March 2012 Ordinary Busines Paper - Narrabri Shire Council - NSW ...

of the NorthWestOur Reference:Your Reference:Contact Name:Telephone:EL:ELMrs Libby Lantz(02) 67ee 6833CouncillorNanabri Shire CouncilNARRABRI NSW 2390l4thMarch2072Dear CouncillorRe: Ordinary Council Meeting -Tuesdayr 20th March 2012You are advised that an Ordinary Meeting of Council will be held at the Narrabri ShireCouncil Chambers,46-48 Maitland Street, Nanabri on Tuesday,20th March 2012 commencingat 10.00am.AGEI\DA1. 9.30am: Morning tea2. 10.00am: Meeting opens.i. Opening Prayer -Fellowshipii. Apologiesiii. Public Forumiv. Disclosures of Interestsv. General Businessvi. Lunch -Narrabri Bowling Clubvii. Closure of Meeting.Pastor Peter Westman from Narrabri ChristianYours sincerely-4,//r'// ,/q *4o¡/'l'{*/Phil MarshallGENERAL MANAGERiPage 1 of 555 of the March 2012 Ordinary Business Paper

11.6 Weekly Cleaning Program – Cooma Oval Toilets ............................................................ 46311.7 Opening Of Cooma Oval Toilets ....................................................................................... 46411.8 Investigation Of Rail Crossing .......................................................................................... 46511.9 Access Options For Residents ........................................................................................... 46611.10 Barwon Local Area Command 150 th Anniversary Celebrations…………..……………..467MEETING CLOSEDPage 3 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL2ATTENDANCE/APOLOGIESORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 4 of 555 of the March 2012 Ordinary Business Paper

2 ATTENDANCE/APOLOGIESApologies received to date - NilORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 5 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL3DISCLOSURES OFINTERESTORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 6 of 555 of the March 2012 Ordinary Business Paper

3 DISCLOSURES OF INTERESTCouncillors and senior staff are reminded of their obligation to declare their interest in any matterslisted before them.In considering your interest you are reminded to include pecuniary, non-pecuniary and conflicts ofinterest as well as any other interest you perceive or may be perceived of you.Councillors may declare a interest at the commencement of the meeting, or alternatively at anytime during the meeting should any issue progress or arise that would warrant a declaration.Councillors must state their reasons in declaring any type of interest.COUNCILLOR ITEM NUMBER PECUNIARY/NON-PECUNIARYREASONORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 7 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL4PUBLIC FORUMORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 8 of 555 of the March 2012 Ordinary Business Paper

4 PUBLIC FORUMPublic Forum received to date - NilORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 9 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL5MINUTES OF COUNCILMEETINGSORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 21 ST FEBRUARY 2012.Page 10 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES5 MINUTES OF COUNCIL MEETINGS5.1 MINUTES OF THE ORDINARY MEETING OF THENARRABRI SHIRE COUNCIL HELD IN THECOUNCIL CHAMBERS, 46-48 MAITLAND STREET,NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.PRESENT: Her Worship the Mayor Cr RA Faber, (Chair), Cr CM Bolton, Cr K Bates, Cr PAEtheridge, Cr LN Kelly, Cr RC Lowder, Cr LJ Knox, Cr GB O’Regan, Cr JE Clements, Cr CCRedding, and Cr GA Sevil.General Manager (Mr P Marshall), Director Engineering Services (Mr L Oldfield), DirectorCorporate Services (Mr P Wearne) and Council’s PA to General Manager and Mayor (Mrs LLantz) were also in attendance.OPENING PRAYERMembers and officers were upstanding for the opening prayer by the Mayor.PROCEEDINGS OF THE MEETING COMMENCED AT 10.05AM.APOLOGIES1/2012 RESOLVED on the motion moved by Councillor Etheridge/Clements that the apologiesfrom Cr Buckman for non-attendance at the meeting due to personal and business commitments beaccepted and that leave of absence for those members be granted.DISCLOSURES OF INTEREST1. Cr Redding declared a non pecuniary interest in Item 10.1.14, being 28 Mooloobar Streetand a pecuniary interest in Item 10.2.3, being NDCAS Request for Financial Assistance;2. Cr Clements declared a non pecuniary interest in Item 10.2.3, being NDCAS Request forFinancial Assistance.PUBLIC FORUMMr Paul Lineham addressed the Public Forum with regard to the Thai Restaurant DevelopmentApplication. Representing the owners of the Restaurant. Has discrepancies with the assessment, inparticular the car parking spaces requirement within the Development Application process whichhas been a large problem for the business owners in the process. Mr Lineham is hopeful that theapplication will be approved today by the Council.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 11 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESPRESENTATIONMr Fabrice Binet, Aeropelican addressed the Councillors with regard to passenger and flightnumbers and the Aeropelican service in Narrabri.MINUTES OF COUNCIL MEETINGS5.1 CONFIRMATION OF MINUTES OF THE ORDINARY MEETING OF NARRABRISHIRE COUNCIL HELD ON TUESDAY, 20 TH DECEMBER 2011.2/2012 RESOLVED on the motion moved by Councillor Lowder/Knox that the Minutes of theOrdinary Meeting of the Narrabri Shire Council held on Tuesday, 20 th December 2011, comprisingMinute No’s 802/2011 to 929/2011 as circularised, be confirmed and signed as a correct record bythe Mayor and General Manager.6 SECTION 355 COMMITTEESNIL REPORT TO THIS MEETING.MOTIONMotion moved by Councillor Clements/Bolton that as a matter of urgent business, the NarrabriShire Council request at the next general meeting the attendance of a representative of the EPA,Whitehaven Coal and Boggabri Coal to explain the water releases both uncontrolled and controlledof water outside the agreed conditions and that the EPA also explain their response to thismonitoring and their regulatory role.CR ETHERIDGE LEFT THE MEETING AT 10.45AM.CR ETHERIDGE RETURNED TO THE MEETING AT 10.46AM.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.3/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that as a matter ofurgent business, the Narrabri Shire Council request at the next general meeting the attendance of arepresentative of the EPA, Whitehaven Coal and Boggabri Coal to explain the water releases bothuncontrolled and controlled of water outside the agreed conditions and that the EPA also explaintheir response to this monitoring and their regulatory role.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 12 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES7 DELEGATES REPORTS7.1 MINERALS AND ENERGY WORKING GROUPWEDNESDAY, 14 TH DECEMBER 2011, GUNNEDAH (LK:EL)4/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that the Council write toNamoi Councils to amend the Liverpool Plains and Gunnedah Basin Minerals and Energy WorkingGroup name to Namoi Councils Minerals and Energy Working Group as originally posted.7.2 NAMOI COUNCILS MEETING 1 DECEMBER 2011 (RAF:EL)5/2012 RESOLVED on the motion moved by Councillor Faber/Kelly that the report on theMeeting of Namoi Councils on 1 December 2011 be received and noted.8 GENERAL MANAGER’S REPORT OFITEMS TO BE CONSIDERED IN THE CLOSED(PUBLIC EXCLUDED) MEETING8.1 ITEMS TO BE CONSIDERED IN THE CLOSED (PUBLIC EXCLUDED)MEETING OF COUNCIL (EL:EL) [GM]6/2012 RESOLVED on the motion moved by Councillor Clements/Bates that the followingmatters be considered in the Closed (Public Excluded) Meeting, the reason being that the mattersand information are:The information that would, if disclosed, prejudice the maintenance of law; andThe commercial information of a confidential nature that would, if disclosed confer acommercial advantage on a competitor of the council.Information that would, if disclosed, confer a commercial advantage on a person withwhom the council is conducting (or proposes to conduct) business.Thus in compliance with Section 10A(2)(e), Section 10A(2)(d)(ii) and Section 10A(2)(c) of theLocal Government Act, 1993 Council is required to deal with this matter in Closed Committeebecause in accordance with Section 10A(2)(e), Section 10A(2)(d)(ii) and Section 10A(2)(c) thematters to be considered are :Sale of Council Owned Land – 9 Hillam AvenueVoluntary Payment AgreementsIPS LogisticsREPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 13 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES9 MAYORAL REPORT9.1 NEWEST FLOOD EVENTS FROM 1 FEBRUARY ON ONGOING (RAF:EL)9.2 MEETING WITH HON KATRINA HODGKINSONTUESDAY 7 TH FEBRUARY REGARDINGNSW RESPONSE TO DRAFT MURRAY DARLING BASIN PLAN (RAF:EL)7/2012 RESOLVED on the motion moved by Councillor Faber/Clements that the Mayoral Reporton the January/February 2012 floods and the NSW Government response to the MDB Plan bereceived and noted.MOTIONMotion moved by Councillor Clements/Redding that Council make known publicly the availablegrants for flood affected small businesses and any non for profit organisations in the Shire and thatthe Council write to the Minister for Western NSW expressing disappointment that a RecoveryCommittee has not been established in the Narrabri Shire.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.8/2012 RESOLVED on the motion moved by Cr Clements/Redding that Council make knownpublicly the available grants for flood affected small businesses and any non for profitorganisations in the Shire and that the Council write to the Minister for Western NSW expressingdisappointment that a Recovery Committee has not been established in the Narrabri Shire.9/2012 RESOLVED on the motion moved by Councillor Faber/Redding that Council staff preparea response to the Draft Plan for consideration by Council at the March 2012 Council Meeting.10 OFFICER’S REPORTSCR KNOX LEFT THE MEETING AT 11.26AM.CR KNOX RETURNED TO THE MEETING AT 11.28AM.MOTIONMotion moved by Councillor Clements/Bates that the Council write to the chair of RDANIobjecting that the Narrabri Airport Project was not referred to the next stage for funding in Round 2and asking why there is no member from the Western area on the board.ON BEING PUT THE MEETING THE MOTION WAS DECLARED CARRIED.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 14 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10/2012 RESOLVED on the motion moved by Councillor Clements/Bates that the Council writeto the chair of RDANI objecting that the Narrabri Airport Project was not referred to the next stagefor funding in Round 2 and asking why there is no member from the Western area on the board.10.1.1 GENERAL MANAGER’S REPORTSubject:Resolution Register11/2012 RESOLVED on the motion moved by Councillor Knox/Etheridge that the Councilendorse and receive the Resolution Register for February 2012 and that the completed itemsmarked ‘yellow’ be approved for deletion from the Resolution Register.10.1.2 GENERAL MANAGER’S REPORTSubject:NSW 2021 – A Plan to make NSW Number One12/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that the GeneralManager prepare a plan on the NSW 2021 – A Plan to make NSW Number One be received andthat the Council identify local and regional issues to be put forward to the DPC Regional Coordinators.10.1.3 GENERAL MANAGER’S REPORTSubject: Destination 2036Release of the Draft Destination 2036 Action Plan13/2012 RESOLVED on the motion moved by Councillor / that the Council consider the DraftDestination 2036 Action Plan and provide comment to the General Manager by the 7 th February2012 to meet the deadline for submissions by the 15 th February 2012.CR KELLY LEFT THE MEETING AT 11.47AM.CR CLEMENTS LEFT THE MEETING AT 11.50AM.CR KELLY RETURNED TO THE MEETING AT 11.50AM.CR CLEMENTS RETURNED TO THE MEETING AT 11.56AM.14/2012 RESOLVED on the motion moved by Councillor Knox/Etheridge that Narrabri ShireCouncil (NSC) as detailed in Points 1 to 5 be forwarded to the Destination 2036 ImplementationSteering Committee (ISC):1. What do you like about the Draft Action Plan?NSC supports all activities outlined in the Action Plan and will participate with coordinatingagencies to contribute to these actions. (FUNDED STRATEGIES)The following feedback is provided on the Key Activities:REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 15 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES1a) NSC is a member of Namoi Councils and looks forward to 2036 utilising thecombined knowledge and expertise of the ROC.2a) NSC and Randwick Council have a sister city relationship for sharing of resources.Formal relationship with Walgett Shire to provide Ranger services.2b) NSC is willing to work with the co-ordinating agency to develop a program forpartnering and mentoring between Councils.2c) NSC is keen to develop flexible and responsive workforce through utilisation ofwork teams to increase flexibility in working arrangements.2. In what ways could the Action Plan be improved?Frequency and responsibility for providing progress reports on activities.Key Activities 10a and 14b, Local and Regional plans must be developed with due regardto the Community Strategic Plans.3. Are there any other key activities you believe should be included under any initiatives?Nil.4. Do you have any suggestions regarding the proposed process for advancing the ActionPlan?NSC is committed to working with the co-ordinating agencies where appropriate.5. Are you aware of any activities (eg. research) currently underway that could directlycontribute to the achievement of any of the initiatives or Key Activities?NSC is not aware of any further activities.10.1.4 GENERAL MANAGER’S REPORTSubject:“B” Division MeetingCR CLEMENTS LEFT THE MEETING AT 12.09PM.CR CLEMENTS RETURNED TO THE MEETING AT 21.10PM.15/2012 RESOLVED on the motion moved by Councillor / that the Council authorise the Mayorand General Manager to attend the 2012 “B” Division Meeting in Inverell and develop motions onissues facing Narrabri and Local Government within NSW to be presented to the meeting,including any motions put forward by Councillors, as follows:REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 16 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESMOTIONMotion moved by Councillor Bolton/Clements that the Minister for Local Government giveconsideration to amending the Local Government Act to allow formal meetings of Council to takeplace where Councillors cannot attend in disaster declared Shires to be conducted using suitableelectronic media.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.16/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that the Minister forLocal Government give consideration to amending the Local Government Act to allow formalmeetings of Council to take place where Councillors cannot attend in disaster declared Shires to beconducted using suitable electronic media.MOTIONMotion moved by Councillor O’Regan/Clements that we move at the “B” Division conference thatthe Shires Association call an emergency meeting when the Draft EP & A Act is finalised and thatall Council’s have at least a three month scrutiny period before it is presented to the State Governorfor approval.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.17/2012 RESOLVED on the motion moved by Councillor O’Regan/Clements that we move at the“B” Division conference that the Shires Association call an emergency meeting when the Draft EP& A Act is finalised and that all Council’s have at least a three month scrutiny period before it ispresented to the State Governor for approval.18/2012 RESOLVED on the motion moved by Councillor Sevil/Clements that Council nominatethe following Councillors to attend the 2012 “B” Division Meeting in Inverell along with theMayor and General Manager:Cr SevilCr O’ReganCr ClementsAnd that Council delegates offer to host the 2013 B Division meeting in Narrabri.CR BOLTON DECLARED A NON PECUNIARY INTEREST IN ITEM 10.1.5.19/2012 RESOLVED on the motion moved by Councillor Sevil/Clements that Council defer item10.1.5 until after lunch.10.1.6 GENERAL MANAGER’S REPORTSubject:Constitutional Recognition of Local Government – contribution offunds20/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that the Councilallocate funds in the 2012/13 budget to cover the special levy for the ALGA National AdvertisingCampaign.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 17 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESCR O’REGAN REQUESTED THAT HIS VOTE AGAINST THE MOTION BE RECORDED.21/2012 RESOLVED on the motion moved by Councillor Lowder/Sevil that the Thai RestaurantDA report be brought forward for discussion.CR REDDING LEFT THE MEETING AT 12.35PM.10.1.16 GENERAL MANAGER’S REPORTSubject:Development Application 99/2012 – Thai Restaurant22/2012 RESOLVED on the motion moved by Councillor Lowder/Etheridge:1. That Council approve development application 99/ 2012 in accordance with section 80 ofthe Environmental Planning and Assessment Act 1979 subject to conditions ofdevelopment consent.2. That the Council authorise the General Manager to apply conditions of developmentconsent to the notice of determination in accordance with section 80 (1)(a) of theEnvironmental Planning and Assessment Act 1979.CR REDDING RETURNED TO THE MEETING AT 12.36PM.NAME FOR OPPOSEDCr SevilXCr BoltonXCr ClementsXCr BatesXCr KellyXCr EtheridgeXCr LowderXCr KnoxXCr Buckman ABSENTCr O’ReganXCr Redding ABSENT WHENVOTE WAS TAKENCr FaberX23/2012 RESOLVED on the motion moved by Councillor Lowder/Etheridge that standing ordersbe suspended and the meeting adjourn for lunch.THE MEETING ADJOURNED FOR LUNCH AT 12.39PM.24/2012 RESOLVED on the motion moved by Councillor Kelly/Etheridge that standing ordersresume.STANDING ORDERS RESUMED AT 1.22PM.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 18 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.1.5 GENERAL MANAGER’S REPORTSubject:Code of Conduct – Report from Conduct Review CommitteeMOTIONMotion moved by Councillor Lowder/Sevil that Council receive and note the report from the Codeof Conduct Review Committee titled “Report of Code of Conduct Inquiry - Allegations ofMisbehaviour by Councillor Conrad Bolton”.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED LOST.MOTIONMotion moved by Councillor Kelly/Redding that the Council consider the recommended actions bythe Conduct Review Committee in their report dated 8 th January 2012 titled “Report of Code ofConduct Inquiry – Allegations of Misbehaviour by Councillor Conrad Bolton” arising from eventsof 21 st June 2011 and determine what action (if any) it will take.THE MOTION WAS WITHDRAWN.CR KNOX LEFT THE MEETING AT 1.46PM.CR KNOX RETURNED AT 1.46PM.MOTIONMotion moved by Councillor Etheridge/Kelly that the Council consider the recommended actionsby the Conduct Review Committee in their report dated 8 th January 2012 titled “Report of Code ofConduct Inquiry – Allegations of Misbehaviour by Councillor Conrad Bolton” arising from eventsof 21 st June 2011 and determine that Cr Bolton be censured in accordance with Section 440g of theLocal Government Act 1993.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED LOST. (VOTE6/5)MOTIONMotion moved by Councillor Clements/Lowder that Council receive and note the report of theCode of Conduct committee and that the General Manager arrange for Cr Bolton to meet with theappropriate people to run through the Code of Conduct, particularly the dealing with contractors.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.25/2012 RESOLVED on the motion moved by Councillor Clements/Lowder that Council receiveand note the report of the Code of Conduct committee and that the General Manager arrange for CrBolton to meet with the appropriate people to run through the Code of Conduct, particularly thedealing with contractors.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 19 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.1.7 GENERAL MANAGER’S REPORTSubject:Narrabri Shire Council Policy Review26/2012 RESOLVED on the motion moved by Councillor Bolton/Kelly that Council adopt alldraft policies as below and advertise as coming into effect in 14 days in conjunction with the LocalGovernment Act, 1993:Alcohol Free Public Spaces PolicyAsbestos Waste Disposal PolicyBackflow Prevention PolicyBuilding Over Council’s Underground Services PolicyConcrete Footpath Cost Recovery Commercial Premises PolicyControlled Works On A Floodplain PolicyLaundry Stained By Rust In The Town Water Supply PolicyMaintenance Of Nature Strips In Urban Areas PolicyNarrabri Lawn Cemetery – Floral & Other Tributes PolicyOptic Fibre Installation On Council Land PolicyPublic Space Tree PolicyRural Property Access PolicySaleyard Fees – Waiving Passed In Stock FeeSewer Junction Connection PolicyUndetected Water Leak PolicyWater Service Connection PolicyWater Meter PolicyDebt Recovery PolicyFinancial And Medical Hardship PolicyInvestment PolicyPensioner Concession PolicyProperty Addressing PolicyPurchasing PolicyRecords Management PolicyRevenue – Water And Sewer PolicyWater Billing PolicyDomestic Animal PolicyLiquid Trade Waste PolicyEnforcement PolicyTownship Amenity and Public Safety PolicyLocal Approvals PolicyProvision of Rainwater Tanks Storage PolicyWaiving Application fees for Development PolicyNew England North West Film PolicyPayment of Expenses and Provisions of Facilities to CouncillorsPrivacy Management PolicyCode of ConductCode of Meeting PracticeCouncillors Access to Information and Interaction with Council StaffGifts and Benefits PolicyUse of Council Facilities by Elected PoliticiansWee Waa Town Levee Management PolicyREPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 20 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.1.8 GENERAL MANAGER’S REPORTSubject:Issues Paper of the NSW Planning System ReviewTHE ITEM WAS WITHDRAWN AS ITEM BEFORE IT WAS DISCUSSED AS IT IS INRELATION TO 10.1.12.10.1.9 GENERAL MANAGER’S REPORTSubject:2012 LGSA Tourism Conference - Gunnedah27/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that the Council receiveand note the report in relation to the NSW Local Government and Shires Association TourismConference held in Gunnedah between 12th – 14th March 2012 and nominate the followingCouncillors to attend the Conference:Cr KnoxCr ReddingCr O’ReganCr Bates (Day1)10.1.10 GENERAL MANAGER’S REPORTSubject:Capital Replacement Wee Waa Animal Holding FacilityMOTIONMotion moved by Councillor Bolton/Clements that Council locate the Wee Waa AnimalTemporary Holding Facility at the Wee Waa Council Depot.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.28/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that Council locate theWee Waa Animal Temporary Holding Facility at the Wee Waa Council Depot.29/2012 RESOLVED on the motion moved by Councillor Bates/Bolton that under the 2012/2013Management Plan appropriate funds be allocated to the demolition of the existing Wee Waaholding facility at the Wee Waa Sewerage Treatment Plant (STP) including removal of asbestoswaste.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 21 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.1.11 GENERAL MANAGER’S REPORTSubject:Capital Replacement Boggabri Animal Holding Facility30/2012 RESOLVED on the motion moved by Councillor Bates/Lowder that Council endorse theconcept location being Lot 73 in DP 744475 known as 39 Finches Lane Boggabri subject to normalstatutory development consent requirements.CR REDDING LEFT THE MEETING AT 2.34PM.CR REDDING RETURNED TO THE MEETING AT 2.35PM.CR KNOX LEFT THE MEETING AT 2.42PM.CR SEVIL LEFT THE MEETING AT 2.44PM.CR KNOX RETURNED TO THE MEETING AT 2.46PM.CR ETHERIDGE LEFT THE MEETING AT 2.47PM.10.1.12 GENERAL MANAGER’S REPORTSubject:New South Wales Planning System Review31/2012 RESOLVED on the motion moved by Councillor Etheridge/Bates that Council adopt thedraft submission as proposed and forward to the Department of Planning for consideration underthe New South Wales Planning System Review.MOTIONMotion moved by Councillor O’Regan/Bolton that Council write to the Department seeking at leasta three month scrutiny period in which to make comment before it is presented to the StateGovernor for approval.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.32/2012 RESOLVED on the motion moved by Councillor O’Regan/Bolton that Council write tothe Department seeking at least a three month scrutiny period in which to make comment before itis presented to the State Governor for approval.10.1.13 GENERAL MANAGER’S REPORTSubject: Draft Policy (Sex Services and Restricted Premises)Development Control Plan – Formal Adoption33/2012 RESOLVED on the motion moved by Councillor Bates/Lowder:1. That Council formally adopt the Policy (Sex Services and Restricted Premises)Development Control Plan following completion of the statutory advertisement period;2. That Council publically advertise the adoption of the policy in accordance with Clause 21of the Environmental Planning and Assessment Regulation 2000.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 22 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESCR SEVIL RETURNED TO THE MEETING AT 2.49PM.CR REDDING LEFT THE MEETING ROOM WHILE ITEM 10.1.14 WAS DISCUSSED AT2.49PM.10.1.14 GENERAL MANAGER’S REPORTSubject:28 Mooloobar Street Narrabri (Status update)34/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that Council followingreview of the submission from Mr Ryman, issue the final order under section 121B of theEnvironmental Planning and Assessment Act 1979, the demolition of the current main fire affectedbuilding due to amenity and safety issues associated with the structure on Lot 11 DP. 758756, 28Mooloobar Street, Narrabri.CR REDDING RETURNED TO THE MEETING AT 2.49PM.CR ETHERIDGE RETURNED TO THE MEETING AT 2.51PM.CR O’REGAN LEFT THE MEETING AT 2.52PM.10.1.15 GENERAL MANAGER’S REPORTSubject:Swimming Pools Act 1992 Review – Response to Discussion Paper35/2012 RESOLVED on the motion moved by Councillor Lowder/Bolton that the Councilendorse recommendations made as part of the review of the Swimming Pools Act 1992, andapprove the submission to the Division of Local Government, as invited, in response to the Reviewdiscussion paper.CR O’REGAN RETURNED TO THE MEETING AT 2.54PM.10.1.17 GENERAL MANAGER’S REPORTSubject:LEP Amendment – 25, 27 & 29 Barwon Street, and 2 Fitzroy Street,Narrabri36/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that the Councilresolve to forward the Planning Proposal (prepared by Mitchel Hanlon Consulting Pty Ltd inrelation to Lot 1 in Deposited Plan 915444 (29 Barwon Street, Narrabri) Lot 4 in Deposited Plan918950 (2 Fitzroy Street Narrabri) and Lots 1B and 2B in Deposited Plan 338549 (25 and 27Barwon Street Narrabri) to the Minister of Planning in accordance with Section 56 of theEnvironmental Planning and Assessment Act 1979 for a “Gateway Determination”.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 23 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.1.18 GENERAL MANAGER’S REPORTSubject: Development Application 179/2011Extractive Industry (“Killara” - Quarry)Lot 32 in Deposited Plan 757104, “Killara” Rockdale Road, Narrabri.ITEM 10.1.18 WAS WITHDRAWN BY STAFF AND WILL BE BROUGHT BACK TO AFUTURE MEETING.10.1.19 GENERAL MANAGER’S REPORTSubject: Development Application 251/12Demolition of Buildings (Town Hall Garage)Lots A and B in Deposited Plan 160839, 9-11 Doyle Street, Narrabri.MOTION on the motion moved by Councillor Clements/Bolton that Council determinedevelopment application DA 179/2011 in accordance with Section 80(1) of the EnvironmentalPlanning and Assessment Act 1979 by way of Approval – subject to the attached standardConditions of Consent in schedule 1 of this report;AMENDMENTAmendment moved by Councillor Etheridge/Kelly that Council determine development applicationDA 179/2011 in accordance with Section 80(1) of the Environmental Planning and Assessment Act1979 by way of Approval – subject to the attached standard Conditions of Consent in schedule 1 ofthis report with the exception of Condition 18.ON BEING PUT TO THE MEETING THE AMENDMENT WAS DECLARED CARRIEDAND THUS BECAME THE MOTION.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.37/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly that Council determinedevelopment application DA 179/2011 in accordance with Section 80(1) of the EnvironmentalPlanning and Assessment Act 1979 by way of Approval – subject to the attached standardConditions of Consent in schedule 1 of this report with the exception of Condition 18.NAME FOR OPPOSEDCr SevilXCr BoltonXCr ClementsXCr BatesXCr KellyXCr EtheridgeXCr Lowder XCr Knox XCr Buckman ABSENTCr O’ReganXCr ReddingXCr FaberXREPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 24 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESTHE GENERAL MANAGER GAVE CREDIT TO THE PLANNING AND DEVELOPMENTSERVICES MANAGER, MR NICK WILTON FOR HIS EFFORTS10.1.20 GENERAL MANAGER’S REPORTSubject:Human Resources Update38/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge that the Council noteand receive information on activities within the Human Resources section of Council.10.1.21 GENERAL MANAGER’S REPORTSubject:Council Opportunity: Join the campaign for State-wide smoke-freelaws39/2012 RESOLVED on the motion moved by Councillor Bolton/Redding that Council notsupport the Cancer Council NSW current campaign that is calling on the NSW Government tobring in smoke-free legislation covering particular public outdoor areas, including children’splaygrounds and outdoor dining areas.CRS SEVIL, ETHERIDGE AND KNOX REQUESTED THAT THEIR VOTE AGAINST THEMOTION BE RECORDED.10.1.22 GENERAL MANAGER’S REPORTSubject: Bush Bursary Sponsorship 201240/2012 RESOLVED on the motion moved by Councillor Etheridge/Clements that Councilparticipate in the 2012 Bush Bursary Scholarship Scheme.10.1.23 GENERAL MANAGER’ REPORTSubject:Economic Development February Update41/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge that Councilreceive and note the February update from the Economic Development Section.CR BOLTON LEFT THE MEETING AT 3.13PM.CR CLEMENTS LEFT THE MEETING AT 3.15PM.CR CLEMENTS RETURNED TO THE MEETING AT 3.17PM.CR BOLTON RETURNED TO THE MEETING AT 3.18PM.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 25 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.2.1 DIRECTOR CORPORATE SERVICES REPORTSubject:Questions Without Notice Register42/2012 RESOLVED on the motion moved by Councillor O’Regan/Etheridge that the QuestionsWithout Notice Register report be received and noted and that the completed items marked‘yellow’ be approved for deletion from the Register.CR SEVIL LEFT THE MEETING AT 3.21PM.CR SEVIL RETURNED TO THE MEETING AT 3.22PM.CR KNOX LEFT THE MEETING AT 3.27PM.CR KNOX RETURNED TO THE MEETING AT 3.29PM.43/2012 RESOLVED on the motion moved by Councillor Clements/Redding that the meetingadjourn for afternoon tea at 3.35pm.STANDING ORDERS WERE SUSPENDED AT 3.35PM FOR AFTERNOON TEA.44/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox that standing ordersresume.THE MEETING RESUMED AT 3.53PM WITH THE SAME MEMBERS PRESENT.10.2.2 DIRECTOR CORPORATE SERVICES REPORTSubject:Request for Sponsorship – Nosh on the NamoiMOTIONMotion moved by Councillor Etheridge/Bolton that given the considerable contribution Councilalready makes to the event, Council requests that it be recognised as a Major Partner to Nosh on theNamoi.AMENDMENTAmendment moved by Councillor Sevil/ that Council contribute an additional $1000 to Nosh onthe Namoi.THE AMENDMENT LAPSED FOR WANT OF A SECONDER.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.45/2012 RESOLVED on the motion moved by Councillor Etheridge/Bolton that given theconsiderable contribution Council already makes to the event, Council requests that it berecognised as a Major Partner to Nosh on the Namoi.CRS CLEMENTS AND REDDING LEFT THE MEETING WHILE THE FOLLOWING ITEMWAS DISCUSSED AT 4.03PM.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 26 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.2.3 DIRECTOR CORPORATE SERVICES REPORTSubject:Request for Financial Assistance – Narrabri & District CommunityAid Services IncMOTIONMotion moved by Councillor Etheridge/Sevil that Council deem the installation of new airconditioning units at 22 George Street, Wee Waa recently undertaken by the tenants, Narrabri &District Community Aid Services Inc, to be at the tenants’ expense and that Council seek formalconfirmation from the tenant that the units are the property of Council.AMENDMENTAmendment moved by Councillor Bolton/Bates that Council deem the installation of new airconditioning units at 22 George Street, Wee Waa recently undertaken by the tenants, Narrabri &District Community Aid Services Inc, to be at the tenants’ expense.ON BEING PUT TO THE MEETING THE AMENDMENT WAS DECLARED CARRIEDAND THUS BECAME THE MOTION.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.46/2012 RESOLVED on the motion moved by Councillor Bolton/Bates that Council deem theinstallation of new air conditioning units at 22 George Street, Wee Waa recently undertaken by thetenants, Narrabri & District Community Aid Services Inc, to be at the tenants’ expense.CRS CLEMENTS AND REDDING RETURNED TO THE MEETING AT 4.15PM.10.2.4. DIRECTOR CORPORATE SERVICES REPORTSubject:Council Borrowing Strategy47/2012 RESOLVED on the motion moved by Councillor Etheridge/O’Regan that the paying outof Loans 143, 145, 148 and 150 be incorporated into the December Quarterly Budget Review.48/2012 RESOLVED on the motion moved by Councillor Kelly/Bates that the following tworecommendations be discussed later in the February 2012 Ordinary Meeting:“that Council advise the Division of Local Government of its intention to amend itsproposed borrowing schedule for 2011/12 as shown in Table 2 of the report.that Council include the proposed borrowings for 2012/13 as part of the Management Plandeliberations”REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 27 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESCR REDDING LEFT THE MEETING AT 4.27PM.CR REDDING RETURNED TO THE MEETING AT 4.35PM.10.2.5 DIRECTOR CORPORATE SERVICES REPORTSubject:Shannon EstateMOTIONMotion moved by Councillor Bolton/Clements that Council adopt an amended draft contract ofsale, replacing d) “brick veneer” with “new building” and with the exception of i) and k); and therewording of o) “no works that would affect the drainage of the lot and subdivision”.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.49/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that Council adopt anamended draft contract of sale, replacing d) “brick veneer” with “new building” and with theexception of i) and k); and the rewording of o) “no works that would affect the drainage of the lotand subdivision”.CR ETHERIDGE REQUESTED THAT HIS VOTE AGAINST THE MOTION BE RECORDED.50/2012 RESOLVED on the motion moved by Councillor Bolton/ Etheridge that Councilauthorise the Mayor and General Manager to sign and affix Council Seal, if necessary, to alldocuments pertaining to the sale of individual lots within Stage 1 of the Shannon Estate.10.2.6 DIRECTOR CORPORATE SERVICES REPORTSubject:Sustainability Purchasing – Sustainable Choice Program51/2012 RESOLVED on the motion moved by Councillor Lowder/Sevil that the Council becomea member of the Sustainable Choice Program by:Accepting in writing the LGSAs invitation to join the program.Integrating sustainable procurement principles into council’s current purchasingprocesses.CR ETHERIDGE LEFT THE MEETING AT 4.41PM.CR ETHERIDGE RETURNED TO THE MEETING AT 4.42PM.10.2.7 DIRECTOR CORPORATE SERVICES REPORTSubject:Friends of The Crossing Theatre Request for Contribution towardsproduction of ‘April Fool’52/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge that the Councilsupport the Friends of The Crossing Theatre production of April Fool through promotion andadvertising.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 28 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.2.8 DIRECTOR CORPORATE SERVICES REPORTSubject:Investments Monthly Report53/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder that in accordancewith Section 625 of the Local Government Act, 1993 that Council note and receive the monthlyinvestment report as at 31 st December 2011.54/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder that Council notethat Council’s Senior Finance Officer has certified that Council’s investments have been made inaccordance with the Local Government Act 1993, the Local Government Regulations andCouncil’s own investment policy.55/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder that Council notethat Council’s Senior Finance Officer has advised that, following standard accounting procedures,losses on the following CDO’s have been brought to account:ISN: AU300HCAP027 Scarborough $300,156.00ISN: AU300CSRJ039 Torquay $491,863.09ISN: AU300HCAP019 Esperance $45,402.69Total Losses $837,421.7810.2.9 DIRECTOR CORPORATE SERVICES REPORTSubject:Investments Monthly Report56/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox that in accordance withSection 625 of the Local Government Act, 1993 that Council note and receive the monthlyinvestment report as at 31 st January 2012.57/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox that Council note thatCouncil’s Senior Finance Officer has certified that Council’s investments have been made inaccordance with the Local Government Act 1993, the Local Government Regulations andCouncil’s own investment policy.10.2.10 DIRECTOR CORPORATE SERVICES REPORTSubject:Quarterly Financial ReviewTHE DIRECTOR CORPORATE SERVICES WITHDREW ITEM 10.2.10 AND WILL BEDEFERRED UNTIL A FULL REPORT IS PRESENTED TO THE MARCH WORKSHOPMEETING.10.2.11 DIRECTOR CORPORATE SERVICES REPORTSubject: Rural Fire Service Estimates 2012/201358/2012 RESOLVED on the motion moved by Councillor Sevil/Etheridge that Council receiveand note the report on the Rural Fire Service Contribution for the 2012/13 year.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 29 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES59/2012 RESOLVED on the motion moved by Councillor Sevil/ Etheridge that Council authorisethe General Manager to sign the Rural Fire Fighting Fund Estimates for the 2012/13 year.CR CLEMENTS REQUESTED THAT HIS VOTE AGAINST THE MOTION BERECORDED.FORESHADOW MOTIONForeshadow motion moved by Councillor O’Regan/Clements that the General Manager togetherwith the Director Corporate Services seek to meet with Moree and Gwydir Councils to discussfunding for RFS and that this issue be referred to the 2012 B Division Meeting.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.60/2012 RESOLVED on the motion moved by Councillor O’Regan/Clements that the GeneralManager together with the Director Corporate Services seek to meet with Moree and GwydirCouncils to discuss funding for RFS and that this issue be referred to the 2012 B Division Meeting.10.2.12 DIRECTOR CORPORATE SERVICES REPORTSubject:Game Council of NSW –Conservation Friendly Hunting61/2012 RESOLVED on the motion moved by Councillor Sevil/Etheridge that the Council invite arepresentative of the Game Council of NSW to do a presentation at the April Council meeting.10.2.13 DIRECTOR CORPORATE SERVICES REPORTSubject:Proposal to Name/Rename Public Roads62/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder that Council approvethe renaming of SR278 Eurimbla Lane to SR278 Camerons Lane, as well as renaming SR165Panorama Lane to SR165 Wynella Road.63/2012 RESOLVED on the motion moved by Councillor Etheridge/ Lowder that Councilapprove the proposal to assign names to six previously unnamed roads.64/2012 RESOLVED on the motion moved by Councillor Bates/Bolton that the February 2012meeting be extended until 6pm.10.2.14 DIRECTOR CORPORATE SERVICES REPORTSubject: Optus Regional Community Grants 201165/2012 RESOLVED on the motion moved by Councillor Lowder/Redding that Council endorsethe literacy program “Filling the Cracks” which has received funding from the Optus RegionalCommunity Grants for 2011.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 30 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES10.2.15 DIRECTOR CORPORATE SERVICES REPORTSubject:Report on upcoming grant opportunities (under $50,000) for Council.66/2012 RESOLVED on the motion moved by Councillor Clements/Sevil:1. That the Grants Officer Report be received and noted2. That Council endorse applications to be made67/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge that Councilendorse applications to be submitted to the NSW Recreational Fishing Trust and “Saluting TheirService”.10.2.16 DIRECTOR CORPORATE SERVICES REPORTSubject:Development of boating and fishing facilities at Wee Waa Lagoon.68/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox that Council endorsethe Wee Waa Lagoon Boat Ramp project and allocate matching funding of $15,500 in the2012/2013 budget to complete the project.69/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox that Council endorsethe application to be made to the NSW Recreational Fishing Trust, for a fully funded fishingplatform at Wee Waa Lagoon.10.2.17 DIRECTOR CORPORATE SERVICES REPORTSubject:NSW Local Infrastructure Renewal SchemeITEM 10.2.17 WAS WITHDRAWN FOR DISCUSSION AT THE MARCH WORKSHOPMEETING.CR SEVIL RETURNED TO THE MEETING AT 5.14PM.10.2.18 DIRECTOR CORPORATE SERVICES REPORTSubject:Expression of Interest to Host the Australian Local GovernmentWomen’s Association NSW Branch Inc. (ALGWA) 2014 Conference70/2012 RESOLVED on the motion moved by Councillor Sevil/Bolton that the Council rescindresolution 902/2011 which states:“902/2011 RESOLVED on the motion moved by Councillor Bolton/O’Reganthat Council authorise the General Manager to submit an Expression of Interestto host the 2014 ALGWA conference.”10.2.19 DIRECTOR CORPORATE SERVICES REPORTSubject:Queen Elizabeth II Diamond Jubilee Street Naming71/2012 RESOLVED on the motion moved by Councillor Sevil/Knox that the Council adopt anunnamed (major) street in Shannon Estate as Queen Elizabeth II Avenue.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 31 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESMOTIONMotion moved by Councillor Clements/Redding that the Council write to her Majesty QueenElizabeth II advising that Council will be naming a prominent street in honour of her DiamondJubilee and invite Prince Charles to officially open the street during his visit in June 2012.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.72/2012 RESOLVED on the motion moved by Councillor Clements/Redding that the Councilwrite to her Majesty Queen Elizabeth II advising that Council will be naming a prominent street inhonour of her Diamond Jubilee and invite Prince Charles to officially open the street during hisvisit in June 2012.10.3.1 DIRECTOR ENGINEERING SERVICE REPORTSubject:Upgrade of Netball CourtsITEM 10.3.1 WAS DEFERRED UNTIL THE MARCH WORKSHOP MEETING.10.3.2 DIRECTOR ENGINEERING SERVICES REPORTSubject:SR 11 - Harparary Road Upgrade73/2012 RESOLVED on the motion moved by Councillor Clements/Lowder that Council receiveand note the SR 11 – Harparary Road Upgrade report for information supporting the developmentof the 2012-2013 Management Plan.10.3.3 DIRECTOR ENGINEERING SERVICES REPORTSubject:Heavy Vehicle Parking Area – Industrial SubdivisionMOTIONMotion moved by Councillor Bolton/Clements that the Council note the request from the LocalTraffic Facilities Committee for a heavy vehicle parking area within the Industrial Subdivision offYarrie Lake Road and that Council staff investigate opportunities in the area for the establishmentof.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.74/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that the Council notethe request from the Local Traffic Facilities Committee for a heavy vehicle parking area within theIndustrial Subdivision off Yarrie Lake Road and that Council staff investigate opportunities in thearea for the establishment of.10.3.4 DIRECTOR ENGINEERING SERVICES REPORTSubject:Nosh – Request for Suspension of Alcohol Free Area75/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that the Councilsuspend the Alcohol Free Area between the Narrabri Creek and the Crossing Theatre, Narrabri,between the hours of 4:00PM Friday 30 March 2012 to 12:00AM Sunday 1 April 2012 (SaturdayREPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 32 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESmidnight), for the ‘Nosh on the Namoi’ fine food and wine festival. The car park area will remainan Alcohol Free Zone.76/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that the Council waivethe $100 lodgement fee of the ‘Request for Suspension of an Alcohol Free Area’ from ‘Nosh on theNamoi’ due to it being a non-profit event attracting tourism to Narrabri.THE DIRECTOR ENGINEERING SERVICES INTRODUCED COUNCIL’S NEW WATERSERVICES MANAGER, MR JOHN STAMMERS AND WELCOMED HIM TO THECOUNCIL.11 NOTICES OF MOTION11.1 NOTICES OF MOTIONMOTION FOR B DIVISION OF NSW SHIRES ASSOCIATION 2012(BOR:EL)77/2012 RESOLVED on the motion moved by Councillor O’Regan/Bolton that B Division callon the Shires Ass. to circulate support for a public forum in Narrabri within 6 weeks of themeeting to allow time for landowners across NSW who are concerned with the Coal Seam Gasindustry, make brief documented statements, together with brief questions to be submitted to apanel of three including a chairman, at least 7 days before the Forum date to answer concerns ofland owners of, their loss of freehold rights, the methods of coal seam gas extraction and theownership of the gas and of the coal, and that this motion and support be included in the “B”Division’s business paper for distribution.11.2 NOTICES OF MOTIONGENERAL ELECTION – ELECTION OF MAYOR(PE:EL)MOTIONMotion moved by Councillor Etheridge/Lowder that as part of the next Local Government GeneralElections to be held in September 2012, a referendum question be included seeking communitysupport to elect the Mayor by popular vote at subsequent elections.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED LOST.11.3 NOTICES OF MOTIONLETTER OF CONGRATULATIONS – SES VOLUNTEERS (JC:EL)78/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that Narrabri ShireCouncil write to the SES Controllers and congratulate the SES volunteers and other services acrossthe Shire for their efforts helping those in need and protecting property during the flood and aidingin the clean up that follows these events and that this letter be made public.CR BOLTON LEFT THE MEETING AT 5.56PM.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 33 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESCR ETHERIDGE LEFT THE MEETING AT 5.58PM.CR ETHERIDGE RETURNED TO THE MEETING AT 6.00PM11.4 NOTICES OF MOTIONNARRABRI LOCAL DISASTER PLAN (JC:EL)79/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that the Narrabri LocalDisaster Plan be made available to the public and that NSC write to the Peel District EmergencyManagement Committee and request that the Narrabri Local Disaster Plan be reviewedimmediately with significant input from the residents of this shire; additionally, the Council tomake it clear to the public that it will hold a number of public forums with regard to recent floodingevents and issues arising from such.MOTIONMotion moved by Councillor Clements/Kelly that Council write to the Peel District EmergencyManagement Committee requesting that they reassure the Council that the Narrabri Local DisasterPlan will not be finalized until the process detailed in the resolution has been completed and in theinterim and that a new trigger point has been determined for the imminent failure of the Wee Waalevee bank.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.80/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that Council write tothe Peel District Emergency Management Committee requesting that they reassure the Council thatthe Narrabri Local Disaster Plan will not be finalized until the process detailed in the resolution hasbeen completed and in the interim and that a new trigger point has been determined for theimminent failure of the Wee Waa levee bank.CR BOLTON RETURNED TO THE MEETING AT 6.04PM.CR REDDING LEFT THE MEETING AT 6.06PM AND DID NOT RETURN.MOTIONMotion moved by Councillor Clements/Lowder that Council discuss with the Peel districtemergency management committee and the State Government establishment of NarrabriShire Flood Recovery Committee.ON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.81/2012 RESOLVED on the motion moved by Councillor Clements/Lowder that Council discusswith the Peel District Emergency Management Committee and the State Government establishmentof Narrabri Shire Flood Recovery Committee.CR SEVIL LEFT THE MEETING AT 6.08PM AND DID NOT RETURN.CR KNOX LEFT THE MEETING AT 6.08PM.CR KNOX RETURNED TO THE MEETING AT 6.10PM.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 34 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES11.5 NOTICES OF MOTIONWATER DAMAGE FROM FLOOD EVENT - REVIEW OF PLANS (JC:EL)82/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that Narrabri ShireCouncil review the plans prepared by the late Mr Bob Christensen and Mr Jim Purcell in thelight of the Stony Creek, Mulgate Creek, Horsearm Creek and Doctors Creek water that causedso much damage to business and private premises in the recent flood event particularly in theindustrial area. And that we seek public input as part of that review.83/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that the LateProfessor Crawford Munro’s (and Sinclair Knights work) work for the Namoi Valley FloodInvestigation Trust be obtained and reviewed in the light of the Stony Creek, Mulgate Creek,Horsearm Creek and Doctors Creek water that caused so much damage in the recent flood eventparticularly in the industrial area. And that we seek public input as part of that review.11.6 NOTICES OF MOTIONINVESTIGATION OF WATER DIVERSION (BOR:EL)84/2012 RESOLVED on the motion moved by Councillor O’Regan/Bates that a claim from aneighbour that water on Lot 6 Parish of Durrisdeer adjacent to Shire Rd. 11 is being divertedby way of Headwall Banks on both sides of this public road, has resulted in a scouring of thegravel from the point where the Headwall meets our SR 11 to a point some two or threekilometres West and South West respectively, be investigated by Council`s staff.11.7 NOTICES OF MOTIONCOAL SEAM GAS DEVELOPMENT APPLICATIONS (BOR:EL)Motion moved by Councillor / that we call on all private landowners who have allowed miningcompanies to explore for Coal Seam Gas seek a late Development Approval (DA) where, onRural 1A LAND mining has contravened their existing use right to only practice agriculturewithout consent.THE MAYOR RULED THE MOTION OUT OF ORDER.CR CLEMENTS LEFT THE MEETING AT 6.17PM AND DID NOT RETURN.12 CORRESPONDENCE REPORT12.1 CORRESPONDENCE (EL:EL)85/2012 RESOLVED on the motion moved by Councillor Lowder/Kelly that the letters ofappreciation from November2011- February 2012 be received and noted.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 35 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTES13 CLOSED (PUBLIC EXCLUDED)GENERAL MANAGER’S REPORT86/2012 RESOLVED on the motion moved by Councillor Kelly/Bates that at 6.18pm, Councilmove into Closed (Public Excluded) Meeting of Council and that the press and members of thepublic be asked to leave the room whilst Council to considers the following items:Sale of Council Owned Land – 9 Hillam AvenueVoluntary Payment AgreementsIPS Logistics13.1.1 PRIVATE AND CONFIDENTIAL GENERAL MANAGER’S REPORTSubject:Sale of 9 Hillam Avenue Narrabri Report87/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly that Council accept theoffer on 9 Hillam Avenue Narrabri of Albaterra Super Fund.88/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly that Council authorisethe Mayor and General Manager to sign and seal all relevant documentation pertaining to the sale.89/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly that the net proceeds ofthe sale to be placed in Council’s Staff Housing Reserve.13.1.2. PRIVATE AND CONFIDENTIAL GENERAL MANAGER’S REPORTSubject:Voluntary Payment AgreementsITEM 13.1.2 WAS DEFERRED UNTIL THE MARCH 2012 COUNCIL MEETING.13.1.3 PRIVATE AND CONFIDENTIAL GENERAL MANAGER’S REPORTSubject:IPS LogisticsMOTIONMotion moved by Councillor / that the Council accept an ex-gratia payment of $200,000 from IPSto satisfy the requirements of Development Application DA 82/1996 and DA 22/2009 for thebuilding of the road from Yarrie Lake Road to the railway crossing and that the funds be allocatedto the Community Infrastructure Reserve.AMENDMENTAmendment moved by Councillor Kelly/Lowder that the Council accept an ex-gratia payment of50% of the road cost from IPS to satisfy the requirements of Development Application DA 82/1996and DA 22/2009 for the building of the road from Yarrie Lake Road to the railway crossing andthat the funds be allocated to the Community Infrastructure Reserve.ON BEING PUT TO THE MEETING THE AMENDMENT WAS DECLARED CARRIEDAND THUS BECAME THE MOTION.REPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 36 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL FEBRUARY 2012 ORDINARY MINUTESON BEING PUT TO THE MEETING THE MOTION WAS DECLARED CARRIED.90/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that the Council acceptan ex-gratia payment of 50% of the road cost from IPS to satisfy the requirements of DevelopmentApplication DA 82/1996 and DA 22/2009 for the building of the road from Yarrie Lake Road tothe railway crossing and that the funds be allocated to the Community Infrastructure Reserve.91/2012 RESOLVED on the motion moved by Councillor Kelly/Knox that Council move out ofClosed (Public Excluded) Meeting and the Mayor read out the motions resolved in the Closed(Public Excluded) Meeting.THE MAYOR THEN READ OUT THE MOTIONS RESOLVED IN CLOSED COUNCIL.THERE BEING NO FURTHER BUSINESS, THE MEETING CLOSED AT 6.28PM.Cr RA FaberCHAIRREPORT OF THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRI SHIRE COUNCILCHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 ST FEBRUARY 2012.GENERAL MANAGERMAYORPage 37 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL6REPORTS OFCOMMITTEESORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 38 of 555 of the March 2012 Ordinary Business Paper

