIrida Lankadeep 2, 9 Puththalama KalapeShrenidari MulGuruwaruBethakatawthHoyaganna baluVara Ureykal 2 "MedakkappattuwarumPalwarththa NeerodeySheerakkappaduma"The Island 4 Catching a Cobra bythe tailGeneral 10 Catching a Cobra bythe tail010/10/2007 Kshama Mr. B. Skandakumar The Nation 10 'Women inGovernance'011/10/2007 Kshama Mr. W.L.P. WijewardenaPussellawa PlantationsLimited, 228, Havelock Road,Colombo 05.012/10/2007 Kamal Miss. Kamani Senavirathna845/12Daily news 2 Workers ProtestAgainst EucalyptusFellingSilumina 2 Misuse Simbolcopyrite ( but not013/10/2007 Ameen Mr. S. Nantha Soruban Thinakural 2 Misuse of symbol3/1 Andersdson FlatsColombo 05014/10/2007 Kamal Mr. Damith Kurunduhewa Lakbima Irida 10 Protection ofBusiness dataComplaint Summary for the Month of November 2007ComplaintOfficer Complainant NewspaperComplaintNo001/11/2007 Ameen Mr. S .J. A. Moulana No 32/3Subodharama Road,Dehiwela002/11/2007 Kamal Mrs. Himali wayjayanthamala118, Dewana Adiyara,CodeClausesHeadlineSaththiyakkural 2 ILAM MOULAVIYEYTHURATHTHI........Lakbima 10 Ekama pauleDaruwan Dedena99

apacharayataBadovtaAththidiya003/11/2007 Kamal Mr. Ubayasena Wirasinha30/9, Sunethradevi Road,Kohuwala004/11/2007 Kamal Mr. Wasantha Warnasuriya187/8, Moratuwa Road,Piliyandala005/11/2007 Kamal Mr. Jeewan thiagarajaha 86,Rosmead Place,Colombo 7006/11/2007 Kamal Mrs. Sirimali LiyanagamaRanaviru Sewa Adhikariya287, Galle Road, Colombo 03007/11/2007 Kamal Mr. D. D. A. W. Prabu 86,Rosmead Place, Colombo 7lak kala ayek daleSirikatha 10 Maupiya senehasaonama wayasedidarupatiya oben athkaranna epaDaily Mirror 2, 3 Chaimpionsmanhanhandled afterclinching titleLanka Irida San 2, 3 CHA Uthsahakaranne sri lankawachakarannadaLakbima 2 RanavirusevaadikariyaDaily news 2, 7 Forces on alert toprevent tigerinfiltration in jafnaComplaint Summary for the Month of December 2007ComplaintOfficer Complainant NewspaperComplaintNo001/12/2007 Kamal Mr. D. D. Wedagedarage 86,Rosmead Place, Colombo 07CodeClausesHeadlineSilumina 2 yapanayetharunayangebaraveem kagethurumpuwakda002/12/2007 Ameen Mr. V. Anandasangaree C-38,Mc Kenzie Road, KeppettipolaMawatha, Colombo 05003/12/2007 Ameen Mr. V. Anandasangaree C-38,Mc Kenzie Road, KeppettipolaMawatha, Colombo 05004/12/2007 Kamal Mr. G. H. Wimaladasa 472,Bopagoda, RathgamaSudar Oli 3 "onpathu ManawarkalUtpada 11 perkilimoril paliyanameymulukkattukkatheyenkirar sangary"Uthayan 2, 3 "Thunukkay kilaimoril11 per paliyanathakawal kattukkatheyenkirar Anandasangary"Silumina 10 Silumina Not Pay ForArticle.005/12/2007 Kamal Mr. B.L. Ajith Prasnna Divaina 2 Sathiyak athulathaPolice Station,laksha pahalawak100

Uragasmansandiya.006/12/2007 Kamal Mr. Wasantha KumaraKatugampola26,Godagama RoadAthurugiriyaKollakalaDivaina 2 Sathiyak athulathalaksha pahalawakKollakala101

Code of Professional Practice (Code of Ethics) of The Editors102

Guild of Sri Lanka adopted by the Press ComplaintsCommission of Sri Lanka01. PREAMBLEThis code of practice which is binding on all Press institutions and journalists, aims toensure that the print medium in Sri Lanka is free and responsible and sensitive to theneeds and expectations of its readers, while maintaining the highest standards ofjournalism.Those standards require newspapers to strive for accuracy and professional integrity,and to uphold the best traditions of investigative journalism in the public interest,unfettered by distorting commercialism or by improper pressure or by narrow selfinterestwhich conspires against press freedom. Newspapers and journalists, while freeto hold and express their own strong opinions, should give due consideration to theviews of others and endeavour to reflect social responsibility.This code both protects the rights of the individual and upholds the public’s right to know.It should be honoured not only to the letter but in the spirit – neither interpreted sonarrowly as to compromise its commitment to respect the rights of the individual nor sobroadly as to prevent publication in the public interest.Editors should co-operate swiftly with the Press Complaints Commission of Sri Lanka(PCCSL) in the resolution of complaints. Any publication judged to have breached theCode must print the adjudication in full and with due prominence, including a headlinereference to the PCCSL.02. ACCURATE REPORTING2.1: The media must take all reasonable care to report news and pictures accurately andwithout distortion.2.2: Every reasonable attempt should be made by editors and individual journalists toverify the accuracy of reports prior to publication. Where such verification is notpracticable, that fact shall be stated in the report.2.3: Editors and their staff, including external contributors, shall not publish material insuch a way as to endorse any matter which they know or have reason to believe tobe false or inaccurate.2.4: Publications are encouraged to engage in investigative journalism in the publicinterest.03. CORRECTIONS and APOLOGIES3.1: Where it is recognized by the editor that a report was incorrect in a material respect,it should be corrected promptly and with due prominence and with an apology whereappropriate, except where the correction or apology is against the wishes of theaggrieved party.04. OPPORTUNITY TO REPLY103

4.1: A fair and reasonable opportunity to reply should be given to individuals ororganizations in respect of factually incorrect statements endangering theirreputation, dignity, honour, feelings, privacy and office. The reply should be confinedto the complainant’s version of the facts and no longer than necessary to correct thealleged inaccuracy.4.2: Newspapers or journalists who respond to a complainant’s reply other than toapologize or regret the error, must then be prepared to offer the aggrieved party a freshopportunity to reply.05. CONFIDENTIAL SOURCES5.1: Every journalist has a moral obligation to protect confidential sources of information,until that source authorizes otherwise.06. GENERAL REPORTING and WRITING6.1: In dealing with social issues of a particularly shocking or emotionally painful nature –such as atrocity, violence, drug abuse, brutality, sadism, sexual salacity and obscenity –the press should take special care to present facts, opinions, photographs and graphicswith due sensitivity and discretion, subject to its duty to publish in the public interest.6.2: In reporting accounts of crime or criminal case, publications shall not, unless it isboth legally permitted and in the public interest –i. Name victims of sex crimesii. Knowingly name any young person accused of a criminal offence who is below theage of 16 and who has no previous convictionsiii. Identify without consent relatives of a person accused or convicted of a crime6.3: A journalist shall not knowingly or willfully promote communal or religious discord orviolence.6.4: i. The press must avoid prejudicial or pejorative reference to a person’s race, colour,religion, sex or to any physical or mental illness or disability.ii. It must avoid publishing details of a person’s race, caste, religion, sexual orientation,physical or mental illness or disability unless these are directly relevant to the story6.5: i. Even where the law does not prohibit it, journalists must not use for their own profitfinancial information they receive in advance of its general publication, nor should theypass such information for the profit of others.ii. They must not write about shares or securities in whose performance they know thatthey or their close families have a significant financial interest, without disclosing theinterest to the publisher, editor or financial editor.6.6: When reporting suicide, care should be taken not to give excessive detail of themethod used.07. PRIVACY104