LOCAL TRAFFIC FACILITIESNARRABRI SHIRE COUNCIL MARCH 2012 COMMITTEE REPORT6 REPORTS OF COMMITTEES6.1 REPORT OF THE LOCAL TRAFFIC FACILITIESCOMMITTEE MEETING OF THE NARRABRI SHIRECOUNCIL HELD IN THE COUNCIL COMMITTEEROOM, 46-48 MAITLAND STREET, NARRABRI, ONTUESDAY, 6 TH MARCH 2012.See Attachment 6.1.a to view the Business Paper and Minutes of the Local Traffic FacilitiesCommittee Meeting.RECOMMENDATIONSNILREPORT OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD IN THENARRABRI SHIRE COMMITTEE ROOM, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 6 TH MARCH 2012.GENERAL MANAGERMAYORPage 39 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 1 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTEMINUTES OF THE NARRABRI LOCAL TRAFFICFACILITIES COMMITTEE MEETING HELD ON TUESDAY 6MARCH 2012.Opening of the Meeting:10.40amPresent: Mr Luke Tanner (Chairman) (LT)Cr Conrade Bolton (Rep. Member for Barwon, Mr. Kevin Humphries MP) (CB)Mr. David Vant (Roads and Maritime Services)(DV)Mr. Mark Lyon (Local Police Representative)(ML)Mr Anthony Smetanin (Design Services Manager – NSC)(AS)Apologies:Cr Ron Lowder (Chairman) (RL) and Mr. Lewis Oldfield (Director of EngineeringServices – NSC)1. Confirmation of Minutes from the November MeetingThe minutes of the meeting of the Narrabri Shire traffic Committee held on 29 November 2011 were confirmedas a true record of the meeting.UnanimousCarried.2. Recommendations from the Narrabri Local Traffic Facilities Committee November 2011MeetingThe Recommendations to Council’s December 2011 Meeting were adopted as recommended.3. Review Actions from the Previous Meetings3a) Truck Rest Area required between Wee Waa and Narrabri AND between Wee Waa andBurren Junction (item raised by Luke Tanner)AS informed the committee has placed traffic counters out. The data that was collectedindicate that 1030 vehicles travelled over the road, 21.7% being heavy vehicles.DV mentioned that the funding for the rest areas need to be approved from people higher inthe RTA.ACTION (LO and AS) 2/8/11: Dot points to be prepared and brought back to Committee toreview and consider. Traffic counters to be placed on Boolcarrol Road to supportrecommendation for a rest area west of Wee Waa.UPDATE (LO) 6/9/2011: LO informed Committee that AS has advised that traffic counterswere installed two weeks ago so therefore a report of the date will be made available for thenext Committee Meeting.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR1 of 9 March 2012 Ordinary Business PaperPage 40 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 2 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTEUPDATE (AS) 4/10/2011: AS confirmed that counters has been installed near the bridge butat this stage no substantial results to date. AS suggested that counters remain there until afterthe harvest season to get accurate results.ACTION (AS) 4/10/2011: AS to prepare an initial letter to the RTA indicating trafficcounters are in place and a further report will be provided after the harvest season confirmingthe Committee’s argument for a Truck Rest Area to be allocated.UPDATE (AS) 2/11/2011: AS confirmed that a letter has been sent to the RTA and trafficcounters have been in place for approximately one (1) month. The counters have recorded anADT reading of 1100 vehicles per day with 20.5% of those vehicles being heavy vehicles.Committee agreed for this agenda item to remain with AS to report further every month withtraffic counter results and a decision to be made following the completion of harvest.UPDATE (AS) 29/11/2011: AS informed Committee that he didn’t have the opportunity tocheck traffic counters due to weather conditions so therefore he will bring current results tothe next Traffic Committee Meeting.UPDATE (AS) 6/3/2012: The data that was collected indicate that 1030 vehicles travelledover the road, 21.7% being heavy vehicles.3b) Fire & Rescue NSW request for additional four (4) car parks at their Headquarters in DoyleStreet, Narrabri (item raised by Luke Tanner)AS explained that the additional car parks have been completed.ACTION 2/8/2011: Committee agreed that no further discussion would occur until such timethat the request is received from Shane Bradford in writing.UPDATE (LO) 6/9/2011: LO confirmed to Committee that no further communication hasbeen received from Mr Bradford and therefore sought Committee’s permission to remove thisagenda item with no further action required. Committee agreed.CompletedUPDATE (LO) 26/09/2011: Email from Shane Bradford dated 6 July 2011 requestingadditional car parks (copy attached to Agenda.)UPDATE (AS) 4/10/2011: AS provided to each Committee member a copy of a further emailfrom Shane Bradford dated 28 September 2011 in regards to the matter.ML was of the understanding that car parks have previously been allocated in the Council carpark for Fire and Rescue. AS could not recall that being the case as he was of theunderstanding that parks in the car park were not allowed due to pedestrian risk. ML raised theissue that currently there is approximately only three (3) car parks in that block (Doyle Streetbetween Maitland and Barwan Street) for residents to go to Post Office so therefore it wouldbe a more practical decision to allocate four adjacent parks in the car park area.CB suggested that AS prepare a report to Council with different scenarios and get Council’sendorsement then advise Fire and Rescue. DV suggested that in the meantime a reply emailcould be forwarded to Shane Bradford indicating that no further parks will be allocated on theMINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR2 of 9 March 2012 Ordinary Business PaperPage 41 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 3 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTEstreet however, a report is being prepared for Council with different options and theCommittee/Council will report further in due course.ACTION (LO) 4/10/2011: Reply email to Shane Bradford as per paragraph above.UPDATE (LO) 2/11/2011: LO confirmed that Shane Bradford was informed that should herequire a copy of the minutes from last month’s meeting he needs to make application to thePublic Officer and as far as LO is aware Shane Bradford has done this.ML brought to the Committee’s attention that in the car park there is specific car parkspreviously been marked for Fire & Rescue NSW.ACTION (AS) 2/11/2011: AS to look at the car park and search for a previous Council reportin regards to the matter. AS to prepare a new report for the next Committee meeting.UPDATE (AS) 22/11/2011: Report attached as per action raised at previous meeting (2November 2011).The purpose of this report is to present to Council a request from the Narrabri Fire & RescueStation Commander, seeking Council approval to permanently reserve an additional four (4)on-street parking bays, for the purpose of parking Narrabri Fire & Rescue personnel vehicles.Current parking arrangements.Current and future needs of various road users.See Report TC-AUPDATE (AS) 29/11/2011: AS informed Committee that he thoroughly reviewed the issueand obtained a lot of history in regards to the request. Following his assessment AS couldn’tjustify approving the request for additional parking.ML enquired if the car parks had been removed from the actual car park. AS informed following hisinspection of the car park yes it appears they have been removed as there are only faded marks on theground. RL suggested that perhaps as a Committee we could deny their request but as an alternativeoffer four car parks in the car park itself. AS suggested if recommendation is approved by Councilthen a letter could be sent in the future detailing the alternative suggestion. LO suggested as aCommittee we do not approve the request however, leave it up to Council to consider approving carparks to be allocated in the car park itself.RECOMMENDATION:That the Local Traffic Facilitates Committee recommend that the Council deny the request todedicate the remaining four (4) unrestricted on-street parking bays to the Narrabri Fire &Rescue Station on Doyle Street, between the Narrabri Fire & Rescue Station and BarwanStreet, for Fire Fighters use only, based upon current public usage.UnanimousCarried.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR3 of 9 March 2012 Ordinary Business PaperPage 42 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 4 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTEUPDATE (AS) 6/3/2012: AS confirmed that to Committee that recommendations ofDecember Meeting was adopted by Council. Committee agreed that the matter has beenresolved and agenda item can be removed from future agendas.Completed3c) Parking Complaints Mooloobar Street – email from Senior Constable Hinshelwood dated1 September 2011.ML confirmed to Committee that this complaint has come from Senior ConstableHinshelwood who resides in the Police residence next to the basketball courts. The complaintis in regards to heavy vehicles parking along Mooloobar Street overnight waiting to enterCargill first thing the next morning. The other complaint was in regards to a driver parking infront of the monument however, Police have spoken to that particular driver.AS suggested that a warning type letter could be forwarded to Cargill detailing the complaintreceived. DV suggested that the situation could be monitored and the legislation should bereviewed. CB suggested that a heavy vehicle parking area could be included in the new YarrieLake subdivision.ACTION (AS) 4/10/2011: AS to prepare a suggestive report for Council in regards to theinclusion of a heavy vehicle area in the Yarrie Lake subdivision.UPDATE (AS) 2/11/2011: AS informed Committee that he is yet to prepare Council report asdiscussed at previous meeting as he is waiting on finalisation of the Yarrie Lake Subdivision.Committee agreed agenda item on hold pending finalisation/review of the Yarrie LakeSubdivision.UPDATE (AS) 29/11/2011: AS informed Committee that as subdivision has now beenapproved by Council he will proceed to prepare a report to Council as discussed at previousmeetings.UPDATE (AS) 6/3/2011: Yarrie lake Subdivision Res.74/2012. Number of heavy vehiclestravelling this road will be assessed during harvest time, and that a report will be presented toa future Committee meeting. LT informed the committee that the trucks are damaging the kerband guttering in Mooloobar Street. Customer Service requests have been raised for the issue.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR4 of 9 March 2012 Ordinary Business PaperPage 43 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 5 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTE3d) Boggabri CBD – Pedestrian Crossing – Report AttachedThe purpose of this report is to present to Council, the findings of an investigation into theinstallation of a proposed pedestrian (zebra) crossing within the middle of the Boggabri CBD.Current vehicle and pedestrian traffic movements.Compliance with RTA specifications.See Report TC-CUPDATE (LO) 2/11/2011: LO informed Committee that this request was received by theMayor from a resident of Boggabri.AS informed Committee that the request doesn’t meet criteria as there is ample time to crossthe street. AS has been to Boggabri himself whereby he watched a resident cross the streetwith a young child who dropped something in the middle of the street and the adult had timeto stop pick the toy up and continue to cross the street very safely. AS enquired of DV doesCouncil have delegation to install pedestrian crossings. DV informed that it has to meetwarrant and traffic committee can install the crossing. AS believes that it is a similar situationas it is in Narrabri as it is a raised area the public assume it is a pedestrian crossing. MLenquired is there enough room for an island in the middle of the road? DV suggested that arefuge island could be installed with supplements and blisters.LO and other committee members agreed that it doesn’t warrant the installation of apedestrian crossing. AS suggested that as a Committee review of the current crossing layoutscould be completed with different options to be considered.ACTION (AS) 2/11/2011: AS to prepare a report for the next Committee meeting withdifferent options for consideration.UPDATE (AS) 29/11/2011: AS informed Committee that report is yet to be prepared. LOinformed Committee that at the last Council meeting it was resolved that a letter be sent toRTA requesting their requirements in regards to the installation of a pedestrian crossing and todate a reply is yet to be received. AS to hold off on preparing his report until such time a replyis received and that reply will be attached to the report.UPDATE (AS) 6/3/2012: AS reported that Council is still awaiting a letter from the RTAregarding this issue. DV explained to the committee that speed zones (top 100 list) has beenthe priority with the RTA over the last few months and that the requested letter will be sent toCouncil at a later date.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR5 of 9 March 2012 Ordinary Business PaperPage 44 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 6 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTE3e) Safety improvements to Therribri and Leard Forest Road intersections with Boggabri Coalprivate haul road (item raised by Geoff Sharrock, General Manager, Boggabri Coal PtyLimited to Lewis Oldfield)Committee reviewed email and plans supplied with Agenda from Geoff Sharrock toLewis Oldfield dated 19 August 2011.DV informed Committee that matter will need to be referred to RTA however, in principal hedoesn’t have a problem with it. DV raised the issue of who would be responsible for themaintenance and monitoring of the mobile sign boards.RECOMMENDATION:1. The Local Traffic Facilities Committee in principal endorses the plans attached to an emailfrom Geoff Sharrock to Lewis Oldfield dated 19 August 2011. With such plans being drawnby Idemitsu Boggabri Coal, TN – 19 August 2011.2. The Local Traffic Facilities Committee advises Council that the proposal will need to bereferred to the RTA for assessment.Moved: D. Vant Seconded: M Lyon Carried.UPDATE (DV) 4/10/2011: DV informed Committee that as far as he was aware the RTA wasyet to hear from Council in regards to the matter.ACTION (LO) 4/10/2011: Chase up LO in regards to current status of agenda item and reportto next Committee Meeting.UPDATE (LO) 2/11/2011: LO confirmed to Committee that recommendation of OctoberCommittee Meeting was adopted by Council. Committee agreed that the matter has beencompleted and agenda item can be removed from future agendas.CompletedUPDATE (LO) 25/11/2011: Email from Ben Rossiter, Constructive Solutions dated 25November 2011 with attached drawing detailing the existing and revised signagearrangements.UPDATE (LO) 29/11/2011: LO informed Committee that RTA didn’t approve lights so ifCommittee could review revised plan and if happy sign off revised plan as replacement. ASqueried the use of rubble strips on one side only. DV informed that he has been in consultationand that rubble strips are to be installed on both approaches with trucks to be fitted with GPSmonitors.RECOMMENDATION:The Local Traffic Facilities Committee in principal endorses the plans attached to an emailfrom Ben Rossiter, Constructive Solutions dated 25 November 2011 with rubble strips to beinstalled in both directions. With such plans being drawn by CF of Constructive Solutionswith plans dated 25 October 2011 (job code CSPL-20111).UnanimousCarried.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR6 of 9 March 2012 Ordinary Business PaperPage 45 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 7 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTEUPDATE (AS) 6/3/2012: AS confirmed that to Committee that recommendations ofDecember Meeting was adopted by Council. Committee agreed that the matter has beenresolved and agenda item can be removed from future agendas.Completed3f) Load Limit – Wee Waa Streets – Report AttachedThe purpose of this report is to present to Council a request to implement a 10 tonne LoadLimit on Albion Street, Louis Street and part Mitchell Street, Wee Waa.Safety concern from residents.Road suitability for heavy vehicles.See Report TC-BUPDATE (AS) 29/11/2011: AS informed Committee he received a phone call and an emailfrom a local resident voicing their concern as the local Police can not issue any infringementsdue to no signage. AS reviewed the current situation and recommends the installation ofsignage as per recommendation referred to in report. AS suggested that upon installation ofthe signage the matter could be monitored for a period of twelve (12) months.RECOMMENDATION:That the Council approve the implementation of a ten (10) tonne load limit for;Louis Street, Wee Waa – from Boolcarrol Road to Mitchell StreetAlbion Street, Wee Waa – from Boolcarrol Road to endMitchell Street, Wee Waa – from Warrior Street to Louis Street…and make the following sign changes;Install one (1) iconic ‘No Trucks’ and ‘Over 10t Tare’ sign at the corner of LouisStreet and Boolcarrol Road, Wee Waa (900mm x 1450mm)Install one (1) iconic ‘No Trucks’ and ‘Over 10t Tare’ sign at the corner of AlbionStreet and Boolcarrol Road, Wee Waa (900mm x 1450mm)Install one (1) iconic ‘No Trucks’ and ‘Over 10t Tare’ sign at the corner of WarriorStreet and Mitchell Street, Wee Waa (900mm x 1450mm)UnanimousCarried.RL raised the issue (on behalf of Wolters Coaches previously Lowders Buses) of the 10t loadlimit on the Lagoon Bridge. RL was of the understanding that school buses were exemptprovided it is on a bus route. AS confirmed that he has a standard letter that he can send toWolters Coaches confirming the exemption of school buses. DV confirmed that under the roadrules buses are not heavy vehicles.ACTION (AS) 29/11/2011: letter to Wolters Coaches.MINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR7 of 9 March 2012 Ordinary Business PaperPage 46 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 8 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTELT informed the committee that Customer Service Requests have been lodged andprogrammed to be completed.3g) Barwan Street RoundaboutML raised the issue of over dimensional loads wrong siding the Barwan Street roundabout.ML queried AS if he received any phone calls in regards to over dimensional loads comingthrough town. AS can recall that the last call he received was approximately six (6) to seven(7) months ago and he advised them to remain on the highway. ML wondered if theroundabout could perhaps be revisited as tyres are blowing on the concrete lip. DV informedCommittee that as far as he is aware this is the first time he has heard about the issue. LOenquired if there are issues in regards to the pavement itself. DV confirmed that theroundabout was designed to mount however, he will make enquiries and report to the nextTraffic Committee meeting.RECOMMENDATION:The Local Traffic Facilities Committee in principal endorses the plans attached to an emailfrom Ben Rossiter, Constructive Solutions dated 25 November 2011 with rubble strips to beinstalled in both directions. With such plans being drawn by CF of Constructive Solutionswith plans dated 25 October 2011 (job code CSPL-20111).UnanimousCarried.DV stated that there is an enforcement issue. ML expressed that an application must be madeprior to driving on the wrong side of the roundabout as a police escort is required.4. Referrals to the CommitteeGlencoe ChannelCB raised the issue of Glencoe Channel when flooding occurs. CB stated that a complaintcame from Councilor Clements explaining that people cannot gain access to the Channel asthe road is closed with 250mm of water over it. LT declared that there are no protocols on theShire contract, and that managers administer guidelines to when the road is shut. ML statedthat Council cannot just pick a height that we close the road at. LT explained that the road isclosed after flooding to repair before access granted again, this is to prevent further damage.CB mentioned that Walgett Council has Council workers escorting people over damagedroads which continued the flow of traffic, as there are no strict guidelines Council could dothis. However it is damaging the road underneath. LT stated that a Contact Manager, RMCCon behalf of the RTA can close the road regardless of Council. CB and LT agreed that closingthe road works well.ACTION (LT) 6/3/2012 LT will investigate into long tern effects.5. General BusinessMINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR8 of 9 March 2012 Ordinary Business PaperPage 47 of 555 of the March 2012 Ordinary Business Paper