7.1: The press shall exercise particular care to respect the private and family lives ofindividuals, their home, health and correspondence. Intrusions on this right to privacywithout consent could be justified only by some over-riding public interest.7.2: The use of long-lens or other cameras to photograph people without consent onprivate or public property where there is a reasonable expectation or privacy isunacceptable, unless in the public interest.7.3: Particular care should be taken to ensure that in cases involving grief or shock,inquiries and approaches are handled with sensitivity and discretion.7.4: Young people should be free to complete their school years without unnecessaryintrusion. Publication of material concerning a child’s private life would be acceptableonly if there was some exceptional public interest other than the fame, notoriety orposition of his or her family or guardian.7.5: The restrictions on intruding into privacy are particularly relevant to inquiries aboutindividuals in hospitals or similar institutions, unless it serves the public interest.08. HARASSMENT and SUBTERFUGE8.1: Journalists, including photo-journalists, must not seek to obtain information orpictures through intimidation or harassment or by misrepresentation or subterfuge. Theuse of long-lens cameras or listening devices must also not be used unless this can bejustified in the public interest and the material could not have been obtained by othermeans.09. DIGNITY9.1: Every journalist shall maintain the dignity of his or her profession.INTERPRETATION‘Public Interest’ means;1: i. Protecting democracy, good governance, freedom of expression and thefundamental rights of the people and of keeping them informed about events that wouldhave a direct or indirect bearing on them, and that of their elected government, anddetecting or exposing crime, corruption, maladministration or a serious misdemeanor;ii. Protecting public health and security and social, cultural and educational standards;iii. Protecting the public from being misled by some statement or action of an individualor organisation.2: In any case where the public interest is involved, the Press Complaints Commissionwill be entitled to require a full explanation by the Editor and/or journalist demonstratinghow the public interest was served.ONLINE PUBLICATIONSThe provisions of this Code will also apply to the Online publications of the print media.REVIEW105

The Editor's Guild of Sri Lanka shall review the provisions of this Code from time to time,in consultation with a Code Committee comprising of members, and non-membersappointed by The Guild.The Code is supported by the following organizations:• The Newspaper Society of Sri Lanka• Free Media Movement• Sri Lanka Working Journalists Association• Sri Lanka Press Institute• Sri Lanka College of Journalism• Sri Lanka Tamil Media Alliance• Sri Lanka Muslim Media Forum• Federation of Media Employees Trade Union• South Asian Free Media Association (SAFMA) – Sri Lanka ChapterEND/PCCSL106

Rules and Complaints Procedure of the PressComplaints Commission of Sri Lanka1. Any person who reasonably believes that he has been adversely affected by a published item,including a news story, article, photograph and/or graphic that appeared in a newspaper or amagazine published in Sri Lanka may complain to the PCCSL. The PCCSL will also entertainthird-party complaints on a case-by-case basis.2. The complaint of the said complainant shall be in writing and duly signed preferably in theprescribed form and communicated to the PCCSL in person, by Registered Post, Facsimile or E-mail.3. The complainant shall annex a copy of the published item, which he alleges adversely affectedhim, along with the said complaint. Where the complaint is communicated via e-mail or any otherelectronic means, the complainant shall take steps to have the complaint form duly signed and toprovide a copy of the published item along with a copy of the complaint be delivered to thePCCSL within seven working days thereof.4. The Chief Executive Officer (CEO) of the PCCSL shall entertain a duly received complaint onlyif it appears that the published item referred to has breached the Code of Professional Practiceof The Editors' Guild of Sri Lanka as adopted by the Press Complaints Commission of SriLanka.5.The CEO shall not entertain a complaint against any published item after two years from itspublication.6. Once the complaint is entertained the CEO shall, within one working day thereof with a copy tothe complainant, communicate the same to the Editor of the newspaper or the magazineconcerned and call for a reply from the said Editor within a maximum period of five working daysthereof.7. Failure by the Editor of the newspaper or the magazine as the case maybe to tender his replyon the due date may result in the said complaint being directly referred for adjudication by theCouncil of the PCCSL. Provided, however the Editor or someone acting on his behalf requeststime to reply giving reasons in writing and such request is deemed by the CEO to be areasonable request, such further time may be granted by the CEO.8. The CEO shall make all endeavors by way of conciliation and/or mediation to facilitate theparties to enter into a settlement within the shortest period of time, but no later than four weeksfrom the date of entertainment of such complaint. Such settlement may include a correction,correction and/or apology and/or a right of reply. Provided, however the CEO may engage theservices of a member of the Dispute Resolution Council (DRC) of the PCCSL for such mediation.9. When a correction, and/or apology and/or a right of reply is published pursuant to asettlement before the PCCSL by the newspaper or the magazine against which the complaintwas made, it may be specifically stated in the said newspaper or the magazine that suchpublication is pursuant to a settlement reached before the PCCSL.10. Where settlement is not possible by way of conciliation and/or mediation, the Council of thePCCSL shall adjudicate the complaint within two weeks from the date of such failure to reach asettlement by way of conciliation and/or mediation.11. Notwithstanding the aforesaid, the CEO may refer any complaint entertained, directly foradjudication to the Dispute Resolution Council (DRC) of the PCCSL, if it appears to him/her thatsuch adjudication is necessary in the public interest and/or interest of the newspaper industry,arid/or interest of the complainant.12. The CEO should appoint three members from the Dispute Resolution Council (DRC) for suchadjudications.13. Quorum for any adjudication by the Council of the PCCSL shall be three whilst alwaysmaintaining non-press related members' majority.14. A member of the Council of the PCCSL having a specific personal interest in the content ofthe published item complained of shall not take part in such adjudication.Evidence15. At the request of the Arbitral Tribunal, the parties shall state the evidence on which they wishto rely on, specifying what they wish to prove thereby.107