Attachment 6.1.a- 9 -NARRABRI SHIRE COUNCIL MARCH 2012 LOCAL TRAFFIC FACILITIES COMMITTERose Street Heavy Vehicle Issue – DV suggested that road warning signs and flagging of thearea could be useful or road blisters be used as a last resort as they are effective. AS stated thattraffic counters can be put in place.CB asked if there could be load limits painted onto the road as lots of trucks travel this road.AS commented that advanced warning signs could be put in place. DV stated that there is noprovision under roads to undertake this.ACTION (AS) 6/3/2012: To put traffic counters down at 50km zones at Wee Waa.Wee Waa Museum Parking- CB states that there have been a couple of near misses comingout of the museum driveway as trucks park right to the gate line. CB suggested that we markthe area with paint to ensure that trucks do not park to the gate way. DV recommended a stopsign be put in the area. LT also raised the issue that there is a resident truck that park on thefootpath in Rose Street. CB stated that it is a site issue. However DL stated that there is nooffence make with the trucks parking at the museum unless they are double parking. LTexpressed that they are double parking in the area. AS raised the issue that there may be issuesraised from the Caltex due to them losing business.ACTION (AS) 6/3/2012: To put traffic counters down at 50km zones at Wee Waa and draft aconcept plan indicating No Stopping Zones.Wee Waa School Zone Issue – Email from Vivian Smith at 174 Rose Street Wee Waa- DLhanded around an email from Mrs. Smith regarding trucks blocking driveways, trucksspeeding while approaching Wee Waa.ACTION (LT) 6/3/2012: To refer to Committee. Not for forum Road Services Managerinvestigating protocols to be applied.6. Next MeetingTuesday, 3 April 2012Meeting Closed:4.15pmMINUTES OF THE LOCAL TRAFFIC FACILITIES COMMITTEE MEETING OF COUNCIL THAT WAS HELD ON TUESDAY6 MARCH 2012.GENERAL MANAGERReports of CommitteesNarrabri Local Traffic Facilities CommitteeMAYOR9 of 9 March 2012 Ordinary Business PaperPage 48 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL7SECTION 355COMMITTEESORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 49 of 555 of the March 2012 Ordinary Business Paper

7 SECTION 355 COMMITTEES7.1 FRIENDS OF THE CROSSING THEATRE COMMITTEE (EL:EL) [GM]The Committee minutes for the Friends of the Friends of The Crossing Theatre Committee meetingdated Wednesday, 16 th November 2011 are Attachment 7.1.a.RECOMMENDATION: That Council receive and note the report of the Friends of TheCrossing Theatre Committee Meeting held on Wednesday, 16 th November 2011.The Friends of The Crossing Theatre Committee made the following specific recommendations forCouncil to consider:Nil.Page 50 of 555 of the March 2012 Ordinary Business Paper

Attachment 7.1.aFriends of the Crossing TheatreMeeting Weds 16 th November 2011 @ Crossing Theatrehttp://friendsofthecrossingtheatre.comMeeting Opened 7:00pmChair Colin TannPresent: Colin Tann, Jessica Stokes, Sharon Downes, Sue Hanrahan, RobynConstable, Paul Shelley, Barbara Murphy, Anna Thomson, Allan Goode, Julie Goode,Sandy Tapscott, Paul TeschnerApologies: Jenny Tucker, Marg Gleeson, Ross Gleeson, Trish Hadley, Judy JannsonMinutes from Previous MeetingJessica Stokes moved that minutes from the meeting were a true and accurate record,seconded Sue Hanrahan…...………………….……………….……………………..CarriedCorrespondence In Let the Sunshine discount email NSC invoice Film and Sound Inv $9.90 Film and Sound receipt The Courier Inv and statement Membership form Hit Productions promo materials Bugalugs Bum Thief school activities Boggabri Coal logo and cheque World Theatre Festival 2012 email 2x letter of receipt of grant applications Inv Moree Broadcasting $495.00 Fall of the Roman Umpire Statement Film & Sound $9.90 Narrabri Shire Community Radio statement $93.50 Narrabri HS Invitation Colin Tann Presentation night Amalgamated Movies Tax Inv Memberships Fall of the Roman Umpire Box Office Report Roadshow Films tax invCorrespondence Out Minutes Xmas inviteJessica Stokes moved the correspondence be accepted, seconded Sandy Tapscott………………………………………………………………………………….carriedSection 355 CommitteesFriends of The Crossing Theatre1 of 3 March 2012 Ordinary Business PaperPage 51 of 555 of the March 2012 Ordinary Business Paper

Attachment 7.1.aTreasurers Report Robyn ConstableTreasurer’s report November 2011Bank balance at 1/10/11 $ 7,862.05Income $ Expenditure $Box Office2049.00 Amalgamated Movies (Exit through) 121.00Chronic Ills of RZFriends Flicks 334.50 The Courier 334.40Membership 55.00 National Film and Sound Archive (A9.90day @ the races)Boggabri Coal 1000.00 1 st Payment Critical Stages 1210.00Moree Broadcasting 495.003438.50 2170.30Closing balance on 31/10/11 $9130.25Accounts for payment $Roadshow Films (A Streetcar Named Desire) 55.00Amalgamated Films (Animal Kingdom) 121.00Roadshow Films (An Education) 66.00Moree Broadcasting 325.60The Courier 250.80Film and Sound Archive (Dial M for Murder) 9.90Narrabri High School (letter sent but not received) 100.00Robyn Constable moved that her report be accepted and all accounts be paid, secondedSandy Tapscott…………………………………………………………………………carriedFriend’s Flicks Report - Sharon DownesFLICKERFEST has been confirmed for 11 February 2012 at the Crossing Theatre.Performing Arts – Sue HanrahanSeveral grants have been applied for. WE have received $1000 of Boggabri Coal and$1000 of Community Health Mental Heath team .Event Service – Barb MurphySince the last meeting the friends have assisted with the: Susie Q concert on 16 th Oct a great night was had by all. The fall of the Roman Umpire on the 21 st Oct. a small crowd but enjoyed bythose in attendance. And the Roger Woodward concert on the 7 th Nov there were a few seatingissues with the change of layout and lack of seat numbers and aisle markers.But we sorted things out and most people were understanding and patience,and were then rewarded by a truly wonderful performance by Roger.Action Discuss ongoing seating/ticketing issues with new manager Peter.Section 355 CommitteesFriends of The Crossing Theatre2 of 3 March 2012 Ordinary Business PaperPage 52 of 555 of the March 2012 Ordinary Business Paper

Attachment 7.1.aTrish and my self would like to say a very big thank you to all the volunteers who helpedus through out the year. We appreciate your help whether you came to one function orten. And hopefully we will get a few new helps next year to relieve the pressure on someof the regular volunteers.Also a big thank you to Paul Shelley for his attendance at our meetings and hiswillingness to take on board our suggestions and he also did a great job as the go toman in a sometimes stressful change over period.We thank him and all the staff who keep our wonderful theatre operating and hopefulnext year will bring many new and exiting adventures for all of us as we aim to giveNarrabri the entertainment venue they desire and deserveMerry Xmas and safe holidays to all.PS we will be needing Ushers for the Wolf mother Concert on the 10 th Dec. If you canhelp please contact Barb or Trish ThanksMeeting Closed 7:45pm - XMAS party and a preview of the coming year by SueHanrahanMERRY CHRISTMAS ONE AND ALL!Next Meeting 7pm 8th February 2011Friends of the Crossing Theatre 2012Wednesday 8 FEBRUARY 1 ST Meeting of the YearSaturday 11 FEBRUARY 2012 FLICKERFESTMonday 7 MAY 2012 April’s FoolWednesday 6 JUNE 2012 Let The SunshineWednesday 13 JUNE 2012 Bugalugs Bum ThiefFriday 31 AUGUST Ladies’ NightAlternative Film 1 st Thursday of the Month;Classic Film 3 rd Monday of the month matineeSection 355 CommitteesFriends of The Crossing Theatre3 of 3 March 2012 Ordinary Business PaperPage 53 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL8DELEGATES REPORTSORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 54 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 DELEGATES REPORTS8 DELEGATES REPORTS8.1 WEE WAA LHACC MEETING (RL:EL)RECOMMENDATION: That the Council receive and note Cr Lowder’s DelegatesReport on the Wee Waa LHACC Meeting.Please find following minutes from the Wee Waa LHACC meeting of 16 thAttachment 8.1.a.February 2012 atThe COAG initiative for better access to primary care services in rural areas is being trialled inWarialda and will then roll out to Wee Waa. We are still struggling to attract a second doctorwhich is a matter of continuing concern.Cr Ron LowderDELEGATEDELEGATES REPORTS PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THENARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH 2012.GENERAL MANAGERMAYORPage 55 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.1.aWee Waa Local Health Advisory Committee MeetingHealthHunter New EnglandLocal Health DistrictDate 16 February, 2012Time 1pmVenue Wee Waa Community Health Conference RoomCirculation ListMaxine BoobyPam CallachorRon LowderAnne WeeksDavid QuirkRobyn AllenMargaret Constablelf you are unable to attend the meeting please ensure that your apology is recorded bycontactingMargaret Constable 67950400or Marqaret. Constable@ hnehealth. nsw. qov. auAGENDA1. Present and Apoloqies Chairman2. Declaration of Gonflicts of Interest and Gonfidential ltems Chairman3. Gonfirmation of Previous MinutesThe Minutes of the meeting held on 11 October,2011 are attached.Chairman4.5. Presentations6. General Business6.1 Recruitment for GP6.2 Service delivery during flood7. Standinq ltems8. Other Business9. For lnformation10. ChairmanDelegates ReportsWee Waa LHACC Meeting1 of 6 March 2012 Ordinary Business PaperPage 56 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.1.aMinutes of Wee Waa Local Heatth Advisory Committee MeetingHealthHunter New EnglandLocal Health DistrictDATE:VENUE:PRESENT:APOLOGIES:IN ATTENDANGE:11 October,2017WeeWaa Community Health Conference RoomMaxine Booby (Chair), Pam Catlachor, Anne Weeks, Robyn Allen, Ron Lowder, Margaret ConstableDavid QuirkDr S SivanathanDelegates ReportsWee Waa LHACC Meeting2 of 6 March 2012 Ordinary Business PaperPage 57 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.1.afrom a medical officer in anothertown3.2lnformation to be sought on thefuture of LHAC membership andany changes to Committee terms ofreference4. Presentations4.1 Better Access to PrimaryCare Services in Rural areas -COAG Section 19(2) Exemptionslnitiative for Non Admitted Patients5. General Business5.1 COAG Section 19(2)ExemptionsPower point presentation by Margaret ConstableDr S Sivanathan discussed advantages for WeeWaa Community Hospital. lmplementation plantabled and discussed.Chairperson to sign site agreement if LHACmembers agree with proposalAwaiting direction from theafeaCommittee members allagreed to have chairpersonsign implementation of theCOAG Section 19(2) sitestakeholder agreement whenfinalised.6. Other BusinessNo other business due topresentation and informationregarding COAG Section 19(2)Exemptions lnitiative for NonAdmitted Patients.Delegates ReportsWee Waa LHACC Meeting3 of 6 March 2012 Ordinary Business PaperPage 58 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.1.aFor lnformation7.1 HNE Matters August, 2011Next Meetinq10.1 The next meeting time to beadvised by Margaret Constable{insert month and year}Delegates ReportsWee Waa LHACC Meeting4 of 6 March 2012 Ordinary Business PaperPage 59 of 555 of the March 2012 Ordinary Business Paper

Wee Waa Local Health Advisory CommitteeAttachment 8.1.aHealthHunter New EnglandLocal Health DistrictAction List as at 11 October, 2011Delegates ReportsWee Waa LHACC Meeting5 of 6 March 2012 Ordinary Business PaperPage 60 of 555 of the March 2012 Ordinary Business Paper