16. The Parties shall produce as requested by the Arbitral Tribunal the documentary evidence onwhich they rely.17. The Arbitral Tribunal may when deemed appropriate, require the submission of written affidavits.18. The Arbitral Tribunal may refuse to accept evidence offered to it if it considers that suchevidence is not required or is irrelevant or that proof can be established more simply by othermeans on a particular matter.19. The Arbitral Tribunal shall require the parties to the dispute to be comprehensive in any or allstatements submitted in accordance with the foregoing Rules and may dismiss the case if themember of the public fails to comply with such requirement. In the event that a publication who isa party to the dispute fails to submit any or all statements in accordance with the foregoing Rules,such failure will not prevent the continuation of the arbitration proceedings.20. Unless the parties agree otherwise, the Arbitral Tribunal may appoint an expert to give hisopinion on a particular matter.21. In the event that a party fails to appear at a hearing or otherwise to comply with an order anddoes not show valid cause for such failure, such failure shall not prevent the Arbitral Tribunal fromproceeding with the case and or rendering an award.The Award22. Unless the parties to a dispute expressly confer on the Arbitrator, in writing power to awardany other relief, the powers of the Arbitrator to award relief in any arbitral proceedings shall belimited to making an order to the publication who is a party to the dispute to publish a right ofreply and or correction and or apology in the media in which the publication of the matterin dispute was made.23. An arbitral award shall be made not less than one (1) month from the date the statement ofClaim is submitted unless otherwise determined by the Council.24. In the event a settlement is made, the Council may at the request of the parties confirm suchsettlement in the Award.25. The award shall be made after having conscientiously considered and evaluated all aspectsof the proceedings and after the Arbitral Tribunal determines what has been provided case.26. In the event, the Council sits in to as the Arbitral Tribunal; the majority opinion of the ArbitralTribunal shall prevail. .27. A separate issue or part of the matter in dispute between parties may, at the request of aparty, be decided by a separate award. If any party objects, such an award may be rendered onlyif the Arbitral Tribunal deems that there are exceptional reasons therefore.28. Where a party has partially admitted a claim, the Arbitral Tribunal may give a separate awardon the part that has been admitted.29. The award shall be rendered at the place of arbitration. The award shall contain an order ordeclaration and the reasons therefore and shall be signed by the arbitrator or all the arbitrators,as the case may be. An award may be rendered even in the absence of the signature of anarbitrator, provided that the award has been signed by the majority of the arbitrators and containsverification by them that the arbitrator whose signature is absent took part in deciding the dispute.30. An Arbitral Tribunal shall after the close of the proceedings submit to the Commission, onecopy of each award as well as a record of all proceedings.Correction or change of the Award31. Any obvious miscalculation or clerical error in an award shall be corrected by the ArbitralTribunal.32. In the event that a party so requests, within thirty (30) days of receiving the award, theTribunal may decide a question which should have been decided in the award but which was notdecided therein.33. In the event that a party so requests, within thirty (30) days of receiving the award, theArbitral Tribunal may provide an interpretation thereof in writing.34. Before the arbitral Tribunal takes such action, the parties shall afford an opportunity toexpress their views.108