{ioirr lHearths.çI{ I L'iiîi);ü'Jì3Jfi iiReport for:LHAC MeetingThursday 16thFebruarv 2012Report from:Attachment 8.1.aMs. MargaretConstable - HSMWee WaaReport on:COAG Section 19(2) Exemptionlnitiative - lmproving Access toPr¡mary Care Services in RuralAreas.Date ReportWr¡tten:Tuesday 14thFebruarv 2012SITUATIONUnder the lmproving Access to Primary Care Services in Rural Areas - COAG Section 19(2) Exemptionslnitiative, small rural and remote towns, with populations of less than 7000 and with an identified generalpractitioner (GP) workforce shortage are eligible for exemption of Section t9(2) of the Commonwealth Healthlnsurance Act 1973.The Wee Waa Health Service Manager, Ms. Margaret Constable, has been working closely with her stafl thelocal Medical Practitioners and Community Stakeholders to progress the Section 19(2) Exemptions lnitiativefor the locality of Wee Waa.BACKGROUNDThis initiative, as part of the Health Reform agenda, provides exemptions under Section 19(2) of the Healthlnsurance Act 1973 enabling Medicare benefits to be claimed for eligible, non-admitted, non-referredprofessional services that have traditionally been provided by State governments in small rural healthfacilities.The 19(2) Exemptions lnitiative provides an opportunity for the Wee Waa Health Service, in consultation withcommunity stakeholders, to improve the provision of primary health care services to the Wee Waacommunity through the reinvestment of Medicare Benefits Schedule (MBS) revenue that will be raised fromthe initiative.A Memorandum of Understanding (MOU) was signed between the Commonwealth (Cwlth) and New SouthWales Governments in December 2011, which committed funding for this initiative until 30 June 2015.ASSESSMENTThe implementation status of the Section 19(2) Exemptipn lnitiative for Wee Waa is:o Draft HNELHD 19(2) lmplementation Plans have been submitted to the NSW Ministry of Health (MOH) forcomment prior to final submission to the Commonwealth. Positive feedback about the plans has beenreceived from MOH with minor changes being made prior to submission to the Commonwealth.¡ The Wee Waa 19(2) lmplementation Plan, which has been signed off by all Medical Practitioners andcommunity stakeholders, will shortly be re-submitted to the Commonwealth seeking exemption and 'goahead'for the Wee Waa locality.¡ HNELHD is currently waiting for the Commonwealth to grant a t9(21exemption for the Warialda MPS whichis the pilot site for HNELHD. Warialda will provide a practical model for other facilities such as Wee Waa toadopt. Templates and work processes developed in Warialda will be easily transferrable to Wee Waa.o Enhancements have been made to iPM Emergency Department (ED) Module to record appropriate 19(2)information and additional programming to the finance software Platypus 2 was performed to facilitateMedicare billing. This will have the effect of simplifying processes for frontline and administrative staff. Aswell, the HNE pat¡ent information system staff and finance and billing staff will be working closely with WeeWaa staff on 'go-live' date to provide on-site training, ensuring the smooth rollout of the 19(2) lnitiative.¡ Wee Waa Medical Practitioners have applied for new Medicare provider numbers that are location specificfor the 19(2) lnitiative. The doctor's details are currently being loaded into the HNELHD finance systemPlatypus 2. This is being done to assist localstaff with the 19(2) billing process and with the reimbursementof funds from Medicare Australia (back into the Wee Waa Health Service).o Business process are currently being reviewed, a training package for staff is being developed, as is acommunication plan which will provide information for both internal stakeholders and the general public.¡ A reinvestment strategy has been drafted by the Wee Waa HSM, in consultation with the Wee Waa staff,LHAC, Medical Practitioners and relevant stakeholders. This strategy will not only contribute to decisionsabout how to re-invest generated funds but will also provide a governance mechanism to oversee thereinvestment of funds and thus ensuring enhancement to primary health care in the Wee Waa community.o Allied Health Service mapping has been completed for Wee Waa which will assist in identifying service gapsand will also be an aid to decision making for the reinvestment strategy.RECOMMENDED ACTIONDelegatesFor information. ReportsWee Waa LHACC Meeting6 of 6 March 2012 Ordinary Business PaperPage 61 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 DELEGATES REPORTS8.2 FLOODPLAIN MANAGEMENT ASSOCIATION COMMITTEE MEETING(JC:EL)RECOMMENDATION: That the Council receive and note Cr Clements’ DelegatesReport on the Floodplain Management Association Committee Meeting held 24 th November2011 and 23 rd February 2012.I attended the Floodplain Management Association Committee Meetings on 24 th November 2011 inSydney, and in Batemans Bay on 23 rd February 2012. Attached for information at Attachment8.2.a are the following Floodplain Management Association Committee papers:Notice of Meeting, Business Papers and associated annexures for the FloodplainManagement Association Committee meeting held Thursday, 24 th November 2011;Floodplain Management Association Committee Minutes from meeting held Thursday, 24 thNovember 2011;Business Papers and associated annexures for the Floodplain Management AssociationCommittee meeting held Thursday, 23 rd February 2012.The Minutes of the February 2012 Floodplain Management Association Meeting and AGM havenot been received by Council at this stage and on receival, will be presented to the Council in afuture delegates report.Cr J ClementsDELEGATEDELEGATES REPORTS PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THENARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH 2012.GENERAL MANAGERMAYORPage 62 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodp lai n Management AssociationNotice of Meet¡ngCall for Agenda ltems, Reports & Notices of MotionNovem ber Quarterly Meetingand WorkshopDate: Thursday 24 November,201lPlace: The Auditorium, McKell House, Rawson Place, SydneyMeeting Time'.11.00 am until 1:00 pmA light lunch will be available at the conclusion of the meeting.Workshop Time. 1.45 pm until 2:45 PmWorkshop Topic: Social Media - communication opportunities before and during floods.Items for Agenda and Notices of MotionMembers are advised that any ltems of Business to be listed and Notices of Motion are to belodged with the Executive Officer by the close of business on 10 November, 2011. All ltemsand Notices received will be circulated with the Business Papers.Reports from Agencies and CommitteesAgencies and Committees are advised to have their reports with the Executive Officer byclose of business on 10 November, 2011. All reports received will be circulated with theBusiness Papers.Reports from the FMA ExecutiveExecutive Members are reminded to have reports with the Executive Offlcer by the close ofbusiness on 10 November, 2O11for circulation with the Business Papers.Draft Minutes of the May Quarterly MeetingDraft Minutes of the August Quarterly Meeting were circulated on 1 1 October.Meeting ApologiesPlease advise apologies, if possible before the meeting, to the Executive Officer.RegardsârPGlenn EvansExecutive Officer2811012011glennevans.fma@gmail.com | 0415 873353 | 115 Marshall Street Garden Suburb NSW 2289Delegates ReportsFloodplain Management Association Meetings1 of 214 March 2012 Ordinary Business PaperPage 63 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplainManagementAssociationMINUTES of NOVEMBER 2011 QUARTERLY MEETINGThursday 24 November, 2011McKell House AuditoriumRawson Place, SydneyMeeting commenced at 11:05Item IItem 2Item 3Item 4Item 5Item 6Item 7Item 8Item 9Item 10ApologiesConfirmation of Minutes Quarterly Meeting of 25 August,2011 and Business ArisingGhairman's Reportlmmediate Past Chairman's ReportDeputy Ghairman's ReportExecutive Officer's ReportTreasurer's ReportReports from Executive CommitteeDirector - TechnicalDirector - Land-Use PlanningCommunications OfficerReports from Conference HostsE u robod alla 20 12 Conferen ceTweed 2013 National ConferenceReports from AgenciesOffice of Environment and HeritageState Emergency ServiceBureau of MeteorologyChairman...Delegates ReportsFloodplain Management Association Meetings.............Executive Officer...2 of 214 March 2012 Ordinary Business PaperPage 64 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 1lItem 12Item 13Item 14FMA Survey - Flood Definition, s149 CertificatesItems Listed by MembersGeneral BusinessNext Scheduled Meeting / Close1:30 - 2:30 Workshop: "Social Media - communication opportunities between andduring floods" Discussion was led by FMA Director Landuse Planning Sue Ribbons. Thepresentation is at Appendix 9.Item 1 APOLOGIESAttendance and apologies are at Appendix 7.Resolved - That the apologies be accepted.Item 2 CONFIRMATION OF QUARTERLY MEETING MINUTESMinutes of the August 2011 Quarterly Meeting have been circulated.Resolved - The Minutes as circulated were accepted as a true record of the QuarterlyMeeting of the August, 2011.There was no business arising from the Minutes not covered elsewhere in the agenda.Item 3 CHAIRMAN'S REPORTGirculated ReportIt is my pleasure to welcome all members and visitors to the November 2011 QuarterlyMeeting and thank you very much for your attendance today.During the past 3 months your Executive has been working on severalfronts to promote theinterests of floodplain rnanagement and it has been pleasing to note the interest fromoverseas with several speakers travelling to our next conference at their own expense topresent papers and join in with our network.Delegates may also be interested to know that I have changed my professional role as anEngineer and have moved to Moree Plains Shire Council, which is a long standing memberof the FMA. The Council has been unable to attend meetings recently so I am now able tobring a "western" perspective to our discussions as well as my normal role as a Councillorfor Clarence Valley Council.Chairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer3 of 214 March 2012 Ordinary Business PaperPage 65 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alnternational River SymposiumDuring September I attended the lnternational River Symposium in Brisbane and was ableto make contact with several speakers who will be of considerable interest to all delegates ifwe can recruit them to present at our national conference in 2013.The sessions on the Brisbane and other Queensland floods were particularly interestingand there are many lessons for us all resultíng from these events.I was able to promote the FMA during question times and networking throughout each day.I have given a written summary of potential speakers to our Executive Officer and to TweedShire Councilwho will be hosting the 2013 conference.Discussions with LGSAAs verbally reported to the last quarterly meeting, further discussions have been held withthe LGSA in Sydney on Wednesday 24th August 2011to identify more specific areas ofmutual support.It was agreed that the exchange of information via our respective newsletters would bemutually beneficial and in particular the issues surrounding land use planning and theupcoming review of planning legislation. A meeting will again be held with the LGSA on 23November before our quarterly meeting and a verbal report will be presented to thismeeting.Flood Risk Management Course at University of Technology SydneyThe FRM course has been successfully completed for another year and I particularly wishto thank our Technical Director, David Gibbons, and our Land-use Planning Director SueRibbons for their valuable time and expertise in presenting components of this course.It is a big commitment to prepare and present subject material at this level and all memberscan be assured that the FMA is very well represented by Sue and David in this importantacademic forum.Once again, on your behalf, I wish to express my sincere thanks to Duncan Mcluckie alsofor his continued efforts in delivering our education program and one day workshop serieseach year. The state agencies have undergone some significant changes but thankfully wehave continued our strong partnership thanks to Duncan's long standing commitment.It was particularly pleasing to see a number of Planners this year, and I encourageeveryone to continue signing up more Planners to attend in future years for the benefìt offloodplain management.Executive RepresentationWe were indeed fortunate to be represented by members of our Executive at a number ofsignificant recent events. Director-Planning Sue Ribbons and Director-Technical DavidDelegates ReportsFloodplain Management Association Meetings4 of 214 March 2012 Ordinary Business PaperPage 66 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGibbins have each delivered presentations at the Emergency Management and BusinessContinuity Summit at Darling Harbour, Sydney in September 2011.Deputy Chairman Clr Larry Bolitho has now represented the FMA at the National FloodForum 2011 in Brisbane in October where his expertise on insurance matters wasparticu larly beneficial.lnternational Commission on lrrigation and DrainageThe 63'd Conference of the lnternational Commission on lrrigation and Drainage, thelrrigation Australia Annual Conference and the 7th Annual Asian Regional lrrigationConference will be held concurrently in Adelaide from 24lo 30 June 2012.The conference is expected to attract in the order of 500. The program includes a floodplainmanagement component, and the FMA has been invited to assist. This is anotheropportunity for the FMA to network with interstate and overseas practitioners, and increaseknowledge of the FMA. The Executive Officer will participate in the conference programorganising committee.OEH Review of Flood ProgramDuring October Land-use Planning Director Sue Ribbons, the Executive Officer and Iaccompanied representatives from Warringah, Shoalhaven, The Hills and the Hunter at ameeting with OEH staff to provide input to the review.The discussions covered a range of issues which have been raised by FMA members,including support for the NSW Floodplain Development Manual (FDM), the need for expertOEH technical staff to assist members and be champions for sound floodplainmanagement; appropriate levels of funding, affordable funding ratios and rolling programsfor capital and maintenance activities; funding for community education and appropriatedevelopment controls; and the need for consistency of planning policies with the FDM.Thank you to those members who provided issues and information to the Executive, andthank you to those members who participated in the meeting. We are looking fonruard to thenext progress meeting.Season's GreetingsAs this is our final meeting for 2011,1 would like to take this opportunity to thank membersand delegates, and particularly the Executive Team, for the support you have provided tothe FMA throughout the year. I wish you all the best for a safe, happy and prosperousChristmas and New Year.Clr lan DinhamChairmanResolved -The Chairman's Report be received.Delegates ReportsFloodplain Management Association Meetings5 of 214 March 2012 Ordinary Business PaperPage 67 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 4 IMMEDIATE PAST CHAIRMAN'S REPORTClr Ezzy advised that on 17 October he represented the FMA, LGSA and ALGA at ameeting of the National Flood Risk Advisory Group (NFRAG) in Brisbane. lssues discussedincluded the National Strategy for Disaster Resilience and draft Communications Strategy,the Australian Flood Studies Database hosted by Geoscience Australia, and progress of theQueensland Reconstruction Authority in planning for more resilient floodplains.He also attended the annual Local Government Association Conference in Nowra inOctober, and there are lessons from that event which can be applied to the FMA's annualconference.Resolved - The lmmediate Past Chairman's Report be received.Item 5 DEPUTY CHAIRMAN'S REPORTClr Bolitho noted that while this is a season of glad tidings and joy, we need to rememberthat it is also a time of destruction and devastation for many. Our task is to help reducehardship for our communities.Clr Bolitho advised that he attended the first National Floods Forum in Brisbane on 6 and 7October. The forum was opened by the Attorney General.There were 7 technical presentations on the first day including various forms of temporarybarriers. A presentation was provided by a group called Emergency Architects Australia(EEA) which provided architects, engineers and students to assist people without floodinsurance. EEA reported that most housing is brick veneer on concrete slab, which sustainsmajor damage when inundated. Many builders now have no experience in building otherforms of construction. The group is working with the University of Newcastle to developmodelling of flood liability of building techniques.The second day included a presentation by the lnsurance Council of Australia. A clearmessage was that if funding for flood mitigation is not restored we cannot afford to increasethe number of houses at risk, and the flood disaster scheme would be at risk. There is astrong push for common definitions across all professions involved in floods. He believesthis would be an unmitigated disaster as the many organisations have differing roles andresponsibilities, and different communication needs.The forum was advised that planners responsible for signing off plans for development infloodprone areas do not need to have formal training in floodplain management. Clr Bolithoadvised forum attendees of the UTS Floodplain Risk Management Course developed inpartnership with OEH and the FMA. Allan Gear reminded the meeting that the Planninglnstitute of Australia (PlA) also encourages its members to attend the FMA annualconference, which is accredited for continuing career development points.On 23 November Clr Bolitho and the Executive Officer attended a meeting with the LocalGovernment and Shires Associations' Director - Policy and Policy Officer for EmergencyServices. Arrangements were agreed for a survey of Councils affected by the 2010 and2011 floods to be undertaken in December/January. The survey will assess Councils' rolesChairman....Delegates ReportsFloodplain Management Association Meetings....Executive Officer6 of 214 March 2012 Ordinary Business PaperPage 68 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aand costs in flood response and recovery, and their experiences with the Natural DisasterRecovery Arrangements (NDRA).The LGSA has accepted an invitation to participate in the 2012 FMA Conference. ShiresAssociation President Clr Ray Donald will deliver an address at the opening ceremony.Clr Bolitho commented that in the coming year the FMA will need to look at the resources ithas to address the huge range of issues ahead of it, particularly as we move towards thenational conference in 2013.Resolved - The Deputy Chairman's Report be received.Item 6 EXECUTIVE OFFICER'S REPORTCirculated ReportFMA Corporate and Business PlansThe FMA Constitution requires the organisation to prepare an annual Business Plan, and toreview the Corporate Plan every two years. These plans are based on the Constitution,which Members will recall was unable to be amended at the 2011 AGM.The workshop held after the August meeting commenced the business planning process,and discussed priorities for the FMA; what we are good at; what we need to do better; andhow we can do better. The six highest priorities identified were:. improve funding from all levels of governmentoo. lobby with professionalism. build continuing professional development. build networks and strategic alliancesproactively influence the insurance industryremain relevant - importance as a national organisation / national presenceThe results of the November workshop will be the basis of the Corporate and BusinessPlans to be presented to the February AGM.The other essential document which needs to be prepared for the AGM is the FMA'srevised Constitution. The Executive has decided that a simplified constitution which allowsmore operational flexibility and responsiveness is more appropriate as the needs of theorganisation change. Accordingly I have commenced preparation of a draft constitutionbased on the requirements of the Model Constitution from the Associations lncorporationAct. I will discuss this briefly at the workshop.It is also extremely important that all Full Members attend the Annual General Meeting atthe Conference in February to ensure that the Constitutional changes can be progressed.MembershipsDelegates ReportsFloodplain Management Association Meetings7 of 214 March 2012 Ordinary Business PaperPage 69 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThank you to the members who have already renewed their memberships -77 by 16November. Membership fees are the main source of the FMA's operating income so promptpayment will be greatly appreciated.FMA Member RepresentationKempsey Shire Council has written to the FMA concerning the failure of council's floodwarning system during the 2009 and 2011 floods. Council has raised concerns at thenumber of key stakeholders and the complicated interrelationships involved in current floodwarning arrangements. lt has requested a complete review of arrangements for floodwarning systems in NSW.The matter has been referred to the NSW Flood Warning Consultative Committee of whichthe FMA is a member.2014 FMA GonferenceThe venue for FMA Conferences is determined 2 years in advance. ln January I will berequesting nominations from Full Members to host the 2014 Conference. lf yourorganisation is interested please contact me to obtain the Conference Hosting Manualwhich sets out the requirements.Natural Disaster lnsurance Review - FMA SubmissionAs reported to the August Quarterly Meeting the Director-Technical David Gibbins led thepreparation of the FMA's submission on the Australian Government's Natural Disasterlnsurance Review issues paper. The review is looking at insurance and related mattersfollowing the floods in Queensland and other states.The inquiry's report "Reforming flood insurance - A proposal to improve availability andtransparency" provides 47 recommendations and has been made available for commentuntil 30 March. The report is at Appendix 2.On 14 November the Attorney General Robert McClelland and Assistant Treasurer BillShorten released the Australian Government's response to the recommendations. TheResponse is at Appendix 3.FMA WebsiteClr lsaac Smith will report later in the meeting on his progress in developing the new FMAwebsite. The current website is becoming increasingly difficult to manage, and I askmembers to bear with the very limited amount of information we can make available untilthe new website is operating. When there are items of significant interest they are advisedto members by the FMA Flyers, or email.FMA Quarterly Meeting DatesChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer...8 of 214 March 2012 Ordinary Business PaperPage 70 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThe Annual General Meeting and February Quarterly Meeting will be held at Bateman's Bayon Thursday 23 February 2012.2012 Quarterly Meetings will be held on:Thursday 24 MayThursday 23 AugustThursday 22 NovemberThe venue for the meetings is to be confirmed.I look forward to catching up with you at Batemans Bay in February.Glenn EvansExecutive OfficerAdditional comments from the Executive OfficerThis is the last meeting to be held at McKell Building, as the FMA has been unable tosecure the venue for next year. Members confirmed that a location close to Central RailwayStation is preferable.Resolved - The Executive Officer's Report be received.Item 7 TREASURER'S REPORTCirculated Report2011 Financial PlanThe following budget was adopted at the 201 1 AGM for the activities of the FMA for thefinancial year ending 31 December 2011.From 1 July the adopted fee structure exclusive of GST is:Full Members. ....$1,200Associate & Corporate Members.........$600. Private Members. .......$120o Life Members..........Ni|Progress towards 2011 Financial Plan as at 31 October 2011- tabled page 9Chairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...9 of 214 March 2012 Ordinary Business PaperPage 71 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplainManagementAssociationBUSINESS PAPERS, NOVEMBER 2011 QUARTERLY MEETING11 am, Thursday 24 November,2011McKell House AuditoriumRawson Place, SydneysociarMedia-"Jf,lîJ"illîffo1f,T,l["o[Iå!3"p"'"oduringrroodsItem IItem 2Item 3Item 4Item 5Item 6Item 7Item 8Item 9Item l0ApologiesConfirmation of Minutes Quarterly Meeting oÍ 25 August,2011 and Business ArisingGhairman's Reportlmmediate Past Chairman's ReportDeputy Chairman's ReportExecutive Officer's ReportTreasurer's ReportReports from Executive CommitteeDirector - TechnicalDirector - Land-Use PlanningCommunications OfücerReports from Conference HostsEu robod alla 2012 ConferenceTweed 2013 National ConferenceReports from AgenciesOffice of Environment and HeritageState Emergency ServiceBureau of MeteorologyDelegates ReportsFloodplain Management Association Meetings10 of 214 March 2012 Ordinary Business PaperPage 72 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 11Item 12Item 13Item 14FMA Survey - Flood Definition, s149 Certificatesltems Listed by MembersGeneral BusinessNext Scheduled Meeting / CloseA sandwich luncheon will be served at the conclusion of the meeting.l:30 - 2:30 Workshop: "social Media - communication opportunities between andduring floods" Discussion to be led by FMA Communications Officer lsaac OffìcerItem I APOLOGIESCall for apologies in addition to those held by the Executive Officer.Move ....."That the apologies be accepted."Item 2 CONFIRMATION OF QUARTERLY MEETING MINUTESMinutes of the August 2011 Quarterly Meeting have been circulated.Move....."That the Minutes as circulated be accepted as a true record of the QuarterlyMeeting of the 25, Augusl2011."Business arising from the Minutes not covered elsewhere in the agenda.Item 3 CHAIRMAN'S REPORTIt is my pleasure to welcome all members and visitors to the November 2011 QuarterlyMeeting and thank you very much for your attendance today.During the past 3 months your Executive has been working on severalfronts to promote theinterests of floodplain management and it has been pleasing to note the interest fromoverseas with several speakers travelling to our next conference at their own expense topresent papers and join in with our network.Delegates may also be interested to know that I have changed my professional role as anEngineer and have moved to Moree Plains Shire Council, which is a long standing memberof the FMA. The Council has been unable to attend meetings recently so I am now able tobring a "western" perspective to our discussions as well as my normal role as a Councillorfor Clarence Valley Council.Delegates ReportsFloodplain Management Association Meetings11 of 214 March 2012 Ordinary Business PaperPage 73 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alnternational River SymposiumDuring September I attended the lnternational River Symposium in Brisbane and was ableto make contact with several speakers who will be of considerable interest to all delegates ifwe can recruit them to present at our national conference in 2013.The sessions on the Brisbane and other Queensland floods were particularly interestingand there are many lessons for us all resulting from these events.I was able to promote the FMA during question times and networking throughout each day.I have given a written summary of potential speakers to our Executive Officer and to TweedShire Council who will be hosting the 2013 conference.Discussions with LGSAAs verbally reported to the last quarterly meeting, further discussions have been held withthe LGSA in Sydney on Wednesday 24th August 2011 to identify more specific areas ofmutual support.It was agreed that the exchange of information via our respective newsletters would bemutually beneficial and in particular the issues surrounding land use planning and theupcoming review of planning legislation. A meeting will again be held with the LGSA on 23November before our quarterly meeting and a verbal report will be presented to thismeeting.Flood Risk Management Gourse at University of Technology SydneyThe FRM course has been successfully completed for another year and I particularly wishto thank our Technical Director, David Gibbons, and our Land-use Planning Director SueRibbons for their valuable time and expertise in presenting components of this course.It is a big commitment to prepare and present subject material at this level and all memberscan be assured that the FMA is very well represented by Sue and David in this importantacademic forum.Once again, on your behalf, I wish to express my sincere thanks to Duncan Mcluckie alsofor his continued efforts in delivering our education program and one day workshop serieseach year. The state agencies have undergone some significant changes but thankfully wehave continued our strong partnership thanks to Duncan's long standing commitment.It was particularly pleasing to see a number of Planners this year, and I encourageeveryone to continue signing up more Planners to attend in future years for the benefit offloodplain management.Executive RepresentationWe were indeed fortunate to be represented by members of our Executive at a number ofsignificant recent events. Director-Planning Sue Ribbons and Director-Technical DavidDelegates ReportsFloodplain Management Association Meetings12 of 214 March 2012 Ordinary Business PaperPage 74 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGibbins have each delivered presentations at the Emergency Management and BusinessContinuity Summit at Darling Harbour, Sydney in September 2011.Deputy Chairman Clr Larry Bolitho has now represented the FMA at the National FloodForum 2011 in Brisbane in October where his expertise on insurance matters wasparticu larly beneficial.lnternational Gommission on lrrigation and DrainageThe 63'd Conference of the lnternational Commission on lrrigation and Drainage, thelrrigation Australia Annual Conference and the 7th AnnualAsian Regional lrrigationConference will be held concurrently in Adelaide from 24 to 30 June 2012.The conference is expected to attract in the order of 500. The program includes a floodplainmanagement component, and the FMA has been invited to assist. This is anotheropportunity for the FMA to network with interstate and overseas practitioners, and increaseknowledge of the FMA. The Executive Officer will participate in the conference programorganising commíttee.OEH Review of Flood ProgramDuring October Land-use Planning Director Sue Ribbons, the Executive Officer and Iaccompanied representatives from Warringah, Shoalhaven, The Hills and the Hunter at ameeting with OEH staff to provide input to the review.The discussions covered a range of issues which have been raised by FMA members,including support for the NSW Floodplain Development Manual (FDM), the need for expertOEH technical staff to assist members and be champions for sound floodplainmanagement; appropriate levels of funding, affordable funding ratios and rolling programsfor capital and maintenance activities; funding for community education and appropriatedevelopment controls; and the need for consistency of planning policies with the FDM.Thank you to those members who provided issues and information to the Executive, andthank you to those members who participated in the meeting. We are looking fon¡rard to thenext progress meeting.Season's GreetingsAs this is our final meeting for 2011,1 would like to take this opportunity to thank membersand delegates, and particularly the Executive Team, for the support you have provided tothe FMA throughout the year. I wish you all the best for a safe, happy and prosperousChristmas and New Year.Clr lan DinhamChairmanMove......"That the Chairman's Report be adopted."Delegates ReportsFloodplain Management Association Meetings13 of 214 March 2012 Ordinary Business PaperPage 75 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 4 IMMEDIATE PAST CHAIRMAN'S REPORTA verbal report will be provided by Clr Ezzy.Move......"That the lmmediate Past Chairman's Report be adopted."Item 5 DEPUTY CHAIRMAN'S REPORTA verbal report will be provided by Clr Bolitho.Move......"That the Deputy Chairman's Report be adopted."Item 6 EXECUTIVE OFFICER'S REPORTFMA Gorporate and Business PlansThe FMA Constitution requires the organisation to prepare an annual Business Plan, and toreview the Corporate Plan every two years. These plans are based on the Constitution,which Members will recall was unable to be amended at the 2011 AGM.The workshop held after the August meeting commenced the business planning process,and discussed priorities for the FMA; what we are good at; what we need to do better; andhow we can do better. The six highest priorities identified were:. improve funding from all levels of governmentoo. lobby with professionalism. build continuing professional development. build networks and strategic alliancesproactively influence the insurance industryremain relevant - importance as a national organisation / national presenceThe results of the November workshop will be the basis of the Corporate and BusinessPlans to be presented to the February AGM.The other essential document which needs to be prepared for the AGM is the FMA'srevised Constitution. The Executive has decided that a simplified constitution which allowsmore operational flexibility and responsiveness is more appropriate as the needs of theorganisation change. Accordingly I have commenced preparation of a draft constitutionbased on the requirements of the Model Constitution from the Associations lncorporationAct. I will discuss this briefly at the workshop.It is also extremely important that all Full Members attend the Annual General Meeting atthe Conference in February to ensure that the Constitutional changes can be progressed.Delegates ReportsFloodplain Management Association Meetings14 of 214 March 2012 Ordinary Business PaperPage 76 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aMembershipsThank you to the members who have already renewed their memberships -77 by 16November. Membership fees are the main source of the FMA's operating income so promptpayment will be greatly appreciated.FMA Member RepresentationKempsey Shire Council has written to the FMA concerning the failure of council's floodwarning system during the 2009 and 2011 floods. Council has raised concerns at thenumber of key stakeholders and the complicated interrelationships involved in current floodwarning arrangements. lt has requested a complete review of arrangements for floodwarning systems in NSW.The matter has been referred to the NSW Flood Warning Consultative Committee of whichthe FMA is a member.2014 FMA ConferenceThe venue for FMA Conferences is determined 2 years in advance. ln January I will berequesting nominations from Full Members to host the 2014 Conference. lf yourorganisation is interested please contact me to obtain the Conference Hosting Manualwhich sets out the requirements.Natural Disaster lnsurance Review -FMA SubmissionAs reported to the August Quarterly Meeting the Director-Technical David Gibbins led thepreparation of the FMA's submission on the Australian Government's Natural Disasterlnsurance Review issues paper. The review is looking at insurance and related mattersfollowing the floods in Queensland and other states.The inquiry's report "Reforming flood insurance - A proposal to improve availability andtransparency" provides 47 recommendations and has been made available for commentuntil 30 March. The report is at Appendix 2.On 14 November the Attorney General Robert McClelland and Assistant Treasurer BillShorten released the Australian Government's response to the recommendations. TheResponse is at Appendix 3.FMA WebsiteClr lsaac Smith will report later in the meeting on his progress in developing the new FMAwebsite. The current website is becoming increasingly difficult to manage, and I askmembers to bear with the very limited amount of information we can make available untilthe new website is operating. When there are items of significant interest they are advisedto members by the FMA Flyers, or email.Delegates ReportsFloodplain Management Association Meetings15 of 214 March 2012 Ordinary Business PaperPage 77 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFMA Quarterly Meeting DatesThe Annual General Meeting and February Quarterly Meeting will be held at Bateman's Bayon Thursday 23 February 2012.2012 Quarterly Meetings will be held on:Thursday 24 MayThursday 23 AugustThursday 22 NovemberThe venue for the meetings is to be confirmed.I look fonryard to catching up with you at Batemans Bay in February.Glenn EvansExecutive OfficerMove...... "That the Executive Officer's Report be received".Item 7 TREASURER'S REPORT2011 Financial PIanThe following budget was adopted at the 2011 AGM for the activities of the FMA for thefinancial year ending 31 December 2011.From 1 July the adopted fee structure exclusive of GST is:o Full Members. ....$1,200. Associate & Corporate Members.........$600. Private Members. ........$120. Life Members. .........Ni|Progress towards 2011 Financial Plan as at 31 October 2011lncomeJan-Oct2011 Actual/ex GSD2011 Budget(ex GST)2010 Actual(ex GST)2010Budget(inc GST)Membership fees93,340101 ,64092,70093,500lnterest5,0503,00030431,000Sundry (1)6,4684,000279,000Australian Taxation Office2,000Total lncome104,858108,640 95,770 105,500Delegates ReportsFloodplain Management Association Meetings16 of 214 March 2012 Ordinary Business PaperPage 78 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aExpenditureJan-Oct2011 ActualGx GST)2011Budget (exGST)2010 Actual(ex GSfAccountancy Fees1,8202,0000Audit Fees8001,3004,010Chairman's Allowances5,0977,0007,500Executive Services42,11355,00043,314Special Executive Services2,000Annual Conference Expenses & Travel1,8078,00034,504Entertainment6711,000Depreciation1,000Media/Promotions3,0005,000Miscellaneous1002,0002524,000Lobbying2,0002,000Printing & Stationery5602,700Website2,65520,0003,0855,000Member Visitation, Travel4,53713,0004,000Legal8364,0002,8704,000Floodplain Professional Education1,00030,00035,000Australian Taxation Office1,000FMA Scholarship2.000Total Expenditure 60,997 127,000 125,536 121,000Surplus/(Deficit) 43,861 (18,360) (29,765) (15,500)Opening Retained profits202,516151,706181,471181,471Net ProfiV(Loss) attributable(6,949)(18,360)(29,765)(15,500)Closinq retained profits 195.567 133,346 151 ,706 165,971Delegates ReportsFloodplain Management Association Meetings17 of 214 March 2012 Ordinary Business PaperPage 79 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alncomeJan-Oct2011 ActualGx GST)2011 Budget(ex GST)2010 Actual(ex GST)2010Budget(ínc GST)Membership fees93,340101,64092,70093,500lnterest5,0503,00030431,000Sundry (1)6,4684,000279,000Australian Taxation Office2,000Total lncomeExpenditureAccountancy FeesAudit FeesChairman's AllowancesExecutive ServicesSpecial Executive ServicesAnnual Conference Expenses & TravelEntertainmentDepreciationMedia/PromotionsMiscellaneousLobbyingPrinting & StationeryWebsiteMember Visitation, TravelLegalFloodplain Professional EducationAustralian Taxation Office104,858Jan-Oct2011 Actuallex GSI)1,8208005,09742,1131,8076711005602,6554,537836108,640 95,770 105,5002011Budget (exGSn2,0001,3007,00055,0002,0008,0001,0001,0003,0002,0002,0002,70020,00013,0004,0001,0002010 Actual(ex GSf04,0107,50043,31434,5042523,0852,87030,0002010Budget(inc GST)04,0006,00035,0007,0008,0001,0005,0004,0002,0005,0004,0004,00035,0001,000FMA Scholarship2,000Total Expenditure 60,997 127,OOO 125,536 121 ,000Surplus/(Deficit) 43,861 (18,360) (29,765) (15,500)Chairman.Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...18 of 214 March 2012 Ordinary Business PaperPage 80 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOpening Retained profits202,516151,706181,471181,471Net ProfiU(Loss) attributable(6,949)(18,360)(29,765)(15,500)Closino retained profits 195,567 133,346 151 ,706 165,971Chairman...Delegates ReportsFloodplain Management Association Meetings... .......Executive Officer19 of 214 March 2012 Ordinary Business PaperPage 81 of 555 of the March 2012 Ordinary Business Paper10

Attacment 8.2.aBalancesñeef as at 31/10/2011Cash AssefsJan-Oct2011 Actualþx GST)2010 Actual(ex GST)Cash at bank 43,751 37,474Term deposit 06 2546 50093990 60,060Term deposit #10938,47540,000Term deposit #117Total Currenf Assefs;92,161 40,000195,972 155.949Non-Currenf AssefsPPEWeb designLess A/depreciationTotal Non-Current AssefsTotalAssets195,971 .61 155.949Current LiabilitiesCu rre nt T ax li abil itie sGST clearing(177)3,243Amounts withheld from S&W5821,000Total Current Liabilities405 4,243Total Liabilities4054,243Net AssetsBalance per bank statement at31t1012011Less outstanding chequesPlus Term Deposit #990Plus Term Deposit #117195.567 151.70653,570.40(8,822.81)60,059.5492.161.12Total available cash at3111012011: 196,968.25Notes to financial statements(1) Sundry income from 201 1 pre-conference workshop registration fee.Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer20 of 214 March 2012 Ordinary Business PaperPage 82 of 555 of the March 2012 Ordinary Business Paperll

Attacment 8.2.aGheques Drawn 01101 12011 - 31 11012011Date Cheque Amount Comments24t08t2011 446 941.84 I Dinham US trio exo & Ministerial meetinq 1110824t08t2011 447 5 823.58 G Evans Exec Services & Exp reimbursement25t08t2011 448 339.00 SA & GA Michael - Qtlv meetino caterinq2610812011 449 90.80 I Dinham - Qtlv meetino exo19t09t2011 450 4,902.58 G Evans Exec Services4t10t2Q11 451 1,725.00 I Dinham - River Svmoosium exo reimbursement6t10t2011 452 1,167.67 I Dinham - Chair allowance Jlv to Seo 201119t10t2011 453 4,335.00 G Evans Exec Services19t10t2011 454 2.250.0O Summerland Web Development 50% deposit25t10t2011 455 242.81 I Dinham - Meetinq expenses 191101201131t1012011 456 396.00 Accountcorp - Jlv to Sept 2011 BAS31t10t2011 457 8,184.00 ATO - Jlv to Sept 2011 BASTreasurer's CommentsThe FMA's cash position remains strong. Income will increase over the next two months asremaining annual membership subscriptions are paid. The FMA presently has two termdeposits for terms of 5 and 3 months with an interest rate of 5.5%.Glenn EvansTreasurerResolved - Treasurer's Report be received.Item I REPORTS from EXECUTIVE COMMITTEE8.1 Director - Technical David GibbinsGirculated ReportMr Gibbins was unable to attend the rneeting. His report was presented by the ExecutiveOfficer.Chairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer........21 of 214 March 2012 Ordinary Business PaperPage 83 of 555 of the March 2012 Ordinary Business Papert2

Attacment 8.2.aUTS Floodplain Risk Management Short Course 2011This course was developed and is presented by the University of Technology Sydney inconjunction with the FMA and NSW Office of Environment and Heritage (OEH). The courseshows how to develop and implement floodplain risk management in accordance with theNSW Government Flood Policy and Manual. lt is taught by industry experts, includingthose from (OEH), NSW State Emergency Service, Local Government and consultancy.The course is managed by Dr Jaya Kandasamy of UTS.Enrolment was at capacity indicating the success of this joint venture. Those enrolled didinclude a wide range of industry and student representation.Presenters at "Block 2" on 15 and 16 September this year included the Chair of the FMAClr lan Dinham, and Mr Duncan Mcluckie (OEH) and myself (Chapter 8: Managing risk inareas of existing development - originally developed by Mr Pas Silveri of WollongongCouncil - and supplemented with my experience of Newcastle 2007 "Pasha" flash floods.)lan gave many cases of interest with compelling images of flood management in real life -and challenged the students with some examples of calculating flood damages to workthrough for themselves during his lecture.I highly recommend this course to FMA members and those associated with them in theoften controversial and difficult journeys encountered in the development andimplementation of Floodplain Risk Management Plans.Emergency Management and Business Gontinuity SummitDirector Land-use Planning Sue Ribbons and I both presented at this summit held inSydney 20 - 2l September. The event was well attended by emergency management,government and business representatives from across Australia - and overseas.The opening keynote speaker was New Orleans' former Mayor C. Ray Nagin whointroduced New Orleans as a city with a rich culture of jazz - devastated by HurricaneKatrina (2005) - and the work towards recovery after his re-election (2006). He was frank,entertaining and presented a rigorous understanding of the issues across human, political,financial and legislative dimensions. Ray was introduced by Professor Ed Blakely(University of Sydney), internationally known for his work in Urban Policy and disasterrecovery. (See http://ussc.edu.au/news-room/Ray-Nagin-on-post-Katrina-New-Orleans forEd interviewing Ray 29 September 2011.)Presenters and delegates came from across Australia, from Government emergencymanagement, and CSIRO - and included former Deputy Director of the NSW SES Dr GhasKeys. Chas observed floodplain risk management in NSW seems to be losing its positionof Australian and even international leadership with reduced land use planning rigour - andneeds a renewed high level of support from Government - State and Federal. Presentationson the innovative use of social media in emergency response were amazing.Sue provided a case study on Sea Level Rise - Understanding and Communicating ClimateRisks for Coastal Communities. I spoke on Flood Response Measures and DevelopingDisaster Resilience Leadership, using Newcastle as a case study. ln Newcastle there isthe potential for the capacity of emergency management to be overwhelmed in extremeflash flood events placing many thousands of lives at risk.Chairman...Delegates ReportsFloodplain Management Association Meetings.............Executive Officer22 of 214 March 2012 Ordinary Business PaperPage 84 of 555 of the March 2012 Ordinary Business Papert3

Attacment 8.2.aI commend the Summit presentations to you, which (as the Executive Officer has previouslyadvised) are at www.halledit.com.aulemergencyemansummit'1 1/presentations/2012 FMA ConferenceI have been privileged to participate on the Review Panel for the up and comingConference (www.floodplainconference.com). This year more than 50% more abstractswere received than last year. The diversity of topics and authors - with a significant numberfrom across Australia and overseas - coupled with the very high quality of abstracts -certainly made the Panel's task lengthy and challenging.The result, I believe, will be an outstanding conference hosted by Eurobodalla Shire Councilin the wondedul setting of Bateman's Bay. The theme of the conference is "Riding theFlood of Change - turning risk into opportunity". The conference dates are 21-24 February2012 - with 'early bird'registrations closing Friday 9th December 2011. I urge you toregister - and to register earlylComing: The FMA at a National Flood Modelling and Mapping WorkshopThe National Emergency Management Committee (Australian Government - Attorney-General's Department) has planned that its Risk Assessment, Measurement and MitigationSub-committee (RAMMS) will hold a two day workshop to develop an agreed methodologyto map areas of risk relating to riverine and flash flooding, storm surge and coastalinundation which will facilitate a nationally consistent approach to future flood mapping andmodelling.Participants at this workshop will include members from RAMMS, the National Flood RiskAdvisory Group, Geoscience Australia, the National Spatial lnformation ManagementWorking Group, Engineers Australia and the Floodplain Management Association. I will berepresenting the FMA, and Mr Duncan Mcluckie (OEH) will also be attending.The workshops are scheduled for 28 and 29 November 2011. I will report to the FMA onthe workshops and outcomes.ThanksThank you for the opportunity to serve the members of the FMA in this way. Please do nothesitate to contact me if there is anything you wish to raise or discuss with me. I will beonly too happy to help in whatever way I can.David GibbinsDirector - TechnicalResolved -The report be received.8.2 Director - Land Use Planning Sue RibbonsNSW Planning ReviewOn 12 July 2011, the Hon Brad Hazzard, Minister for Planning and lnfrastructure,announced that a total review of the NSW Planning System (particularly the Environmental,Planning and Assessment Act, 1979) would be undertaken in the next 18 months with theChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Ofhcer".23 of 214 March 2012 Ordinary Business PaperPage 85 of 555 of the March 2012 Ordinary Business Paper14

Attacment 8.2.aaim to create new planning legislation for NSW. The NSW Government has established anindependent panel to review the EP&A Act along with the broader planning system. Thereview has been divided into the following 5 milestones:Milestone 1: Review AnnouncementMilestone 2: Listening and Scoping (current phase) - The Review process commenced withan extensive listening and consultation process between September and December 20111oseek the community's views on what should be the broad underpinning principles for newlegislation to replace the Environmental Planning and Assessment Act l9T9.Consultationinvolved the following: Stakeholder Meetings with a range of peak interest groups inSydney; Community Forums at more than 40 locations across NSW; other writtensubmissions - a written submission was prepared by the FMA (see summary of issuesbelow).All submissions, including the FMA's submission, together with notes taken during theStakeholder Meetings and Community Forums are included on the NSW Planning Reviewwebsite (see link below). Written submissions closed on Friday 4 November 2011 forinclusion in the Milestone 3 lssues Paper.Milestone 3: lssues Paper - An lssues Paper will be released in early December 2011 thatwill cover the ideas and feedback received during the Listening and Scoping phase. Afterthe lssues Paper is released in early December, further feedback and comment will beinvited to be received by Friday 17 February 2012.Milestone 4: Policy Options Release - After considering public comments made during theconsultation phase and in response to the December lssues Paper, a Green Paper will beprepared. The Green Paper will set out the recommended structure for a new planningsystem and will be published by the end of April 2012.Milestone 5: Draft Legislation - A'white paper' and draft legislation will be released forexhibition before a bill is submitted to the NSW Parliament. Details of timing will bepublished in due course.Links to further information about the NSW Planning Review are as follows:NSW Planni ng Review website: www. planning review. nsw. gov. auNSW Planning Review Fact Sheet:www.planning.nsw.gov.au/LinkClick.aspx?fileticket=FTYyGHNqTG0%3d&tabid=68&language=en-AUThe summary of issues presented in the FMA's submission is provided below.15Delegates ReportsFloodplain Management Association Meetings24 of 214 March 2012 Ordinary Business PaperPage 86 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFLOODPLAIN RISK MANAGEMENT STARTS WITH LAND USE PLANNING .SUMMARY OF ISSUES FOR NSW PLANNING REVIEWFloodplain risk management involves protecting life and property from floods. With costlyflood mitigation works becoming further and further out of reach from most local councilsand the ever increasing reliance on evacuation only increasing risk to life during floods, theonly way to prevent the cost of flooding from escalating in the future, is through land useplanning.It is therefore of concern that in the past five years and even in light of the publicitysurrounding the devastating floods in Brisbane in January this year, the Department ofPlanning and lnfrastructure has flouted, and has continued to flout, it's own government'sState Flood-Prone Land Policy, by reducing the controls required for development on floodproneland. This has been carried out through apparent ad-hoc changes to legislationwithout adequate consultation with:. Office of Environment and Heritage-Flood Prone Land Policy;who manage the NSW Government. State Emergency Service-who manage the emergency response toinappropriate development on flood-prone land when floods occur; and. local councils-land.who manage the land use and development on flood-proneIt is therefore RECOMMENDED, as part of the NSW Planning Review, that considerationbe given to the following key issues relating to floodplain risk management:. lssue 1 the repeal of Planning Circular PS07-003-oNew Guideline andChanges to Section 117 Direction and EP&A Regulation on Flood Prone Land;lssue 2 the need for recognition of flood risks above the 100 year flood level forall development types;. lssue 3 the need for consistency with the state government's own FloodplainDevelopment Manual;. lssue 4 the need for a clear definition of flood-prone land in the Standardlnstrument LEP;oolssue 5 the need for a clear definition of 'significant adverse impacts' in theStandard lnstrument LEP;lssue 6 acknowledgment that flood mapping is highly technical, costly andtime-consuming and so is beyond the resources and expertise of many localcouncils;l6Delegates ReportsFloodplain Management Association Meetings25 of 214 March 2012 Ordinary Business PaperPage 87 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aolssue 7 the repeal of that part of State Environmental Planning Policy (Exemptand Complying Development Codes) 2008 that permits complying developmenton flood-prone land.More detail on each of these issues is provided in the full submission - attached asAppendix 4.Review of NSW Flood ProgramOn 19 October 2011,lwas fortunate to be involved in a meeting with representatives fromvarious Councils, the FMA and OEH to discuss a range of issues relating to the Review ofthe NSW Flood Program. This was a great opportunity to discuss a positive path forwardfor the NSW Flood Program. One of the key messages from the FMA was that the Office ofEnvironment and Heritage, as custodians of the NSW Flood Program, need to championthe NSW Flood Prone Land Policy and the Floodplain Development Manual, providetechnical assistance to local councils (and not merely be grant administrators), as well asensuring a consistent approach to the intentions of the Policy and the Manual across allState Government departments and other agencies.Sue RibbonsDirector - Land Use PlanningIn regard to the NSW Planning Review Wal Mills noted that there are also flood risks forproperties which are above flood level, such as isolation due to flooded access roads andloss of electricity, water and sewerage services.Resolved -The report be received.8.3 Gommunications Officer Clr lsaac SmithGirculated ReportWebsite UpdateClr Smith was unable to attend the meeting. His report was presented by the ExecutiveOffìcer.Development of the New FMA Website is currently being undertaken by Summerland WebService. The aim is to have the site ready by mid-December, with all functions available formembers to use.What does the development entail?1 - Complete redesign using the open source Content Management System (CMS),Joomla, which is the world's leading CMS for Not for Profit Organisations -http ://www. ioom la. orq2 - lmprovement in the "look and feel" so it is not like the current one, and seems moremodern and useable.Chairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...26 of 214 March 2012 Ordinary Business PaperPage 88 of 555 of the March 2012 Ordinary Business Papert1

Attacment 8.2.a3 - A redesign of all areas to include the following features:. lnclusion of a public discussion mechanism so members can have their say onissues. This will be in the format of a comment system, not a forum. This will provide amore structured and public discussion.. Newsletter emailed from and linked back to website. This will replace emailed worddocuments.. Latest news and floodplain information. Case studies/project. lnfo on Agencies and Key contacts (including history of acronyms). BOM info reports (McKay update etc.). Funding news. links to relevant national and international groups. Current and past conferences (including all available documents). Committee information (includes papers, meeting info)4. The site will be hosted on a fast and secure Australian Server based in Brisbane.The aim of the redevelopment is to create a useable space for flood managementprofessionals who want current information with the ability to see examples of best practiceprojects and opportunities to network with others in floodplain management.There will be time for members to feedback and "break in" the new site in late December,early January. I hope that it will excite members and provide a fantastic resource forFloodplain professionals across Australia.lsaac SmithCommu nications OfficerResolved -The report be received.Item 9 REPORTS from CONFERENCE HOSTS9.1 Report from Eurobodalla,2012 ConferenceThe Executive Officer provided a progress report.The Call for Abstract was very successful with a record number, 64, being received. Thereview panel had an extremely difficult task selecting the 42 which could be accommodatedin the program. Most abstracts were of very high standard, and it is unfortunate that morecould not be accepted. Thank you to all who contributed.Duncan Mcluckie provided an update on the pre-conference workshops.The conference has been promoted at the Emergency Management and BusinessContinuity Summit, the Queensland and NSW Coastal Conferences and through weekly e-advertising in CareeSpot, GreenCarer and WaterCarer.Almost all sponsorship opportunities and trade exhibition sites have been taken up and at21 November 22 registrations had been received.Delegates were reminded of theChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Offrcer27 of 214 March 2012 Ordinary Business PaperPage 89 of 555 of the March 2012 Ordinary Business Paperl8

Attacment 8.2.aDecember 9 closing date for the early registration discount, and the need for membership tobe current to receive the members'discount.Resolved -The report be received.9.2 Report from Tweed, 2013 National ConferenceDanny Rose provided a progress report. lnitial planning is proceeding well, and the TwinTowns Resort at Tweed Heads has been reserved for the venue. Tenders for theconference management services are presently being assessed.Mr Rose requested any members who have interstate colleagues to provide him withcontact details.Resolved -The report be received.Item 10 AGENCY REPORTS10.1 Office of Environment and HeritageDuncan Mcluckie commented on the Natural Disaster lnsurance Review, and concernsthat there is no standard definition of overland flooding. He advised that this is presentlyappropriately covered by stormwater definitions in most insurance policies.The NSW Flood Database Project is currently being refined, and comments will be soughtfrom the review group which includes the FMA. The project is specifically referenced in thestate plan NSW 2021.Satisfactory progress is being made on the National Flood Manual and Visual Levee AuditMethodology project.Mr Mcluckie advised that a draft revised Temporary Barrier Guideline has been preparedto provide more clarity. lt is now has to go through internal review processes.Steven Molino commented on the 3 manuals covering appropriate building and subdivisiondesigns and planning considerations for the Hawkesbury catchment stating that they couldnot be easily found on government websites. Carolyn Davies advised that they will be madeavailable on the OEH website.Mike Sharpin provided a progress report on the internal review of the flood program. Thereview is to consider the appropriateness, effectiveness and efficiency of the flood programand its delivery. A productive meeting had been held with the FMA at the issues stage.Overall there is no justifìcation for large scale change of the flood program. The focus willbe on improving targeting of resources, improving data management, and more integratedknowledge of where of where flood risks are. For instance at present it is not possible toreport on how many properties have benefitted from investment from the flood program.An action from the review will be some form of rolling program for the preparation of floodrisk management plans, and their implementation.Chairman...Delegates ReportsFloodplain Management Association Meetings.............Executive Officer...28 of 214 March 2012 Ordinary Business PaperPage 90 of 555 of the March 2012 Ordinary Business Papert9

Attacment 8.2.aIt is proposed have another meeting with the FMA before Christmas, and to report on thereview findings and recommendations at the FMA Conference.Garolyn Davies advised that in response to the skills shortage across councils and theNSW Government in the floodplain management area OEH will be engaging a consultant toundertake a skills audit. The FMA will be invited to provide input.The audit will identify skills available now, and needs for the future. The audit is planned tobe complete in March.Clr Ezzy commented that in regard to the proposed introduction of a rolling funding programthis is an issue which the FMA has been pursuing for a number of years and OEH is to becongratulated on this undertaking.Resolved -The report be received.10.2 State Emergency ServiceSimon Opper was unavailable to attend due to operational priorities resulting from floodingin northern NSW.10.3 Bureau of MeterologyCirculated ReportNSW River Gauging NetworkThere is currently a review of a number of the activities related to the river gauging networkcurrently operated by the NSW Office of Water (NOW). NOW manages most of the realtime river gauges outside the tidal limit in NSW. A number of agencies contribute to theoperation of this network including State Water Corporation which through its water chargesto irrigators funds about 50% of the real time network (or some 35% of the overall network)as it uses this data for its river and dam operations.There is reportedly a push that State Water Corporation take over these hydrometricactivities of NOW.Data from the NOW network underpins most of the flood warning services provided by theBureau for NSW. The Bureau relies heavily on NOW's technical expertise, support andsystems to provide it with real time data via its FTP link. The Bureau is concerned over thelong term operation of this network with respect to priorities afforded by a water supplyutility to the other 50% of the real time network, which is of no direct concern to them, aswell as their capacity to operate a sophisticated realtime data collection and managementsystem.I presented a paper on this issue to the 2005 FMA Conference at Narooma (see Appendix5)Seasonal OutlookThe outlook for November 2O11 to January 2012 is that a wetter than average season islikely for large parts or northern, eastern and southwest Australia. The figures belowChairman....Delegates ReportsFloodplain Management Association Meetings... ... . ......Executive Officer...29 of 214 March 2012 Ordinary Business PaperPage 91 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.acompare this year's rainfall outlook with last year's. The rainfall outlook for NSW is verysimilar to last year, however, conditions in the Pacific Ocean have just reached La Niñathresholds and forecasts are for it to be a weak to moderate event. At the same time lastyear the La Niña was already at near record levels. A stronger system generally enhancesthe chance of high rainfall.The July to September rainfall in NSW has also been considerably less than last year -which also reflects the climatic conditions.Will there be major flooding in NSW?Obviously there is a higher risk of major flooding during a wetter than average season.However it is not possible to predict the nature or location of floods based upon theseasonal outlook. For example, last year's rainfall outlook for north-west Victoria was for a60% chance of above median rain and they got record rainfall and some record majorfloods in that part of the state. Similarly in NSW, the Gwydir Valley in northern NSW wasthe only major river in the Murray Darling Basin to receive no flood warnings last year,despite the strong 75o/o chance of above median rainfall prediction.Gordon McKayRegional Hydrology ManagerMr McKay's powerpoint presentation is at Appendix 6.Discussion followed on the NSW River Gauging Network.Resolved -1.The report be received.2. The FMA write to the New South Wales Office of Water (NOW) to ask thestatus of River Gauge management and funding.Chairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer...30 of 214 March 2012 Ordinary Business PaperPage 92 of 555 of the March 2012 Ordinary Business Paper21

Attacment 8.2.aÇh*ru+ cl gcsorJ¡rq rh6 fü6dtan Baintalhlo\r€nÈ€r S01 1 to Jarrmry 201?Pródl¡lÌ ¿{ tlrÊ l{åtunâl G}fiêt€ (hrllÉ1Ìrlilñ'HsEr.!aù íil2|'údt 4ù ÍMðl t. rorásì B!ã d&ld*#llun¿r¡ ¡f lfutsnl¡q)7Gr;ë%rû*80f¡æT"Ohance o! erceedngthe medran RÄinlatllccËrribä 201 0 tr).tärã¡-art ÊS !1Pæíirc? dl ttú ñlàlifi1d Ç&lìdË sãitÈh¡rjiFc.t¡h.F.fiItem 11 FMA SURVEYFlood Definition / Categorisation and s149 Planning Certificate MessagesVic Tysoe from Gosford Council provided a presentation on the outcomes of the surveywhich was undertaken on behalf of the FMA. The presentation is at Appendix 7.Chairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...31 of 214 March 2012 Ordinary Business PaperPage 93 of 555 of the March 2012 Ordinary Business Paper22

Attacment 8.2.aMr Tysoe advised that he would welcome comments or questions concerning the survey.The Chairman acknowledged the significant effort involved in undertaking the study, andthe valuable assistance the information provides to members.Item l2 ITEMS LISTED FOR DISCUSSION BY MEMBERSNo business was listed.Item 13 GENERAL BUSINESSSteven Molino advised that he has been working with Newcastle City Council on its citywide flood risk management study and plan. He had been seeking information on criticalinfrastructure which is held by SES for emergency management purposes, but it is not clearif this information is able to be released for use in flood studies. He has been seekingclarification from the Land and Property lnformation Authority. Duncan Mcluckie advisedthat OEH will pursue the issue.Allan Gear advised that he was involved with judging the recent Excellence in PlanningAwards, and he encouraged members with floodplain management elements in their plansto enter the competition next year.He also advised that the Planning lnstitute of Australia (PlA) wishes to be an industrysupporter for the 2012 and 2013 FMA Conferences.Item 14 NEXT MEETINGThe next scheduled meetings are the February Quarterly Meeting and the Annual GeneralMeeting to be held on 23 February,2012 at the 52nd Floodplain Management AssociationConference at Bateman's Bay.The meeting closed at 1 :1Opm.List of AppendicesAppendix I Minutes August Quarterly Meeting -lssued 5 October - available from EOAppendix 2 Reforming flood insurance - A proposal to improve availability and transparency -available from EOAppendix 3 Government Response to the NDIR Recommendations - available from EOAppendix 4 FMA Submission to the NSW Planning Review - available from EOAppendix 5 BoM 2005 Conference Paper - available from EOAppendix 6 BoM 24 November 2011 Report - provided separatelyAppendix 7 Flood Definition Survey- available from EOAppendix 8 Attendance and ApologiesAppendix 9 Workshop -Floods and Social Media- provided separatelyChairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer32 of 214 March 2012 Ordinary Business PaperPage 94 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAppendix 9ATTENDANCE\IN MANAGEMENT ASSQUARTERLY MEETING24 t 11 t2011ffi,.,szoL--NAME ORGANISATION FULLDELEGATESMEMBERBala Sudarson Auburn City Council 1 1Cherie Blackburn Bankstown City Council 2 1Darren Sturgiss Bathurst Council 3 1John Molteno Blacktown City Council 4 1Gordon McKayBureau of MeterologyMaria Pinto Camden Council 5 1Gamini Hattotuwa Campbelltown City Council 6 1Austin Morris City of Ryde 7 1Clr lan Dinham Clarence Valley Council 8 1Nilmini De Silva Fairfield City Council I 1Glenn EvansDaniel ManolacheFMAFM GlobalVic Tysoe Gosford City Council 10 1Phillip Pleffer Hawkesbury City Council 11 1Pam Colman Holroyd Council 12 3Mark Evens Holroyd Council 12Allan Ezzy Holroyd Council 12Dean Chapman Hunter-Central Rivers CMA 13 1Stephen Leeslndividual MemberChairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer33 of 214 March 2012 Ordinary Business PaperPage 95 of 555 of the March 2012 Ordinary Business Paper24

Attacment 8.2.aNAME ORGANISATION FULLDELEGATESMEMBERWal Millslndividual MemberPeter Harle Liverpool City Council 11 2Jeff Organ Liverpool City Council 12Arch Humphrey Maitland City Council 13 1Steven MolinoCarolyn DaviesLara DavisDuncan McluckieMike SharpinMolino StewartOEHOEHOEHOEHPaul Hackney Parramatta Council 14 1Ratnam Thilliyar Penrith City Council 15 2Adam Wilkinson Penrith City Council 15Janell Keegan Pittwater Council 16 2Sue Ribbons Pittwater Council 16Terry Kefalianos Randwick Council 17 1MichaelWood Richmond River County Cl 18 1Larry Bolitho The Hills Shire Council 18 2Allan Gear The Hills Shire Council 18Danny Rose Tweed Shire Council 19 1Lindsay Tanner Wagga Wagga City Council 20 1Peter Garland Wollongong City Council 21 1Alam Shah Wyong Shire Council 22 1Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer34 of 214 March 2012 Ordinary Business PaperPage 96 of 555 of the March 2012 Ordinary Business Paper25

Attacment 8.2.a22Full Members in attendance 31 Delegates in attendance2 Associate/ Corporate Members in attendance2 lndividual Members Total attendance 41Glenn MounserJeff BaldockMalikeh MichelsPeter JenningsAllan BrownNorm LehehanBetty GreenGreg Joneslsaac SmithBen BecarriDavíd GibbinsSimon OpperJohn CarseDebbi MillenerBillWheeldonADW JohnsonAlbury City CouncilAuburn City CouncilCessnock City CouncilEurobodalla Shire CouncilEurobodalla Shire CouncilKempsey Shire CouncilLake Macquarie City Council (US Study tour)Lismore City CouncilMinistry of Police and Emergency ServicesNewcastle City CouncilSESSydney Metropolitan CMAWarringah CouncilWentworth CouncilChairman....Delegates ReportsFloodplain Management Association Meetings... .......Executive Officer35 of 214 March 2012 Ordinary Business PaperPage 97 of 555 of the March 2012 Ordinary Business Paper26