Enforcement35. In the event a publication fails to abide by the terms of settlement of conciliation, mediationand/or arbitration proceedings, the Council shall assist the member's of the public to enforce suchterms of settlement before High Court in terms of the Arbitration Act, No. 11 of 1995.36. An arbitral award may be enforced by applying to the High Court within one Year after theexpiry of fourteen (14) days of the making of the award in accordance with the provisions of theArbitration Act No 11 of 1995.37. Any adjudication of the Council of the PCCSL. shall be published, in full, by the relevantnews paper or magazine in its very earliest publication thereafter.38. Such adjudication of the Council of the PCCSL is equivalent to an award by an ArbitralTribunal referred to in the Arbitration Act, No. 11 of 1995 and provisions of the said Act shallapply mutatis mutandis for the enforcement of such adjudication39. Any decision of the CEO and/or Adjudication of the Council of the PCCSL shall be final andconclusive for all purposes and cannot be challenged before a court of Law.40. The CEO shall maintain records of all complaints and decisions of conciliation, mediation andarbitration proceedings and shall make available to the Commission an annual statement, whichwill be made available to the public Thereafter by way of a publication by the Commission.41. This procedure is effective for any complaint against a published item appearing in anewspaper or a magazine published on or after October 15, 2003.42. The interpretation of the Code of Professional Practice of the Editors' Guild of Sri Lanka asadopted by the Sri Lanka Press Institute and the PCCSL shall vest with the Council for thepurpose of carrying out all provisions under these Rules.Spokesperson of the PCCSL:43. The Spokesperson for all policy matters relating to the Company shall be the Chairman of thePCCSL, or any member of the Board authorized to speak on behalf of the Board.44. The Spokesperson for all Complaints received and decisions made by the Dispute ResolutionCouncil (DRC) will be the CEO, provided however; that the CEO may consult the Chairman of theCouncil where it is prudent to do so, but in any event no details will be provided to the pressand/or electronic media and/or the public on-going inquiries, and any interpretation of any arbitralawards made by the Council will be made by the CEO only after consultation with the Chairmanof The Council and/or the Arbitral panel.45. Any officer of the PCCSL who may wish to contribute an article or be part of any mediadiscussion in the electronic media relating to the work of the PCCSL will require the prior approvalpreferably in writing, of the CEO, but in any event, such officer is precluded from speaking on anypolicy matters which will be the prerogative of the Board of Directors.46. All press. Releases by the CEO will require the prior sanction of the Chairman of the PCCSLprovided that if they relate to any matter involving a complaint, it will require the authorization ofthe Chairman of the Council.47. These procedures will be reviewed annually or as and when required and if necessary revisedand submitted by the CEO to the DRC for approval and to the PCCSL Board of Directors forratification and implementation.109

COMPLAINT FORMName in Full:…………………………………………………………..Address: ………………………………………………………………………………….Telephone: ……………………….., Mobile:…………………………… Fax:…………………………….Email:……………………………………….Newspaper/Magazine…………………………………..Publication date:……………………………..Headline:………………………………………………………………………………………………………………..Please indicate which clause/clauses of the Code of Professional Practice, in your view hasbeen breached. (Give clause number only)…………………………………………………………………………….By signing below I agree to abide by the following terms and conditions:1. I agree to participate in the process adopted by the Press Complaints Commission of Sri Lanka(PCCSL) in resolving the complaint.2. I agree to abide by the settlement reached between myself and the Editor through thefacilitation of the PCCSL.3. I have enclosed a copy of the newspaper article against which the complaint is being made,and my version of the facts.Please note that the PCCSL follows the Rules and Complaints Procedure of the Commission inseeking a settlement. As per clause 38 of the Procedure, if a settlement is reached through theintervention of the Dispute Resolution Council (DRC) of the PCCSL, such a decision is equivalent toan award by the Arbitral Tribunal referred to in the Arbitration Act No. 11 of 1995, and provisions ofthe said Act shall apply “mutatis mutandis” (as it is) for the enforcement of such adjudication.Any decision of the CEO and or the Adjudication of the Council of the PCCSL is deemed final andconclusive for all purposes, and cannot be challenged before a court of law.…………………………………………….Signature of Complainant…………………………………DateConciliation is the first step in seeking a settlement. The PCCSL obtains the services of the DRC to adjudicatein the matter if conciliation fails.96, Kirula Road, Colombo -05, Sri LankaTel: (+94 11) 5353635, 5333002 | Fax: (+94 11) 5335500 | E-mail: pccsl@pccsl.lk | Web: www.pccsl.lk110