Attacment 8.2.aConsultation paperNovember 2011ryæ': #u"r,';'an *'Lt-t"*?"s\ *¿#.¿dDelegates ReportsFloodplain Management Association Meetings36 of 214 March 2012 Ordinary Business PaperPage 98 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a@ Commonwealth of Australia 2011978-0-642-74763-LThis publication is available for your use under a Creative Commons Attribution 3.0 Australia licence,with the exception of the Commonwealth Coat of Arms, the image of the Hon Bill Shorten MPAssistant Treasurer in the foreword, 'Distribution of residential property flood risk by State' Table onpage 7 ,'Distribution of flood risk in Australia and estimated flood premium' Table on page 8, and theIAG submission to the Natural Disaster lnsurance Review (footnote 4). The full licence terms areavailable from http://creativecommons.org/licenses/by/3.0/au/legalcode.Creative Commons licenceWith the exception of the Coat of Arms (see below), the image of the Hon BillShorten MP AssistantTreasurer in the foreword, Table Distribution of residential property flood risk by State table on page7, Table Distribution of flood risk in Australia and estimated flood premium on page 8, and the IAGsubmission to the NDI Review (footnote 4). This publication is licensed under a Creative CommonsAttribution 3.0 Australia Licence.Use of Treasury material under a Creative Commons Attr¡bution 3.0 Australia licence requires you toattribute the work (but not in any way that suggests that the Treasury endorses you or your use ofthe work).Treasury moterial used'as supplied'Provided you have not modified or transformed Treasury material in any way including, for example,by changing the Treasury text; calculating percentage changes; graphing or charting data; or derivingnew statistics from published Treasury statistics - then Treasury prefers the following attribution:Source: The Austrolion Government the Treasury.Derivative materiallf you have modified or transformed Treasury material, or derived new material from those of theTreasury in any way, then Treasury prefers the following attribution:Bosed on The Austrolian Government the Treosury doto.Use of the Coat of ArmsThe terms under which the Coat of Arms can be used are set out on the lt's an Honour website (seewww. itsa n honou r.gov.a u)Other Useslnquiries regarding this licence and any other use of this document are welcome at:ManagerCommunicationsThe TreasuryLangton Crescent Parkes ACT 2600Email : medialiaison@treasury.gov.auDelegates ReportsFloodplain Management Association Meetings37 of 214 March 2012 Ordinary Business PaperPage 99 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aCorusulrATroN PnocrssRequest for feedback and commentsThe Government is seeking your feedback and comments on the proposal outlined in thisconsultation paper requiring all insurers to offer flood cover in home building and home contentsinsurance policies, while allowing consumers to 'opt out' of flood cover.The meaning of flood used in this paper is consistent with the definition proposed in theconsultation paper 'Reforming flood insurance: Clearing the waters', namely:'Flood means the covering of normally dry land by water that has escaped or been releasedfrom the normal confines of:(a) any lake, or any river, creek or other natural water course, whether or not altered ormodified; or(b) any reservoir, canal or dam'.1This proposal is part of a package of measures aimed at improving the availability and transparencyof flood insurance. Other proposals that form part of this package are the flood risk informationportal, the Key Facts Sheet and the standard definition of flood.While submissions may be lodged electronically or by post, electronic lodgement is preferred. Foraccessibility reasons, please email responses in a Word or RTF format. An additional PDF version mayalso be submitted.All information (including name and address details) contained in submissions will be made availableto the public on the Treasury website, unless you indicate that you would like all or part of yoursubmission to remain in confidence. Automatically generated confidentiality statements in emails donot suffice for this purpose. Respondents who would like part of their submission to remain inconfidence should provide this information marked as such in a separate attachment. A requestmade under the Freedom of lnformation Act L982 (Commonwealth) for a submission marked'confidential'to be made available will be determined in accordance with that Act.Closing date for submissions: 30 March 2OL2Mail:Email:The General ManagerFinancial System DivisionThe TreasuryLangton CrescentPARKES ACT 2600floodinsurance@treasury,gov.auEnquiries: Enquiries can be initially directed to Kanwaljit Kaur, phone 02 6263 37t7 orCaroline Walker, phone 02 6263 38861 Department of the Treasury 'Reforming flood insurance: Clearing the waters', 2011.http://www.treasu ry. gov. au/documents/1995/PDF/Reformi n g_f lood-insu rance. pdfPage iiiDelegates ReportsFloodplain Management Association Meetings38 of 214 March 2012 Ordinary Business PaperPage 100 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aDelegates ReportsFloodplain Management Association Meetings39 of 214 March 2012 Ordinary Business PaperPage 101 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aCorur¡rursCoNsuLTATloN PRocEss.... ..........,.......,111FoREWoRD...............,..,..VilBAcKGRoUND .,..........,....' 1THE PRoposAt ANDTHE OBJECIVE5,.. ............,,.......... 3coNsurrATroN QuEsüoNs ................... 5Operation of the proposal in practice. ......................5lncreasing the awareness of flood risk and flood cover ........,......... 5lncreasing the avaíÌability of flood insurance .......'.." 7lndustry capacity to underwrite f1ood.,..,....,... ".".'. 10Changes neededto lnsurance ContractsAct 1984...............'........t2Which assets should be covered by the proposed bpt out' regime?.. ................ 13Delegates ReportsFloodplain Management Association Meetings40 of 214 March 2012 Ordinary Business PaperPage 102 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aDelegates ReportsFloodplain Management Association Meetings41 of 214 March 2012 Ordinary Business PaperPage 103 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFone wonoAs a new Assistant Treasurer, last summer I asked myself: why does it takedisaster to so consistently bring out the best in our nation?ln this great continent that we call home we are witness to the physics andchemistry of mother nature working their way across Australia in a waythat makes you question that famous tag, 'lucky', attached to our country.But if we remain strong and resolute in the way that we pull togetherperhaps 'lucky' is still the best way to think, despite all that brutal water,wind and fire, ln doing this though we should of course never take ourcommunal good fortune for granted.Perhaps in some unexpected, unsought and undesired way natural disasters do tend to help us inAustralia to rediscover and remind us of our greatest strengths.Australia rallied following the series of devastating storms, floods and cyclones in late 2010 and early2011. But knowing system improvements were needed on 4 March the Australian Governmentcommissioned the Natural Disaster lnsurance Review (NDIR), an independent review of issuesrelating to natural disaster insurance in Australia. The Government has now released the final reportof the NDIR and its response to that Review.The Government is proposing a series of measures responding to the report's recommendations.The Government will provide a single access point to existing flood mapping data-a portal to behosted by Geoscience Australia. The portal will be complemented by the development of nationalguidelines that will cover the collection, comparability and reporting of flood risk information. Theportal will provide a central point through which consumers and other interested parties will be ableto obtain information about flood risk. lt is intended that this initiative will, over time, result in anationally consistent and improved understanding of flood risk in Australia for purposes such as landuse planning, emergency management, mitigation, insurance and public education. Specifically, itwill facilitate insurers providing flood cover.The Review made a number of recommendations for changes to the General lnsurance Code ofPractice to improve insurers' handling of claims and disputes relating to natural disasters. TheGovernment has commenced discussions with the industry on the merits of implementing thesechanges and has asked the industry to provide its views to the Government by the end ofFebruary 2012.Through this consultation paper, the Government is seeking submissions on a proposal requiring allinsurers to offer flood cover in home building and home contents insurance policies, while allowingconsumers to 'opt out' of flood cover. This proposal means that consumers would always have theoption of flood cover available to them, regardless of which insurer they choose, and would need tomake a conscious choice about whether or not to purchase flood cover. The Government is seekingviews from stakeholders as to whether this proposal could improve the availability and transparencyof flood insurance and, ultimately, flood insurance penetration. The Government is also seeking tounderstand what costs are associated with implementing the proposal.Page viiDelegates ReportsFloodplain Management Association Meetings42 of 214 March 2012 Ordinary Business PaperPage 104 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThe intention of the proposal is for consumers to confront the flood risk they face by way ofinsurance premiums, and to be provided with information which they can use to make a consideredchoice about whether to purchase flood insurance. This consultation paper seeks to identify issueswith the proposal and invites feedback from all stakeholders. The feedback provided will be used toinform the Government's considerations of this proposal.This proposal would also complement several other recently announced measures aimed atincreasing consumer awareness about flood risk and insurance in order to ass¡st consumers to makeinformed decisions about how to manage their flood risk. These include a standard definition offlood and a one-page Key Facts Sheet. These measures have already been consulted on.The Government has announced that it will introduce a standard definition of 'flood' which allinsurers will be required to use if they offer flood cover to consumers in home building and homecontents insurance policies, in a defined class of small business insurance policies, and in strata titleinsurance policies. Draft regulations, setting out a standard definition consistent with the formproposed in the 'Clearing the waters' consultation paper, will be released for consultation before theend ofthe year.The Government will also require insurers to provide their customers with a Key Facts Sheet for allhome building and home contents insurance policies. This will clearly set out, in a single page, all keyinformation about the features of the policy. The Key Facts Sheet will complement the existingProduct Disclosure Statement regime and was endorsed by the Review.A further consultation will occur in 2072 on the recommendations in the Review's final reportrelating to the introduction of a system of premium discounts and reinsurance, once further designwork has been undertaken.It was without doubt a very Australian Christmas break last summer, albeit one to break the heart.We are warned in our national verse of the droughts and flooding rains, the far horizons and thebeauty and terror which make up our national story. Yet it is comforting, in an odd way, when werecognise that a terrible beauty is born too. Australians were there for their friends and for strangersduring all the anxiety many risked-their lives for the property and lives of others.So in reaffirming this communitarian spirit nearly a year after the storms, I encourage allstakeholders to engage in the Government consultation processes, including by making a submissionin relation to the substantial proposals outlined in this paper.The Hon BillShorten MPAssistant Treasurer and Minister for Financial Services and SuperannuationPage viiiDelegates ReportsFloodplain Management Association Meetings43 of 214 March 2012 Ordinary Business PaperPage 105 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBRcrc nou ru oFollowing the flooding that occurred in many regions of Australia in late 2010 and early 2011, itbecame apparent that many policyholders did not have flood cover or had cover which only partiallycovered flood. Of these policyholders, many were unaware of this fact until making a claim. Asignificant proportion argued that they would have purchased a policy which included flood cover, ifthey had been aware that they were not covered.For most natural disasters other than flood, insurance cover has been widely available in Australiafor many years. This includes cover for storm damage, including related water damage. Thedistinction between water damage caused by storm and water damage caused by flood is confusingto many and has resulted in considerable distress and financial loss for those impacted by flood butwithout flood cover. This is particularly the case when policyholders only find out they do not haveflood cover once their claim has been denied.To address the issues of flood coverage, the Natural Disaster lnsurance Review considered severaloptions to increase the availability and affordability of flood insurance, one of which was to requireall insurers to offer cover for flood, but with consumers being able to 'opt out' of this cover. TheReview did not recommend this option, but noted that it would increase consumer awareness aboutwhether their policies cover flood and that it may lead to some increase in the take-up of floodinsurance.2The Government has decided to consult at this time on the proposal because it would contribute togreater consumer awareness of flood risk and flood cover, and for a large proportion of householdswith low flood risk, it may contribute to increased rates of coverage for flood. Nevertheless, theremay be costs and unintended consequences associated with this proposal which the Governmentwishes to fully understand before deciding on whether or not to progress this option.The proposal requiring all insurers to offer flood cover in home building and home contentsinsurance policies, while allowing consumers to 'opt out' of flood cover, complements theGovernment's Key Facts Sheet and would ensure that consumers are aware of whether or not theirpolicy includes cover for flood. The proposal also complements the initiative to introduce a standarddefinition for flood because all insurers would be required to offer flood cover which is consistentlydefined.2 Natural Disaster lnsurance Review lssues Paper, pp 9-11.http://www.ndir.gov.au/content/issuespapers/NDl RlssuesPaper.pdfPage 1.Delegates ReportsFloodplain Management Association Meetings44 of 214 March 2012 Ordinary Business PaperPage 106 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aDelegates ReportsFloodplain Management Association Meetings45 of 214 March 2012 Ordinary Business PaperPage 107 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aTue PnoPosAL AND THE OgrrcrtvrsThe proposalThe proposal for consultation is that all insurers be required to offer flood cover in home buildingand home contents insurance policies, based on a standard definition of flood. However, insurerswould be able to choose whether to give consumers the option to 'opt out' of flood cover.Specifically, some insurers may choose to allow consumers to 'opt out' of flood, while others maysimply offer insurance which always includes flood cover. Where consumers with a flood risk aregiven the option to 'opt out' of flood cover, insurers must inform those consumers that they have aflood risk.This would ensure that all consumers are given the option of purchasing flood cover at the point ofsale and renewal.The objectivesThe proposal has been designed to meet two key objectives:. to increase the availability of flood insurance by requiring insurers to offer flood coverin all home building and home contents insurance policies; and. to focus consumer awareness on flood risk and whether their policy provides floodcover,Achieving these objectives may lead to increased flood insurance penetration in the market,particularly for those at low to moderate risk of flood.DiscussionThe 2010-11floods highlight several issues with the provision of flood insurance in Australia. Firstly,there are varied definitions of flood used by insurers, which has made it difficult for consumers tocompare policies and understand exactly what cover for water damage is extended to them undertheir policy. Secondly, not all insurers provide full flood cover (for example, policies may specificallyexclude flood damage or flood claims may be subject to sub-limits). Thirdly, where flood cover isexcluded or limited, consumers may be unaware of this.This proposal is being considered as part of a package of measures aimed at addressing the aboveconcerns to resolve issues around the availability and transparency of flood insurance. The otherproposals that form part of this package are the flood mapping data portal, the Key Facts Sheet andstandard definition of flood.Requiring all insurers to offer home building and home contents insurance policies which includeflood cover would ensure that flood cover is universally available in all policies. Currently, insurersare able to exclude flood cover so long as they clearly inform the consumer of the exclusion inwriting in the Product Disclosure Statement.Page 3Delegates ReportsFloodplain Management Association Meetings46 of 214 March 2012 Ordinary Business PaperPage 108 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRequiring consumers to 'opt out' of cover rather than 'opt in' is preferred, as it forces consumers toconfront their flood risk and explicitly make a choice about whether to purchase flood cover at everyinsurance purchase and renewal. lt would therefore ensure that all consumers are aware on anongoing basis about the flood coverage extended to them under their insurance policies, and thatthey potentially face a flood risk.Roughly 93 per cent of Australian households have no flood risk. Under the proposal, it is anticipatedthat insurers would automatically cover these households for flood. lf these households wereoffered the option of 'opting out' of flood cover, ¡t is expected most would not do so.For the remaining 7 per cent of homes which are subject to flood risk, there would be higherpremiums if flood cover is provided. The flood risk premium for the majority of these homes is likelyto be modest and most would be expected to take up flood cover. For the 2 per cent of homes athigh and extreme risk of flooding, flood risk premiums are likely to be significant and this is expectedto impede the take up of flood cover.For high and extreme flood risk homes, various mitigation and adaptation measures may be a morecost effective method of managing risk than insurance.The following issues associated with this proposal will be explored in further detail in thisconsultation paper and the views of stakeholders will be sought to assist the Government indetermining whether this proposal would meet the objectives of increased flood insuranceavailability and transparency for consumers:. likely increases in awareness (or transparency) about flood cover;. likely increases in the availability of flood insurance;. likely increases in the take-up of flood insurance, including as a result of increasingawareness about flood risk and flood cover, and availability of flood insurance;. industry capacity to underwrite flood risk;. the cost to the insurance industry, and ultimately consumers, of implement¡ng theproposal;. what an appropriate transitional period should be for such a proposal to be introduced;. the nature of amendments required to relevant legislation;. what assets should be covered; and. appropriate sub-limits and/or excesses associated with policies providing flood cover.The Government will release another consultation paper on the Natural Disaster lnsurance Review'sproposal for a flood reinsurance pool and system of discounts, once consultation on this proposalhas been completed (this w¡ll be in 20L2).Page 4Delegates ReportsFloodplain Management Association Meetings47 of 214 March 2012 Ordinary Business PaperPage 109 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aCol¡su LTATI oN Qu rsro rusOprRRlolrl oF THr pRoposAl tN pRACTtcEAs previously stated, the proposal would require all insurers to include flood cover in home buildingand home contents policies which they offer to consumers. lncluding flood cover in these policieswould be achieved through quoting a price for cover, inclusive of flood, at the initial point of saleand renewal.This proposal is different from current practices, whereby insurers are not required to include floodcover in their policies so long as the exclusion is clearly stated in the Product Disclosure Statement.ln addition, flood would be defined consistently across all policies, being based on a standarddefínition of flood, for example, taking the form proposed in the consultation paper 'Reformingflood insurance: Clearing the waters':'Flood means the covering of normally dry land by water that has escaped or been releasedfrom the normal confines of:(a) any lake, or any river, creek or other natural water course, whether or not altered ormodified; or(b) any reservoir, canal or dam'.3While the proposal would require insurers to offer flood cover in all home building and homecontents policies, insurers would be able to choose whether to give consumers the option to 'optout' of flood cover. lf insurers chose to give consumers the option of opting out of flood cover, theway in which this would occur would be at the discretion of the insurer, provided that there is aninitial offer of insurance which includes flood cover. For example, insurers might:. initially provide two quotes to consumers, one inclusive of flood cover and oneexclusive of flood cover; or. provide one quote to consumers inclusive of flood cover, and require that the consumercontact the insurer for an additional quote without flood cover if they so choose.As long as insurers provide consumers with the option of purchasing flood cover at the initial pointof sale or renewal, they would comply with the requirements of the proposal. For example, insurerswho include flood cover in their home building and home contents policies but do not giveconsumers the option of 'opting out' would comply.Where consumers with a flood risk are given the option of 'opting out' of flood cover, insurers wouldalso be required to inform those consumers that they have a flood risk. For example, for internetquotes of insurance a statement could be presented along the lines of:3 Department of the Treasury 'Reforming flood insurance: Clearing the waters', 201.1.http://www.treasu ry.gov.au/docum ents/1995/PDF/Reformi n g-f lood-insurance. pdfPage 5Delegates ReportsFloodplain Management Association Meetings48 of 214 March 2012 Ordinary Business PaperPage 110 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a'your home has been ossessed as hoving a flood risk. We hove outomatìcally included floodcover in your quote. tf you would like to exclude flood cover, you csn do so by selecting thequote without flood cover/contocting us on ...'A circumstance in which an insurer would not comply with the requirements of the proposal wouldbe where it offered a quote for insurance which did not include flood cover but gave the consumerthe option to contact the insurer in order to get a quote for insurance with flood cover. Thiscircumstance would require the consumer to 'opt in', rather than 'opt out'.QuestionsWhot other ways could insurers implement the proposal?What other woys could ínsurers inform consumers about flood risk? How could this beimplemented?Whot might be the most eÍfective way for insurers to implement the proposol in terms of engogíngconsumers in electing to toke insurance with or without flood?How could the proposal to inform consumers oÍ their Ílood risk be implemented?lrucnr¡sn¡e rHE AWARENESS oF FLooD RtsK AND FLooD covERRequiring all insurers to offer flood cover and consumers to explicitly 'opt out' of coverage each yearmay result in many policyholders purchasing flood cover where previously they were unaware thattheir policies did not cover flood.Furthermore, requiring consumers to explicitly 'opt out' would force consumers to confront thatthey are subject to flood risk each time they purchase or renew their insurance.The Government understands that flood risk information is increasingly becoming available toconsumers, with several State and local governments implementing measures to make flood riskinformation publicly available. For example, the Brisbane City Council in 2008 released its flood riskinformation which is accessible by consumers on their website. Similarly, the lpswich City Councilrecently published similar flood maps on its website indicating the flood level of both the 2011 and1974 floods.The Government's initiative to provide a single access point to existing flood mapping data- aportal to be hosted by Geoscience Australia-will enable consumers and other interested part¡es toobtain information about flood risk. The portal will be complemented by the development ofnational guidelines that will cover the collection, comparability and reporting of flood riskinformation. These measures will serve to improve access to available data and lead to a moreconsistent approach to data collection across the nation.Page 6Delegates ReportsFloodplain Management Association Meetings49 of 214 March 2012 Ordinary Business PaperPage 111 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aQuestionsWhat henefits ore there in ofiering flood cover to oll consumers with on 'opt out' option? Whotbenefits øre there in using insuronce premiums to provide on indication of flood risk to consumers?Whot inÍormation would consumers require to moke reosonoble decisions os to whether or not to'opt out' of flood cover? ts this information reodily available? Are consumers able to odequatelyøssess thís informotion?What initíatives would be reguired with respect to consumer educotíon and financîal literacy toassist consumers to moke oppropriote decisions with respect to'opting out' of flood cover?lrucRrRslrue rHE AVAILABILtry oF FLooD tNsuRANcEThe lnsurance Council of Australia suggests the number of at-risk residential addresses, on a state bystate basis, is as set out in the table below. Clearly properties in every state in Australia have someexposure to flood risk. Awareness of flood risk will better equip property owners to take measuresto mitigate that risk, including assessing their insurance needs.Distribution of residential property flood risk by StateI'lood RiskIlxtremeRcturn Period (yean)>l:2Olliglt1:20- 1:50NSWQLD***VICSAWA68,9138,7943,86024,92918,610TAS8915** Only data for Brisbane, Gold and several have been provided to lCA, QLD data isunder-quoted modelling suggests that this is 60 per cent7O per cent of exposed addresses.Source: lnsurance-Council of Australia submission to the Natural Disaster lnsurance Review, p8.s,75?78712416,87417,9124,2977,8481713,86051,50610,23949,57610,0004.100By increasing the availability of flood insurance, it is envisaged there could be increased take-up byconsumers. For the 93 per cent of homes which are subject to no flood risk, the increase in take-upof flood insurance should be near universal as insurers would not need to collect additional premiumto cover the risk.For the remaining 7 per cent of existing homes who do face some flood risk, rates of take-up arelikely to differ according to risk and the corresponding premium required to cover the risk. Thefollowing table illustrates the distribution of flood risk across Australia and estimates premiums forflood cover for home buildings. The premiums in the table are a conservative estimation of the costof flood premiums, calculated simply as a product of the average claim size and probability offlooding. They do not include state taxes or take into account the distribution of costs at differentflood levels, nor are they inclusive of contents.Page 7Delegates ReportsFloodplain Management Association Meetings50 of 214 March 2012 Ordinary Business PaperPage 112 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aDistr¡bution of flood risk in Australia and estimated flood premiumRiskBandFre_quency ofllnôdinø(ARr)Number ofpropertiesNumber ofproperties ar Probability of Averagepercentage of flooding pa claim size ($)totalrFlood riskpremium ($)Annual cost offlood f5mlNo floodrisk6,774,9t29332%Greater than7II276,2774.18%o.19%40,242Total low111 to 105276,2773,509o.o5%o.79%o.93%40,24240,849378I105 to 1003,081o.o5%o.98%40,8953991100 to 6725,2920.38%r.25%40,5445071357 to 5018,483o.28%I.75%41,47572613Totalmedium50,366o.76%r.39%40,928 57250 to 40t4,092o.2r%2.25%42,3339521340 to 3312,r490.18%2.75%43,2691,190L433 to 298,150o.t2%3.25%43,557I,416T229to 259,373o.r4%3.75%43,979r,6491525to 228,073o.t2%4.25%45,ZZOr,92276TZto 206,0r9o.o9%4.75%45,8322,77713Total high43,7367,4438420 to 186,654o.ß%5.25%46,4562,4391618 to 173,610o.o5%5.75%46,5142,67510Extreme17 to 15Less than 157,90539,4100.t2%o.60%6.25%> 6.50%47,55458,8802,9726,77723267Totalextreme57,574 o.87% 9.70% 55,114 316Allflood442,O88 1,018prone*fìgures based on data ffom numbercolumn, total number of properties is assumed aswith no flood r¡sk and all flood proneProperty numbers quoted ¡n this table are conservative and based on 2006 estimates this would need to be adjusted-upwards to account for the number of properties now mapped in each risk band.These are estimates of the r¡sk related price only and do not include other costs that would add to the retail premium such astaxes or brokerage fees.Source: lnsurance Council of Australia submission to the Natural Disaster lnsurance Review, p14 and Treasury calculations.Around 7 per cent of existing Australian properties face some flood risk, with 4 per cent at low risk offlood. The indicative flood risk premium for these households is around 577 per year. Similarly,indicative flood risk premiums for those households at moderate risk of flood are up to 5726 peryear. This proposal could drive a higher rate of take-up among these households, who togethercompr¡se around 74 per cent of all homes with any flood risk.For the remaining approximately 2 per cent of existing homes at high or extreme risk of flooding, it islikely that take-up of flood cover may be lower, For example, an indicative flood risk premium for ahome with a flood risk average recurrence interval (ARl) of less than 1 in 15 years would bearound s6,777 per year.Page IDelegates ReportsFloodplain Management Association Meetings51 of 214 March 2012 Ordinary Business PaperPage 113 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBy way of practical experience, NRMA offers flood cover on an 'opt out' basis for high risk propertiesin NSW. NRMA allows the 2 per cent of its policyholders in high flood risk areas to'opt out'of cover,and has found that the majority do so. This experience suggests that take-up offlood cover under an'opt out' option would be low for those with the highest flood risk.aIt is likely that for the relatively few homes at extreme risk of flood, insurance may not be a viableoptíon for managing their flood risk and that alternative measures such as mitigation, landrepurchases and adaptation strategies would be more effective, noting these strategies are theresponsibility of State, Territory and local governments.Any initial increases in the take up of flood insurance would need to be sustained overtime. There issome evidence to suggest that rates may decline over time, particularly if a number of years passwithout an event. To maintain the home owners' awareness of their flood risk, ¡t is proposed thatthe 'opt out' decision be one which must be made annually.QuestionsTo what extent would insurers olÍering Ílood cover to oll consumers (încluding where on 'opt out'option is provided) inueose the take-up of flood cover? Is it likely that there would be differenttake-up rotes omong groups exposed to different levels of flood risk? Pleose provide reosons.How prevølent would the proctice of offeríng on 'opt-out' option be? For insurers-would youenvisage providing on 'opt-out' option? Why/why not? ll you intend to offer an 'opt out' option,who would you intend to offer it to; for example: any consumer with ony flood risk, or anyconsumer who has a flood risk premíum above a certain value?Would an snnuol decision on 'opt out' maíntain coverage? lf consumers elect to purchase floodcover, should they be provided with on 'opt out' option the following yeor or just offered a renewalof insurance including flood cover?What would be the impact on octual insuronce premiums for the different categories ol flood risk?THe sronvr/FlooD Drsr NCTToNWhile requiring consumers to 'opt out' of flood cover would significantly reduce the confusion overwhether the policyholder had flood cover, in reality many flood events occur in close proximity withstorm events. ln such weather events, there are normally properties which suffer from storm andstormwater runoff damage and properties which suffer flood damage. lt is not uncommon for aproperty to be affected by both floodwater and stormwater runoff.The Government's decision to legislate a standard definition of flood will lessen confusion aboutwhether flooding has occurred because all insurers will use the same definition of flood.However, disputes about whether damage was caused by flood or storm would still exist for thosepolicyholders who do 'opt out' of flood cover, regardless of whether there is a standard definition.Determining the cause of water damage can be difficult when a policy covers storm but not flood. To4 IAG submission to the Natural Disaster lnsurance Reviewhttp://www.ndir.gov.au/content/submissions/issues_paper_submissions/lnsurance_Australia_Group-(lAG).pdfp3Page 9Delegates ReportsFloodplain Management Association Meetings52 of 214 March 2012 Ordinary Business PaperPage 114 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.athe extent that policyholders 'opt out' of flood cover, the disputes which arise with every floodevent about the cause of damage would remain.QuestionsWhat initiotives might ossist to resolve, in a timely fashion, disputes about whether domage hosbeen caused by storm or flood?lruousrnv cApAcrry ro UNDERWRITE FLooDThe lnsurance Council of Australia, in its submission tothe Natural Disaster lnsurance Review, arguesthat there is no market failure regarding flood cover because flood insurance has been widelyavailable for every property in Australia since 2006. However, it has generally only been the largerinsurers with risk appetite and financial capacity, who have invested in underwriting systems toincrease the availability of flood insurance.There are concerns that some insurers may be unable and/or unwilling to provide cover. Requiringall insurers to offer flood cover may result in some companies defensively pricing flood cover orsimply 'redlining' flood prone areas. This could have a negative impact on competition in theinsurance market, at least in areas exposed to flood risk.The problems insurers face in covering flood risk are briefly summarised below'Data RequirementsThe provision of flood insurance requires a more complex data set for underwriting purposes thanmany other natural perils, as flood events tend to affect homes in close proximity to each otherdifferently. For example, during the recent floods there were homes badly affected by flooding butneighbouring properties were not affected at all due to the property or floor level being higher.Therefore, in order to successfully underwrite flood, insurers require property specific data such asthe location of the land on which the property sits, the elevation and curvature of the land, and theexact location and floor height of the property on the land in order to correctly determine the floodrisk. More property specific data may be required compared with other risks such as bushfire,cyclone and earthquake.Flood data is produced by local and State governments, with the quality and availability differingsignificantly between jurisdictions. Some local government areas have highly detailed maps publiclyavailable while others do not have the capacity to produce the data at all.However, many insurers have already invested in the capacity to underwrite flood successfully withthe availability of flood insurance increasing, and the industry continues to invest in the NationalFlood lnformation Database through the lnsurance Council of Australia, which provides flood riskinformation for large parts of Australia.The portal to be hosted by Geoscience Australia, along with the development of national guidelinesthat will cover the collection, comparability and reporting of flood risk information will, over time,result in a nationally consistent and improved understanding of flood risk in Australia for purposesPage 10Delegates ReportsFloodplain Management Association Meetings53 of 214 March 2012 Ordinary Business PaperPage 115 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.asuch as land use planning, emergency management, mitigation, insurance and public education.Specifically, it will facilitate insurers providing flood cover.Systems Costs and lmplicationsEven where accurate flood data is available, underwriting flood cover requires investment in theunderwriting systems which can convert the data into an insurance premium which accuratelyreflects the risk of flood on a property by propeny basis. The insurers who have offered flood coverto date have generally been the larger insurers who have the financial capacity and technicalexpertise required to invest in these systems.The issue for the Government is to what extent (if any) would smaller insurers find it difficult todevelop flood cover offerings.Capital and Financial StrengthGeneral insurers are prudentially regulated by Australian Prudential Regulation Authority (APRA).The key aim of APRA's supervision is to protect the interests of policyholders. APRA is charged withdeveloping and enforcing a robust prudential framework of legislation and prudential standards, andalso issues prudential guidance, that promotes prudent behaviour by the insurance companies itsupervrses.lmplementation of the proposal requiring all general insurers who offer home and content polices toalso offer flood cover could potentially raise prudential issues. To maintain financial strength, it isimportant that insurers implement soundly based pricing for the flood risks they underwrite. Floodcover risks would be dealt with under the existing capital framework and insurers would need tohold capital against their liabilities, including for flood risk, based on appropriate actuarialvaluations.QuestionsWhot particular issues need to be oddressed before all ínsurers could be required to offer floodcover?Whot is the likely impact on overall premiums of system costs?Would insurers need to cross subsidise parts of their business to make this proposol workable? lfso why?Would alfordoble reinsuronce protection be ovailable for all insurers who take on flood risk?Whot foctors would influence whether affordoble reinsurance is ovailable? Would there be onydifference between the ovoilobility of olfordable reinsuronce for large and smoll insurers?Whot other costs might insurers face as a result of the requirement to offer flood cover in all homebuilding ond home contents insurance policies? For example, costs of troining coll centre stafi.How will smaller insurers be affected by this proposal? Are they likely to engage in defensivepricing? Are they likely to exit the market entirely in certain oreas?Page 11Delegates ReportsFloodplain Management Association Meetings54 of 214 March 2012 Ordinary Business PaperPage 116 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aTRRrusrlorrr PERtoDThose insurers which do not currently offer flood cover would need time to build the capacity tooffer flood cover. This includes technical capacity, but could also impact on reinsurancearrangements and prudential capital requirements.The Government proposes that the transition to the new arrangements be two years from thecommencement date of any required legislative change. The two year transitional period will giveinsurers one year to update their systems and pricing formulas such that they are able to price floodcoverage in their insurance policies, and an additional year to transition existing and newpolicyholders into the new arrangements.The Government would like submissions to focus on the interaction of a possible transition periodassociated with this proposaland the keyfacts sheet and the standard definition.Questionsls two years a sulficiently long tronsitional period to enoble insurers to build the underwritingcapacity required to offer flood cover on oll home buildings and home contents ínsurance policies?lf the Government proceeds with implementing the proposed medsure, is there o case for oligningthe commencement date of the tronsitionol period of the proposal meosure with thecommencement date of the Xey Foct Sheet?CHRrue¡s NEEDED To INsURANCE CoNTRAcrs Acr 1984Fhe lnsurance Controcts Act 7984 provides for a 'standard cover' scheme. The effect of the scheme isthat prescribed contracts are required to include insurance for certain types of loss (prescribedevents), and for minimum amounts,Home buildings and home contents policies are prescribed contracts under the scheme. For both ofthese categories, prescribed events include:'storm, tempest, flood, the action of the sea, high water, tsunami, erosion or land slide orsubsidence'The result is that home buildings and home contents policies are required to provide cover for theseprescribed events. However, insurers are able to differtheir policies from standard cover if they canprove that they clearly informed the insured in writ¡ng before the contract was entered into(whether by providing the insured with a document containing the provisions, or the relevantprovisions, of the proposed contract or otherwise) orthe insured otherwise should have known thatthe cover was not included in the contract.lntroduction of the proposal requiring all insurers to offer flood cover in home building and homecontents insurance policies they sell, while allowing consumers to 'opt out' of flood cover at theirdiscretion when they purchase insurance, would require changes to the lnsuronce ContractsAct 7984 and lnsurance Controcts Regulotions 7985. 11 the proposal being consulted on is adopted,insurers would not be able to exclude flood cover from home building and home contents insurancepolicies without the consumer opting to not purchase flood cover.Page L2Delegates ReportsFloodplain Management Association Meetings55 of 214 March 2012 Ordinary Business PaperPage 117 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aWHrcH ASsETS sHouLD BE covERED By rHE pRoposED 'opr our' Rrctn¡¡?The Government is propos¡ng that the 'opt out' regime should apply to all home building and homecontents policies. The Government is not proposing in this consultation that insurers be required tooffer flood cover in small business policies.Detached homes are the most common form of dwelling in Australia, and the insurance market forthese homes is competitive and well served by many insurers offering a diverse range of productswhich are all tailored towards this type of dwelling. Applying 'opt out' to detached homes wouldthus be relatively straightforward and result in the majority of dwellings having the ability to chooseto'opt out'.Home contents policies are quite often sold in conjunction with home building policies. Almost80 per cent of home building policies are combined home and contents policies. lt may therefore bedifficult to apply 'opt out' only to home buildings and not to home contents.QuestionsShould insurers olso be required to offer flood cover in relation to strata title insuronce policies?What issues would this raíse?Su g-r-uv rrs AN D EXCESSESlf 'opt out' is adopted, the question arises over whether insurers should be able to apply specificsub-limits and excesses on flood cover, as they currently do with some other events. Sub-limits andexcesses are forms of co-insurance, whereby the insurer and insured share risk. They are a way toreduce premiums for consumers, but require that the insured meet a portion of costs out of theirown pocket when the insured event occurs.Particularly for the those households at highest risk of flood, whose full flood cover premiums couldreach thousands of dollars, sub-limits and excesses could be a means of ensuring some cover againstflood.However, flexibility on sub-limits and excesses ¡s not w¡thout issues. Depending on the size of anyexcesses and sub-limits, and the financial capacity of the insured to meet these costs, excesses andsub-limits might reduce the capacity of policyholders to recover in the event their property isaffected by flooding. An inappropriate sub-limit or excess for a particular household can thereforebe a cause of underinsurance. Often, consumers may not know how much coverage to seek andwhat would be most suitable for their needs,Consideration would need to be given to the size of excesses and sub-limits for flood within which'opt out' would be meaningful. For example, flood cover with a sub-limit of 5500 per event wouldnot be a meaningful offer for flood cover by an insurer.Page l-3Delegates ReportsFloodplain Management Association Meetings56 of 214 March 2012 Ordinary Business PaperPage 118 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aQuestionsShould insurers hove to oÍfer ltood cover without any flood specific excesses or sub lîmits as anoption for consumers to consider?Shoutd ftood specific excesses be permítted in policies which offer flood cover? lf yes, should therebe a maxìmum permitted excess? If yes, what should it be?Shoutd flood specific sub-limits be permitted in policies which ofier flood cover? ffthere be o minimum permitted sub-limit? lf yes, whot should it be?Shoutd flood specific sub-lîmits and excesses only be allowed for high flood risk properties?Are there ony other issues raised with respect to sub-limits and excesses?yes, shouldPage 14Delegates ReportsFloodplain Management Association Meetings57 of 214 March 2012 Ordinary Business PaperPage 119 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGOVERNMENT'S RESPONSE TO NDIR RECOMMENDATIONSThe Natural Disaster lnsurance Review presented its final report to the Governmenton 30 September 2011. The report makes 47 recommendations in 4 broad areasand the Government's response is set out below.Firsl,27 recommendations relate to mandatory flood insurance and the floodreinsurance pool. The Government considers that adoption of theserecommendations could have potentially significant implications for somehomeowners and for all insurers offering home building insurance, as well asmaterial financial implication for the Commonwealth Government.The Government will, therefore, consult with relevant stakeholders so as to clarifythese implications through a consultation process next year. The Government willconsider these recommendations further in light of these consultations, and theearlier consultations on the proposal to mandate that insurers offer flood cover whileallowing consumers to opt out.Second, 6 recommendations relate to handling of claims and dispute resolution andask the insurance industry to review the General lnsurance Code of Practice. TheGovernment has asked the insurance industry to examine these recommendationsand advise the Government of its response by the end of February.Third, 5 recommendations relate to improving consumer awareness includingrecommendations endorsing the standard definition of flood as set out in the'Reforming flood insurance: Clearing the waters' consultation paper, and inclusionsto the Key Facts Sheet.Finally, the remaining 9 recommendations relate to specific, ad hoc issues.Ghaoter 2: The availabilitv of flood insurance for homesRecommendation 1:That all home building insurance policies includeflood cover.Recommendation 2:That home building and home contentsinsurance should not be made compulsory.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government does not intend to make eitherhome building or home contents insurancecompulsory.Delegates ReportsFloodplain Management Association Meetings58 of 214 March 2012 Ordinary Business PaperPage 120 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGovernment's ResponseRecommendation 3:That in including flood cover in home buildinginsurance policies:a) flood-specific sub-limits not apply; andb) any excess that applies to flood cover becommensurate with that applicable toother insured perils.Early consultation will commence on the issue ofinsurers being required to offer flood cover andconsumers being able to choose whether or notto purchase flood cover. A Consultation Paper isavailable from the Treasury website, andsubmissions are due 30th March 2012This recommendation will be considered as partof this consultation.Ghapter 3: The affordabiliW of flood insurance for homesRecommendation 4:That the following flve principles underpin thedesign of a system of premium discounts:a) premiums should rise with the level offlood risk;b) those whose homes do notface a floodrisk should not pay a flood premium;c) there should be no cross subsidisationof premiums between policyholders;d) there should be some limitations ondiscounts to high-value homes; ande) the discount mechanism should besimple for policyholders and automatedfor insurersThe Government notes that the Reviewrecommends the introduction of flood insurancepremium discounts for home buildings, homeunits and home contents, and that theGovernment guarantee payment of flood claimsfrom a flood reinsurance pool that would providethe mechanism for the delivery of the discounts.The introduction of flood insurance premiumdiscounts would have significant implications forthe provision of home building and homecontents insurance. The Government guaranteeon payment of flood claims would have potentiallysignificant budgetary implications.Given this, the Government will consult withrelevant stakeholders and give furtherconsideration to these recommendatio nsfollowing the consultations.Recommendation 5:That flood premium discounts be provided forhome building insurance for eligible homes:a) the discounts be assessed by reference toan'affordability threshold' for floodpremrums;b) only existing homes would be eligible fordiscounts; andc) discounts would be phased out graduallyover time.Recommendation 6:The levels of the discounts and the phasing outperiods be reviewed from time to time.Recommendation 7:That there be limitations on the size of thediscount available to high-value homes.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the ìntroduction of floodinsurance premium discounts following aconsultation process in 2012.Delegates ReportsFloodplain Management Association Meetings59 of 214 March 2012 Ordinary Business PaperPage 121 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aChapter 4: Flood insurance for other dwellinqsRecommendation 8:That all home unit insurance policies includeflood cover, in the same manner as for homes.Recommendation 9:Thatflood premium discounts be provided, inthe same manner as for homes, to the bodiescorporate of eligible properties, and on the samebasis as for detached homes.Recommendation l0:That the definition of a home for the purposes offlood cover and flood premium discounts be anybuilding for which a homeowner purchases ahome insurance policy.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.This definition ensures that the Review Panel'srecommendations would apply to all 'nonstandard'types of homes such as manufacturedhomes and mobile homes insured under a homebuildings insurance policy.Ghaoter 5: Flood insurance for home contentsRecommendation I 1:That all home contents insurance policiesinclude flood cover.Recommendation l2:That discounts be provided, in the same manneras for homes, to home contents insurancepolicies for eligible properties.Chaoter 6: Flood insurance for small businessRecommendation l3:That all insurers offering small businessinsurance be obliged to include flood cover onan opt-out basis, instead of an opt-in/opt-outbasis as at present, in all of their small businesspackage policies.Recommendation l4:That flood premium discounts not be provided tosmall businesses and that the reinsurancefacility not offer reinsurance for smallbusinesses.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.Delegates ReportsFloodplain Management Association Meetings60 of 214 March 2012 Ordinary Business PaperPage 122 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGovernment's ResponseRecommendation 15:That the questions of flood cover as standard insmall business policies and access todiscounted premiums for small businesspolicyholders should be revisited once therecommended arrangements for homes, homeunits and home contents are in place.The Government will consider thisrecommendation as part of its consideration ofthe manner in which flood cover should beoffered to small business and the provision offlood insurance premium discounts more broadly.Ghaoter 7: A flood oremium discount and reinsurance svstemRecommendation 16:That flood premium discounts be deliveredthrough a model that requires insurers to retainand price a portion of the risk with the remainderto be ceded to the reinsurance facility at adiscounted reinsurance premium.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.Recommendation 17:That for home building insurance policiesreceiving full discounts, policyholders pay forthat portion of the risk retained by the insurerand pay nothing for the remainder of the risk upto $500,000. For properties with a value greaterthan $500,000 policyholders then pay the fullcost of the portion of risk exceeding $500,000.Recommendation 18:That for body corporate insurance policiesreceiving full discounts, policyholders pay forthat portion of the risk retained by the insurerand pay nothing for the remainder of the risk upto $500,000 times the number of units. Forproperties with a value greater than $500,000times the number of units policyholders then paythe full cost of the portion of risk exceeding$500,000 times the number of units.Recommendation 19:That for home contents insurance policies,policyholders pay for that portion of the riskretained by the insurer and pay nothing for theremainder of the risk up to $100,000. Forcontents with a value greater than $100,000policyholders then pay the full cost of the portionof risk exceeding $100,000.Recommendation 20:That homes at high and extreme risk of flood beprovided with discounts initially and that they beassessed regularly for mitigation work alreadyundertaken and the potential for furthermitigation.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 201 2.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 201 2.The Government will consider thisrecommendation as part of its broaderconsideration of the introduction of floodinsurance premium discounts following aconsultation process in 2012.Delegates ReportsFloodplain Management Association Meetings61 of 214 March 2012 Ordinary Business PaperPage 123 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRecommendation 2l:That a flood risk reinsurance facility, orreinsurance pool, be established which wouldhave two primary functions:. to deliver discounts to home, contents andhome unit insurance policies for eligibleproperties; and. to provide flood reinsurance capacity tothe insurance market;and two key design features:. an excess of loss arrangement wherebyinsurers retain and price a 'first loss'portion of each policy on a commercialbasis; and. a'facultative/obligatory'reinsurancetreatythat would allow insurers to cedeindividual properties to the pool if theywish (facultative offer) but the pool wouldbe obliged to accept them (obligatoryacceptance).Recommendation 22:That the Commonwealth Government guaranteepayment of claims from the reinsurance pool byensuring that, whenever a funding shortfalloccurs in the pool through claims exceeding thefunds held in the pool, the Commonwealthwould meet the shortfall.Recommendation 23:That the Commonwealth seek reimbursement ofsome portion of the shortfall from the State orTerritory government in whose jurisdiction theflood occurred.The Government notes the recommendation andthat it represents one possible approach to thedelivery of flood insurance premium discountsand to facilitating the provision of flood cover byinsurers.This recommendation will be considered as partof the broader consideration of the introduction offlood insurance premium discounts following aconsultation process in 2012.The Government notes that while guaranteeingpayments of claims would ensure the financialviability of any flood reinsurance pool, it wouldalso have potentially significant budgetaryimplications.The Government will consider possible fundingsources as part of its broader consideration of theintroduction of flood insurance premium discountsfollowing a consultation process in 2012.The Government will consider possible fundingsources as part of its broader consideration of theintroduction of flood insurance premiumdiscounts, and this will include consultation withState and Territory Governments.Ghaoter 8: lmorovinq flood risk manaoementRecommendation 24:.That to facilitate flood risk information beingmade publicly available, Commonwealth, Stateand Territory governments grant indemnities tothe providers of flood risk information if theinformation is obtained and provided in goodfaith and in the absence of any grossnegligence.The Government will consider this matter andconsult with relevant parties, including State andTerritory governments.Delegates ReportsFloodplain Management Association Meetings62 of 214 March 2012 Ordinary Business PaperPage 124 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aChapter 9: A national disaster risk and insurance agencyRecommendation 25:That a national agency sponsored by theCommonwealth Government be established toundertake national coordination of flood riskmanagement and to operate the system ofpremium discounts and the flood riskreinsurance facility.The Agency would:a) coordinate flood mapping across thecountry (while leaving responsibility forundertaking flood mapping in the hands ofState and Territory governments and localauthorities);b) introduce national guidelines for flood riskmapping and classifications, prepared inconsultation with producers and users offlood risk information;c) act as a national repository of flood riskinformation, primarily through collating andanalysing information collected by others;d) continue development of the lnsuranceCouncil of Australia's National Floodlnformation Database or an equivalentdeveloped by the Agency;e) monitor the effectiveness of flood riskmitigation initiatives across the countryand advise on priorities for flood riskmitigation;f) publish and disseminate flood riskinformation in forms appropriate to variousgroups of users; andS) oversee the quality of flood riskinformation.The Government supports the need for bettercoordination of flood risk information and theimproved public availability of this information.The Government will provide for a centralnational access point (or'shopfront') for allexisting flood risk information.The Government will consult with relevantstakeholders on other elements of thisrecommendation, including the need for nationalcoordination of flood risk management. This willinclude consultation on appropriate mechanismsfor such coordination, were it to be consideredappropriate.Recommendation 26:That the Agency charge insurers a smalladministrative fee for each policy ceded to thereinsurance facility.The Government will consider thisrecommendation as part of its broaderconsideration of the appropriateness ofestablishing a flood reinsurance pool following aconsultation process in 2012.Delegates ReportsFloodplain Management Association Meetings63 of 214 March 2012 Ordinary Business PaperPage 125 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGhaoter 10: Other natural disastersRecommendation 27:.That:a)b)the Agency offer cover to insurers forcyclone risk, on the same basis as forflood risk, but with no affordabilitydiscounts (in the expectation that, whenthe Agency does its own pricing, itwilloffer a fair price to home and home unitowners. This price may be lower but is notguaranteed to be lower than the prices ofcommercial insurers); andan investigation be undertaken toascertain whether there is a basis forgranting affordability discounts for cyclonerisk, along the lines of the recommendedflood insurance discounts, for homes andhome units in northern Australia.Recommendation 28:That all home, contents and home unitinsurance policies cover the policyholder forstorm surge, tsunami and landslide, where thestorm surge, tsunami or landslide is the result ofanother event that is covered under the policyand regardless of whetherthe insured propertydirectly suffers damage from the underlyinginsured event.This includes storm surge associated with acyclone that does not cross the coastline.Ghaoter I 1 : Addressinq non-insuranceRecommendation 29:That the Commonwealth engage with theinsurance industry and the States andTerritories in planning for the future coordinationof charitable and government payments toindividuals to assist with recovery after futurenatural disasters.The Government is aware of home building andstrata title insurance premium increases inNorthern Queensland following cyclone Yasi.The Government will consult with the insuranceindustry on the causes of premium increases andoptions available.The Government will consider thisrecommendation as part of its broaderconsideration of the appropriateness ofestablishing a flood reinsurance pool following aconsultation process in 201 2.The Government has announced a ProductivityCommission review examining barriers toeffective clim ate change adaptation.The review's Terms of Reference include that theCommission is to assess the role of markets(including insurance markets) in facilitatingadaptation.The Government will be guided by the findings ofthe Productivity Commission review whenconsidering this recommendation.The Government acknowledges the importanceof insurance and charitable and governmentpayments in assisting communities to recoverfrom natural disasters.The Government will consult with State andTerritory governments in the first instance toreview and identify better practice coordinationand governance mechanisms for charitable andgovernment payments.Delegates ReportsFloodplain Management Association Meetings64 of 214 March 2012 Ordinary Business PaperPage 126 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRecommendation 30:That access to insurance be enhanced throughthe development of alternative payment options,in particular:a) by the Commonwealth Governmentarranging for Centrelink customers to beable to pay insurance premiumsfortnightly through Centrepay; andb) by State, Territory and/or localgovernments and community housingorganisations arranging insurancepremiums for contents to be able to beincorporated into rent for social andcommunity housing tenants.Recommendation 3l:That lending institutions remind mortgagorsannually of their obligations to hold homeinsurance and of the risks of under-insurance inorder to minimise non-insurance andunder-insurance of homes.Centrepay was specifically designed fordeductions to be made from a customeisfortnightly payment.Centrelink commenced offering the payment ofhome and contents and motor vehicle insurancepremiums through its Centrepay paymentfacilities earlier this year. lnsurance companieswanting to offer Centrepay as a payment optioncan contact Centrelink to request the requiredBusiness Application and Contract documents.However, the insurance industry has identified anumber of obstacles which limit insurancecompanies from accepting fortnightly paymentsthrough Centrepay. Additionally, there are anumber of other issues which arise fromfortnightly Centrepay insurance premiumpayments. Consequently, Centrelink and thelnsurance Council of Australia have agreed towork together to consider these issues andprovide a report to the Government withrecommendations by 28 February 2012.Rent setting for social housing is theresponsibility of State and Territory housingauthorities and similarly for community housingproviders. Therefore, itwould be up to theindividual community housing provider or Stateand Territory housing authority to enableinsurance premiums to be incorporated as part ofrental payments. The CommonwealthGovernment will alert State and TerritoryGovernments to this recommendation.The Government has asked the lending industryto examine this recommendation and advise theGovernment of its response by the end ofFebruary.Ghaoter 12: Reducinq under-insurance of homesRecommendation 32:That all home building insurance policiesproviding sum insured cover be modified by theend of 2014 so as to include replacement valuecover in the event of total loss of the home.That during the transition period insurersconsider how the design features of homebuilding replacement value policies shouldrespond following a natural disaster, includingthe conditions under which cash settlements areto be offered and finalised.The Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.Delegates ReportsFloodplain Management Association Meetings65 of 214 March 2012 Ordinary Business PaperPage 127 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGhapter 13: Gonsumer AwarenessRecommendation 33:That subsection 35(2) of lhe lnsuranceContracts Act 1984 be amended so thatpolicyholders are not deemed to be clearlyinformed of a deviation from 'standard cover' bysimply being provided a copy of the insurancepolicy or product disclosure statement.Recommendation 34:That, in endorsing the Government proposal fora Key Facts Statement, the Key FactsStatement list replacement cover and all naturaldisaster events, identified as 'standard cover' inthe lnsurance Contracts Regulations 1985.That insurers issue a Key Facts Statement topolicy holders with all new policies written andall policy renewals on an annual basis.Recommendation 35:That a 'health warning' be provided by insurersto the purchasers of home and contents policiesthat do not include full flood cover or fullreplacement cover. The health warning shouldbe provided:a) in the Key Facts Statement,b) verbally at the time of telephone purchase;andc) in writing on internet quotation software forall online purchases.Disclosure of insurance policy terms is a keyelement of the current disclosure regime. TheGovernment is further strengthening that regimethrough the introduction of a Key Facts Sheet anda standard definition of flood.The Key Facts Sheet, which insurers will berequired to provide to consumers in addition toexisting disclosure documents, will set out keyinformation relating to home building and homecontents insurance policies. This will significantlyimprove consumers' access to the keyinformation relating to these types of policies.The Government is also introducing a standarddefinition of flood that all insurers will be requiredif the word flood is used in their home build, homecontents, small business and strata titleinsurance policies. This will reduce confusion aswhat the word flood means in these types ofpolicies.These initiatives will further enhancetransparency and disclosure.The Government considers that the introductionof a Key Facts Sheet for home building and homecontents insurance policies in accordance with itsproposal will improve access to key informationfor consumers when making insurance decisions.The format and content of the Key Facts Sheetwill be finalised after consultation with all relevantstakeholders, to ensure the proposal achieves itspolicy outcomes.The Government considers that the introductionof the Key Facts Sheet for home building andhome contents insurance policies in accordancewith its proposal will improve access to keyinformation for consumers when makinginsurance decisions.The format and content of the Key Facts Sheetwill be finalised after consultation with all relevantstakeholders, to ensure the proposal achieves itspolicy outcomes.The Government will consult with relevantstakeholders on the need for and feasibility ofproviding a health warning in thesecircumstances.Delegates ReportsFloodplain Management Association Meetings66 of 214 March 2012 Ordinary Business PaperPage 128 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNatural Disaster lnsurance ReviewrecommendationsRecommendation 36:That the Commonwealth Government introducea standard deflnition of flood in the formproposed in the'Reforming flood insurance:Clearing the waters' consultation paper.Recommendation 37:That, in order to give general insurancepolicyholders the same legal remedies as otherconsumers, unfair contract terms laws beapplied to general insurance.Government's ResponseThe Government considers that the introductionof a standard flood for home building and homecontents, small business and strata titleinsurance policies in accordance with its standarddefìnition of flood proposal will reduce consumerconfusion regarding what is and is not included inflood coverage.Draft regulations for a standard definition of aflood will be released for consultation as soon aspossible to ensure it achieves its policyoutcomes. These regulations will contain wordingfor the standard definition of flood for riverineflooding (category B) consistent with the formproposed in the 'Reforming flood insurance:Clearing the waters' consultation paper.The Government is preparing a consultationRegulation lmpact Statement on this matterwhich will be publicly released in due course.Ghaoter 14: Glaims handlinq and dispute resolutionRecommendation 38:That every APRA-authorised general insureradopt and comply with the General lnsuranceCode of Practice.The Government will consult with the insuranceindustry on compliance with the Code of Practice.Recommendation 39:Thatthe lnsurance Council of Australia amendthe Code of Practice to impose a four monthtime limit (subject to exceptional circumstances)to make a determination as to liability and thenature of the loss or damage with respect to aclaim.That, should a claimant not receive adetermination within the four month period, theclaim be automatically escalated to an internaldispute resolution complaint and the insurernotify the Code Compliance Committee of thebreach of the Code.Recommendation 40:That the lnsurance Council of Australia repealclauses 4.3 and 4.4 of the General lnsuranceCode of Practice, so that claims arising fromnatural disasters are subject to the sameminimum standards as other claims- includingthe four month time limit for a determination onliability and the nature of the loss/damage withrespect to the claim.The Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.The Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.Delegates ReportsFloodplain Management Association Meetings67 of 214 March 2012 Ordinary Business PaperPage 129 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNatural Disaster lnsurance ReviewrecommendationsRecommendation 41:That the lnsurance Council of Australia amendclause 4.5 of the General lnsurance Code ofPractice to extend the time within whichclaimants in natural disasters have the right tomake further claims or lodge reviews after thefinalisation of an initial claim to seven monthsfrom the date of the relevant natural disaster,regardless of when the initial claim wasfinalised.Recommendation 42:That the lnsurance Council of Australia amendthe General lnsurance Code of Practice torequire that:a) internal dispute resolution processes beindependent of the claims handlingdepartment and the internal disputeresolution officers have the authority tooverturn the original decisions and toaccept claims;b) internal dispute resolution complaints befinalised within an aggregate of 45 daysand if this time limit is not met, the insurerto advise the claimant of his or her right tolodge an external dispute resolutioncomplaint with the Financial OmbudsmanService (if applicable) and to seekindependent legal advice;c) time limits on internal dispute resolutioncomplaints commence immediately after apolicyholder notifìes the insurer of acomplaint, whether verbally or in writing,andd) a general fairness test be applied toclaims and complaints handling.Government's ResponseThe Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.The Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.Delegates ReportsFloodplain Management Association Meetings68 of 214 March 2012 Ordinary Business PaperPage 130 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGovernment's ResponseRecommendation 43:That the lnsurance Council of Australia amendthe General lnsurance Code of Practice suchthat the General lnsurance Code ComplianceCommittee:a) be appointed in the same manner as FOSPanels, with the independent chair andthe consumer and industryrepresentatives to be appointed in thesame manner as the ombudsman andpanel members are appointed under theFOS rules;b) have the authority and resources to recordallbreaches of the Code reported to it, toinvestigate breaches of the Code whereappropriate and to conduct regular auditsof insurance companies for compliancewith the Code;c) report serious or systemic breaches of theCode directly to ASIC; andd) publicly release annual reports as to Codecompliance and breaches, with insurers tobe identified in the reports.Recommendation 44:That ASIC conduct a review of the Generallnsurance Code of Practice three years after theamendments recommended to the Code in thisReview are implemented, in order to assess theeffectiveness of the Code with a view todetermining whether an ASIC Regulatory Guidefor claims handling should then be introduced.Recommendation 45:That the Commonwealth and Stategovernments provide funding for legal adviceand assistance with insurance disputesfollowing natural disasters.The Government has asked the insuranceindustry to examine this recommendation andadvise the Government of its response by theend of February.On 43 (c), when consulting on this matter theGovernment will take into consideration theexisting role of the Financial Ombudsman Servicein reporting breaches of the Code of Practice.ln the event that amendments are made to theCode of Practice in response to therecommendations of the Review, the Governmentwill consider the need to undertake anassessment of the effectiveness of the revisedCode.The Australian Government recognises theimportance of coordination in ensuring anefficient and effective response.It will work with States and Territories to ensurethat appropriate legal assistance service areavailable following natural disasters.Ghapter l5: Fundino the rebuildinq of public infrastructureRecommendation 46:That the current formula for the cost ofrebuilding of State and Territory assets underthe Natural Disaster Relief and RecoveryArrangements be changed to expenditurebefore any insurance recoveries by the State orTerritory rather than net of any insurancerecovefles.The Government notes that the recommendationis consistent with a key principle of the currentarrangements under the Natural Disaster Reliefand Recovery Arrangements (NDRRA)Determination. That is, that they should not beseen as a disincentive to plan, mitigate orallocate resources for natural disasters nordiscourage governments, individuals orbusinesses taking out insurance to protect theirassets.However, there is a need to further consider thebroader implications of chanqinq the formula.Delegates ReportsFloodplain Management Association Meetings69 of 214 March 2012 Ordinary Business PaperPage 131 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a16: lmplementation and transitionRecommendation 47:That the Government give priority to introducinglegislation necessary to ensure that all home,contents and home unit insurance policiesinclude flood cover and to establish a newnational agency for flood risk management andflood reinsurance purposes.ln the event that the Government adoptsrecommendations that req uire legislation, prioritywill be given to introducing that legislation.Delegates ReportsFloodplain Management Association Meetings70 of 214 March 2012 Ordinary Business PaperPage 132 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodptain Management Association(formerly Floodplain Managernent Authorities)Caring for Peopte and the Environmentwww.ftoods.org.au ABN 67 007 279179Chairman: Ctr lan Dìnham 0435946575Mr Tim Moore and Mr Ron DyerPlanning System ReviewGPO Box 39SYDNEY NSW 2OO11 November,2011Dear Sirs,Submission to the NSW Planning ReviewThank you for the opportunity to contribute to the NSW Planning Review.The Floodplain Management Association (FMA) represents the interests of 100 localgovernment councils, Catchment Management Authorities, consultants, businesses andindividuals involved in reducing future flood losses.The attached submission summarises concerns raised by FMA members about changes toplanning legislation which are inconsistent with the New South Wales Govemment FloodProne Land Policy.The FMA would be pleased to provide any further information or details which may be ofassistance to the review.Yours faithfully.a?./-,a e;-^-Glenn EvansExecutive OfficerPlease address conespondence to:Glenn Evans Executive Officer Floodplain Management Association115 Marshall Street Garden Suburb NSW 2289 Email glennevans.fma@gmail.com Ph 0415 873353FLOODPLAIN MANAGEMENT ASSOCIATION SUBMISSION TO NSW PLANNING REVIË]^/ 1 OF 7Delegates ReportsFloodplain Management Association Meetings71 of 214 March 2012 Ordinary Business PaperPage 133 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Management AssociationCaring for Peopte and the Environmentwww.ftoods.org.au ABN 67 007 279 179'î¡vAGEMts\'' Chairman: C[ lan Dinham 0435 94ó 525SUBMISSION TO NSW PLANNING REVIEWI NOVEMBER 2011FLOODPLAIN MANAGEMENT ASSOCIATIONWHO IS THE FLOODPLAIN MANAGEMENT ASSOCIATION?The Floodplain Management Association (FMA) (formerly the Floodplain ManagementAuthorities of NSW) was formed after the disastrous floods in NSW in the mid-1950's tosupport and promote best floodplain risk management practice.The FMA currently has a membership of 100 local government councils, CatchmentManagement Authorities, consultants, businesses and individuals involved in floodplainmanagement. Membership and participation includes both technical staff and electedrepresentatives. The FMA has links to equivalent organisations in the Unites States andGreat Britain.The FMA is recognised by State and Federal Govemment agencies as representing theinterests of NSW floodplain communities and those authorities responsible for reducingfuture flood losses. The FMA meets regularly with State and Federal ministers and theirdepartments.Other positive partnerships with government include:rgood working relationships with Department of Planning and lnfrastructure(DoPl), Office of Environment and Heritage (OEH), State Emergency Service(SES) and the Bureau of Meteorology (BoM);. development of the Flood Risk Management Course at the University ofTechnology Sydney (UTS) in association with the Office of Environment andHeritage and the State Emergency Servicer pârticipation in high level flood-related committees, for example the FloodWaming Consultative Committee, Building Code of Australia Advisory Groupfor the New Flood Standard and the State Flood Mitigation AssessmentCommittee.The FMA's annual Floodplain Management Conference is now in its 52nd consecutive yearand provides a great opportunity to promote and network best practice to the members, bythe members.FLOODPLAIN MANAGEMENT ASSOCIATION SUBMISSION TO NSW PLANNING REVIÉ]A/ 2 OF 7Delegates ReportsFloodplain Management Association Meetings72 of 214 March 2012 Ordinary Business PaperPage 134 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFLOOD RISK IN NSWFlooding is the most costly naturaldisaster in Australia. More than 100,000 buildings are atrisk of flooding in NSW, and the average damage from flooding in coastal New South Walesand inland urban centres is around $200 million a year. The damage bill from the recentfloods in Queensland is now in excess of $2.5 billion. Floods in the Hunter Valley andNewcastle in June 2007 cost the local communities around $1.5 billion.Flooding is also the most manageable of natural disasters-flood, we just don't know when. The facts are:we can work out where it will. there is a 1o/o chance EVERY year that a 1-in-100 year flood OR LARGER willhappen in that year;. floods larger than a 1-in-100 year flood CAN and HAVE occurred.FLOODPLAIN RISK MANAGEMENT STARTS WITH LAND USE PLANNINGSUMMARY OF ISSUES FOR NSW PLANNING REVIEWFloodplain risk management involves protecting life and property from floods. With costlyflood mitigation works becoming further and further out of reach from most local councils andthe ever increasing reliance on evacuation only increasing risk to life during floods, the onlyway to prevent the cost of flooding from escalating in the future, is through land useplanning.It is therefore of concern that in the past five years and even in light of the publicitysurrounding the devastating floods in Brisbane in January this year, the Department ofPlanning and lnfrastructure has flouted, and has continued to flout, it's own government'sState Flood-Prone Land Policy, by reducing the controls required for development on floodproneland. This has been carried out through apparent ad-hoc changes to legislationwithout adequate consultation with:. Office of Environment and Heritage-Flood Prone Land Policy;. State Emergency Service-who manage the NSW Governmentwho manage the emergency response toinappropriate development on flood-prone land when floods occur; and. local councils-land.who manage the land use and development on flood-proneIt is therefore RECOMMENDED, as part of the NSW Planning Review, that consideration begiven to the following key issues relating to floodplain risk management:. lssue 1 the repeal of Planning Circular PS07-003 New Guideline and-Changes to Section 117 Direction and EP&A Regulation on FloodProne Land;. lssue2 the need for recognition of flood risks above the 100 yearflood levelfor all development types;. lssue 3 the need for consistency with the state government's own FloodplainDevelopment Manual;FLOODPLAIN MANAGEMENT ASSOCIATION SUBMISSION TO NSW PLANNING REVIË]^/ 3 OF 7Delegates ReportsFloodplain Management Association Meetings73 of 214 March 2012 Ordinary Business PaperPage 135 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a. lssue 4 the need for a clear definition of flood-prone land in the Standardlnstrument LEP;. lssue 5 the need for a clear definition of 'significant adverse impacts' in theStandard lnstrument LEP;. lssue 6 acknowledgment that flood mapping is highly technical, costly andtime-consuming and so is beyond the resources and expertise ofmany local councils;. lssue 7 the repeal of that part of State Environmental Planning Policy (Exemptand Complying Development Codes) 2008 that permits complyingdevelopment on flood-prone land.More detail on each of these issues is provided below.ISSUE 1:REPEAL OF PLANNING CIRCULAR PS07-003 NEW GUIDELINE AND-CHANGES TO SECTION I17 DIRECTION AND EP&A REGULATION ONFLOOD.PRONE LANDPlanning Circular PS07-003 was issued in January 20OT and marked a turning point in floodrisk management in NSW. Many practitioners in flood risk management view this PlanningCircular as a retrograde step in flood risk management that moved away from the principlesof the Floodplain Development Manual (2005) that had operated successfully for more the20 years.The key requirement of Planning Circular PS07-003 is that local councils should adopt the1oo-yearflood asthe Flood Planning Level (which is calculated asthe 1O0-yearflood levelplus 0.5m for freeboard) for residential development, unless there are 'exceptionalcircumstances'. Local councils should not impose flood related development controls onresidential development on land above the residential Flood Planning Level, unless there are'exceptional circumstances'. No further guidance is provided in the Planning Circular abouthow Council's can apply for 'exceptional circumstances'.The Planning Circular is not consistent with the Floodplain Development Manual and doesnot recognise flood risk above the 100 year flood level for residential development as the'rule' rather than the 'exception'It is therefore RECOMMENDED that, as part of the NSW Planning Review, Planning CircularPS07-003 be REPEALED for the reasons set out below in lssues 2to 7.ISSUE 2:NEED FOR RECOGNITION OF FLOOD RISK ABOVE 100 YEAR FLOODLEVEL FOR ALL DEVELOP]VTENT TYPESThe identification and management of flood risks greater than the level of the 100 year floodlevelare of critical importance to disaster management.Planning Circular PS07-003 and Clause 7.3 of the Standard lnstrument LEP infer that floodrisk management and disaster planning should be restricted to areas defined by the FloodPlanning Level.FLOODPI.AIN MANAGEMENTASSOCIATION SUBMISSION TO NSW PLANNING REVIHA/ 4 OF 7Delegates ReportsFloodplain Management Association Meetings74 of 214 March 2012 Ordinary Business PaperPage 136 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThere is a duty of care by all agencies, including the DoPl, to recognise that flood riskmanagement and disaster planning must consider all possible floods. Failure to do this mayleave local communities unnecessarily exposed, both in terms of risk to lÍfe and risk toproperty. The economic gains from permitting development in potentially dangerouslocations could be far outweighed by the damage caused to these communities when anextreme flood occurs.It is therefore RECOMMENDED, as part of the NSW Planning Review, that all DoPldocumentation e mphasises that there is a need to recognise all flood risks up to theprobable maximum flood.ISSUE 3:NEED FOR CONSISTENCY WITH STATE GOVERNMENT'S OWNFLOODPLAIN DEVELOPMENT MANUALThe 2005 Manual is clear in outlining a Floodplain Risk Management Approach to naturaldisaster management, with Flood Planning Levels determined for a particular location basedon a thorough knowledge of the flood risks. Whereas the Section 117(2) Direction 4.3clearly states that the LEP shall be consistent with The 2005 Manual, Planning CircularPSOT-003 and Clause 7.3 of the Standard lnstrument seem to have abandoned themanual's risk management approach and reverted floodplain risk management back some20 or 30 years to a standardised flood planning level of the 100 year ARI flood with norequirement to consider all the possible consequences of flooding.For example, in the Hawkesbury-Nepean floodplain, the flood of record (i.e. a real flood) ismore than 2m (i.e. one storey) higher than the 100 year flood. Clearly there is a risk to life infloods greater than the 100 year flood.Again, it is therefore RECOMMENDED, as part of the NSW Planning Review, that all DoPldocumentation e mphasises that there is a need to recognise all flood risks up to theprobable maximum flood.ISSUE 4:NEED FOR CLEAR DEFINITION OF FLOOD PRONE LAND lN THESTANDARD INSTRUMENT LEPClause 7.3 (Flood Planning) of the Standard lnstrument and the Section 117(2) Direction 4.3Flood Prone Land, both make reference to the fact that a LEP should be consistent with theNSW Government Floodplain Development Manual (2005) (The 2005 Manual). However,Clause 7.3 fails to emphasise the definition of flood prone land.Flood prone land is clearly defined in The 2005 Manual as all land affected by flooding in allfloods up to and including a probable maximum flood (PMF).It is therefore RECOMMENDED, as part of the NSW Planning Review, that a clear definitionof flood prone land, which is consistent with The 2005 Manual, be provided in all Departmentof Planning and lnfrastructure (DoPl) documentation.FLOODPLAIN MANAGEMENT ASSOCIATION SUBMISSION TO NSW PLANNING REVIBA/ 5 OF 7Delegates ReportsFloodplain Management Association Meetings75 of 214 March 2012 Ordinary Business PaperPage 137 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aISSUE 5:NEED FOR CLEAR DEFINITION OF 'SIGNIFICANT ADVERSE IMPAGTS'IN THE STANDARD INSTRUMENT LEPBoth Clause 7.3 of the Standard lnstrument and the Section 117(2) Direction 4.3 refer to"significant adverse impacts" or similar phrases in several locations. Experience has shownthat to define "significant adverse impacts", let alone evaluate whether a developmentproposal will have "significant adverse impacts", is extremely difficult and often leads tovarying subjectivity of the impacts. Only with a true risk management approach, as outlinedin The 2005 Manual, will impacts be adequately and more objectively assessed.It is therefore RECOMMENDED, as part of the NSW Planning Review, that the Departmentof Planning and lnfrastructure documentation specifically refer to the 2005 FloodplainDevelopment Manual for an appropriate methodology for the assessment of flood impacts.ISSUE 6:ACKNOWLEDGEMENT THAT FLOOD MAPPING lS TECHNICAL, COSTLYAND TIME.CONSUMINGIt is important for all councils to identify allflood prone land (i.e. up to a level of the probablemaximum flood), not just flood planning areas. lt is also important that this mapping isreadily and freely available to the local community.However, DoPl must acknowledge that flood mapping is a costly and time-consumingexercise, with many councils simply not having the technical expertise and/or the resourcesto undertake the complex flood studies required to produce flood mapping. Many councilshave a program of flood studies to be completed that span several years or more. Somecouncils have floodplains that may never be mapped.It is noted though that there is a requirement in the NSW Coastal Planning Guideline:Adapting to Sea Level Rise (and the two associated risk management guidelines) forcouncils to have a 'rule of thumb' to identify 'investigation areas' for locations that may beaffected by sea level rise where detailed flood studies are not available.A similar simple 'rule of thumb' for determining flood-prone land is simply not possible.It is therefore RECOMMENDED, as part of the NSW Planning Review, that Clause 7.3 of theStandard lnstrument requires councils to map allflood-prone areas as well as flood planningareas as defined.Also, it is therefore RECOMMENDED, as part of the NSW Planning Review, that DoPlformally recognise that flood mapping is a technical, costly and time-consuming exercise, byproviding additionaltechnical assistance (and possibly grantfunding assistance) to councils.Additional technical assistance could be provided by working with the current flood andcoastal groups at the Office of Environment and Heritage.FLOODPLAIN MANAGEMENTASSOCIATION SUBMISSION TO NSW PLANNING REVIEW 6 OF 7Delegates ReportsFloodplain Management Association Meetings76 of 214 March 2012 Ordinary Business PaperPage 138 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aISSUE 7:REPEAL THAT PARI OF STATE ENVIRONMENTAL PLANNING POLICY(EXEMPT AND COMPLYING DEVELOPMENT CODES) 2008 THATPERMITS COMPLYING DEVELOPMENT ON FLOOD.PRONE LANDDespite all the publicity of the devastating floods in Brisbane in January this year, therevision of SEPP (Exempt and Complying Development Codes) 2008 (the Codes SEPP) topermit complying residential development on flood-prone land, and the speed of the revisionand its implementation, c¿¡me as a surprise to many floodplain risk managementpractitioners as this was yet another reduction on the controls required for development onthe floodplain.The rhetoric suggested that local government requested the change to the Codes SEPP, butit is understoodthat less than a handful of local councils requested the change (out of morethan 150 local councils in NSW and over 80 represented by the Floodplain ManagementAssociation (FMA)). ln addition, recommendations by the industry went substantiallyunheard.Key concerns reported by local councils to the FMA included:. With flood-related development controls in the Codes SEPP overriding those incouncil's own Development Control Plan, the revisions to the Codes SEPPerode Council's efforts to prepare a merits-based approach to their floodrelateddevelopment controls, that take into account localflood conditions andthe soclal and environmental implication of the local community;. The revision to the Codes SEPP relies on councils having not only mappedtheir flood-prone areas but also having categorised their floodplains into areasof flood risk, flood hazard, floodway, flood storage and overland flow. Very fewcouncils have this information (see lssue 6 above);oWhile some councils may have mapped some floodplains, even fewer haveassociated notations included on Section 149 Planning Certificates. lt is stillimportant however that it be made compulsory for private certifiers to obtainSection 149 Certificates as part of any complying development application.It is therefore RECOMMENDED, as part of the NSW Planning Review, that the part of theCodes SEPP that permits complying development on flood-prone land be REPEALED.Without the relevant information, the FMA and many councils are concerned that applicantswill assume that the property is not flood-affected and this will further increase inappropriatedevelopment of flood-prone land in NSW.SUE RIBBONSDIRECTOR, LAND USE PLANNING, FLOODPLAIN MANAGEMENT ASSOCIATIONFLOODPLAIN MANAGEMENT ASSOCIATION SUBMISSION TO NSW PLANNING REVIHA/ 7 OF 7Delegates ReportsFloodplain Management Association Meetings77 of 214 March 2012 Ordinary Business PaperPage 139 of 555 of the March 2012 Ordinary Business Paper

Key words: Frood forecasting, rear-time data, network funding, EnviroMon.Attacment 8.2.aFLooD *ARNING DATA NETwoRKs -_NoT F'R.ETTTNG THELESSONS FROM THC PAST*wffiiJjJ#l[[:?åTüWGordon McKay (q.nAbstractThe quality of flood forand accurate real{imecommittee in 1990 the. management decisions underpinned by timelyWarning Consultativemanagement system thro coilect and view fierdw operational veocar councirs andlntroductionl"r"r'îå'lff,"î,'*"'o'"' nash 'ood warninsï" NSW DepaPlanning and Natuts responsible for theuges as well as itsges.rmportance of datafree public accessamorrgst the local gothe FMA.The paper will atsngements. This paperthe possibte funOinjthe importance ofnetwork andblic access toThe aim ofDelegates ReportsFloodplain Management Association Meetings78 of 214 March 2012 Ordinary Business PaperPage 140 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aLessons From the PastOne of the key lessons from past floods,such as the 2001 floods on the NSW northcoast, is the value of timely and accuraterainfall and river level data to underpin criticalemergency management decisions as well asthe need to meet general community demandfor such information, particularly in areas thatare not specifically covered by Bureau floodpredictions (McKay 2001 ).The NSW SES, for example, base theiroperational management on flood intelligencecollected from past floods for specific rivergauges that are representative of flooding ina particular area (Pfister & Rutledge 2002).The information from past floods isaugmented by flood studies and otherresearch about flood effects on a community,which in turn is also based upon historicalrainfall and river level records.The Bureau uses hydrological models basedupon data from past floods, and highlydependant on automatically collected realtime data, to provide the SES and thegeneral community with predicted river levelsfor these key river gauges. ln NSW there arepresently 161 such river gauges in NSW forwhich the Bureau provides quantitative floodheight predictions to facilitate an early andappropriate community response to the floodthreat. To provide accurate and timely floodpredictions, the Bureau uses real-time datafrom some 565 additional river gaugeslocated upstream of these 161 forecastlocations. Several automatic river gaugesalso have rainfall measuring instruments colocatedwith them. The data from these andstand-alone rain gauges is also used fordeveloping flood warning systems.ln addition to the 161 river gauges thatrepresent key forecast locations, there is alsoa high public interest in obtaining timelyinformation from the other river gauges thatare relevant to their local area and which maynot be covered by the Bureau flood forecast.For example, many gauges are used as aguide for local road closures due to flooding.The public's interest in such information wasstrongly expressed at the numerous publicmeetings that followed the 2001 floods andthis led to the Bureau accelerating thedevelopment of access to real-time data onits lnternet site to help satisfy this demand(Robinson & McKay 2003). A number oflocal councils have also developed locallnternet sites which display real-time rainfalland river level data.Who Owns the NSW River Gauges?A key point is that it was taxpayers money,collected and disbursed through variousprograms, that was used to originallyestablish the NSW river gauging network.Many NSW river gauges were established inthe 1800's as manually-read staff gaugesand most have been uPgraded withautomatic recording instruments andcommunications telemetry over time.The present river level monitoring networkused for flood warning by the Bureau in NSWconsists of 726 river gauges that are ownedand maintained by the followingorganisations :Table 1 : River Gauge OwnershiPORGANISATIONDept. of lnfrastructurePlanning & NaturalResourcesDept. Of Commerce -Manly Hydraulics Lab.(MHL gauges cover thetidal areas, most fundingcomes from DIPNR)Bureau of Meteorology(mainly manually readgauges)Sydney CatchmentAuthorityACT Electricity andWaterOthers- including localcouncilsNo.RiverGaugesoffo476 660/o88 12o/o57 8o/o33 4o/o20 3o/o52 7%Delegates ReportsFloodplain Management Association Meetings79 of 214 March 2012 Ordinary Business PaperPage 141 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOf the 476 river gauges operated by DIPNR,some 300 are used for river and damoperations by State Water, who pay for theirmaintenance. There is a suggestion thatState Water may want to assume"ownership" of these 300 gauges which couldhave implications regarding free access tothis information by other users, such as theBureau, SES, local councils and the generalpublic.Cost of River GaugesThe average cost of installing a new rivergauge is between $15,000 to $30,000,depending upon the site conditions. Theaverage annual maintenance cost of a rivergauge used for water resources assessmentis between $10,000 to $15,000. Rivergauges used only for flood warning cost inthe order of $3,000 to $5,000 per year tomaintain. This indicates that the averageannual cost of maintaining the 726 rivergauges used for flood warning in NSW is inthe order of $ 6 million to $7 million, which isa considerable sum for an agency which hasresponsibility for a large number of theseriver gauges, particularly when it is facingother funding pressures.These maintenance costs are shared by theagencies referred to in Table 1. Most of the"Others" in Table 1 are the several localcouncils for which new river gauges wereinstalled specifically for flood warningpurposes. However, there are many townsthat are provided with a flood warning servicethat have never contributed towards the costof any river gauges as they rely on theexisting networks that are funded by otherprograms. This is because most of the 726river gauges in the NSW Flood Warningnetwork are used for multiple purposes, suchas river operations, water resourceassessment and natural resourcemanagement, and may only be used for floodwarning purposes for a small percentage oftime.Despite the high costs, a number ofeconomic studies have shown that there is ahigh positive benefit cost ratio for thecollection of river level data (Cordery 2003).The benefits come from the application ofstreamflow data across a range ofapplications but considering that themaintenance cost of $6 to 7 million is onlyaround 5o/o of the $128.4 million averageannual cost of flooding in NSW (BTE 2001)the benefit of this data to improved floodwarning may, in itself, justify the cost ofoperating these river gauges.The Gase for Retaining Free PublicAccess to DataThe Bureau of Meteorology is a strongadvocate in the World MeteorologicalOrganisation forum for the international freeexchange of meteorological observationswhich underpins the delivery of weatherservices across the globe. Several poorernations rely on these internationalarrangements as their primary source ofinformation for their weather forecasts andwarnings. Australia is also a beneficiary ofthese arrangements, particularly through thereceipt of weather satellite imagery as well asinternational data for its global computermodels used to predict Australia's weather.As is the case in other countries, weatherrelated warning services, including floodwarning services, are publicly funded andthe community has free access to these.This also includes free access tometeorological and hydrological informationsuch as weather observations, radar andsatellite imagery, as well as rainfall and riverlevel data. This is even the case in countriessuch as Ganada and New Zealand, wherethe national meteorological services havebeen privatised.ln the United States, where the private sectorplays a significant role in the provision ofmeteorological services, the Governmentprovides a benchmark of excellence of freepublic access through its lnternet basedweather and hydrological services, includingthe provision of current and past river levelinformation from its large network onhttp://waterdata.usgs.qov/nwis/rt .Changing the free availability of river levelinformation in NSW will have majorimplications for the provision of flood warningservices. For example, it will raise the issueDelegates ReportsFloodplain Management Association Meetings80 of 214 March 2012 Ordinary Business PaperPage 142 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aof who should pay for this data? The enduserof this information is, after all, not theBureau, or the SES, but the localcommunities that have a flooding problem.The loss of free access to data by the Bureaufrom the existing river and rain gauges thatare cooperatively owned and maintained byother agencies may result in the withdrawalof existing quantitative ftood forecastingservices, which provide specific river heightforecasts, for the affected area. Wherepossible, this may be replaced with a moregeneral advice on whether "minor'',"moderate" or "majof'' flooding can beexpected. Such general warnings are,however, of much less value to the SES thanquantitative flood forecasts that provide adirect link to local flood intelligence on whichareas are likely to be flooded at a specificriver level.The present level of flood warning services inNSW relies heavily upon the automaticcollection and processing of rainfall and riverlevel data. One of the key fessons from thepast is that it is not possible to provide atimely flood warning service during periods ofmajor widespread flooding when relying onmanual data collection and processing, whichwould be the case if the Bureau loses freeaccess to this data. This can be shown bycomparing flood warning timeliness duringthe major widespread floods of April 1989,which relied heavily upon manual networks,to the March 2001 floods, where thenetworks were automated, shown in Figure 1.Figure 1 : Flood Warning Timeliness60U'.g uocË40B^30à

Attacment 8.2.alocal data access was provided using USbased ALERT software, which runs on aQNX operating system, that was extensivelyre-developed by the Bureau. The version ofthe QNX operating system that is used, whilstbeing very robust, is no longer supportedand has seen better days. For example, itcan't be run on computers newer than theageing "486s". There was also demand fromseveral local councils for a data collectionsystem that runs on a windows operatingsystem and which is also caPable ofproviding improved graphical displays.After an exhaustive compilation of userrequirements and comparison of varioussoftware development options, the Bureaudeveloped a replacement system that is nowknown as "EnviroMon".The software was released for testing in a"Beta" version during 200012001 to severallocal councils across Australia, including theWyong and Tweed Shire councils in NSW.John Henley, of Tweed Shire Council, andTom Wallace, of Wyong Shire Council, wereparticularly active proponents for a new datacollection system during a number of ALERTuser meetings that were held during theannual NSW Flood Plain ManagementAuthorities (FMA) conferences. The NSWFlood Warning Centre staff were particularlyrelieved to be able to provide John Henleywith the preliminary version of this softwarebefore his retirement in 2002.The Beta version was also installed innumerous SES offices in the NePeanHawkesbury catchment where it wasdeemed impractical to install the ageing QNXALERT system.The official operational version of EnviroMonwas released in 2004 and is now installed inover 30 locations across NSW, including 2NSW state government water agencies.EnviroMon FeaturesThe primary aim of EnviroMon is to collectand monitor data from Event Reporting RadioTelemetry Systems (ERTS). With EnviroMonyou can monitor the data in real time. Thedata can be viewed as time series plots,maps or tables. EnviroMon also providestools for data archiving, quality control, andmeta-data management (for example sitenames, locations, river gauge offsets).One important feature of EnviroMon is itsability to transfer data in real time via thelnternet. This feature is being used by theBureau to receive data from remoteEnviroMon base stations in the Far-North andMid-north coast of NSW. This transfersystem replaces the unreliable modemconnections used by the old QNX ALERTsystems.The latest version of EnviroMon supports aclienUserver installation that is designed towork in corporate lT environments. ltsupports both Windows workgroups anddomains, and also supports different levels ofenviromon users (administrators, powerusers etc).An alerting module for EnviroMon is currentlybeing developed. Based on critical rainfalland river level thresholds, EnviroMon will beable to send alerts via email and SMS. Thisis expected to be available later this year.ConclusionsThe lessons from the past include thehistorical records of rainfall and river levelsfrom previous floods and a community'sability to successfully manage future floodsdepends heavily upon it having continuedaccess to this information in real-time. Byworld standards it is appropriate to continueto provide free public access to thisinformation.Although rainfall and river gauges areexpensive to install and maintain, economicstudies have proven that their overall value tothe community is typically higher than theircost and this needs to be taken into accountwhen any financial rationalisation is beingconsidered.With respect to flood warnings, a key lessonfrom the past has been that the accuracy andtimeliness of the service has improved withthe growth and automation of the NSW rainDelegates ReportsFloodplain Management Association Meetings82 of 214 March 2012 Ordinary Business PaperPage 144 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aand river gauging network. The opposite istrue if the network is forced to shrink.The EnviroMon data management softwareprovides local councils, SES and other clientswith an advanced monitoring facility that willenhance their emergency managementcapabilities.ReferencesBTE (2001). Economic Costs of NaturalDisasters in Australia. Bureau of TransportEconomics Report 103.Cordery I (2003). A Case for lncreasedCollection of Water Resources Data.Australian Journal of Water Resources.Volume 6. No 2.McKay G (2001). ContemPorary FloodForecasting and Warning lssues in NSW.41't NSW FMA Annual Conference,Wentworth NSW.Pfister N and Rutledge A (2002). The Role ofthe NSW State Emergency Service in FloodManagement. 42nd NSW FMA AnnualConference, Kempsey NSW.Robinson J and McKay G (2003). \AAAATV ofFlood Warning. 43'd NSW FMA AnnualConference, Forbes NSW.Author's BiographiesGordon McKay has managed the Bureau's NSW Flood WarningCentre since 1991. Since joining the Bureau in September 1988Gordon has attended all NSW Floodplain Management Conferencesand has presented papers lo 12 of them.He holds a Bachelor of Engineering and Master of EngineeringScience from the University of NSW.Before joining the Bureau, Gordon spent 9 years with the NSWDepartment of Water Resources (now part of the Department oflnfrastructure Planning and Natural Resources) where he worked hisway through the planning, river and dam operation, policydevelopmenflstrategic planning and waterresource managementsections.Prior to this, he worked for engineering consultants where he wasinvolved in urban drainage and floodplain management studies'Postal Address: Gordon McKay, Bureau of Meteorology, PO Box413, Darlinghurst, NSW 1300E-mail: q. mckav@Bureau.qov.auDelegates ReportsFloodplain Management Association Meetings83 of 214 March 2012 Ordinary Business PaperPage 145 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aJustin Robinson has 12 years hydrological experience in research,consulting and government. He is currently the Senior HydrologicalServices Manager at the NSW Warning Centre, where he has workedsince 2000.He holds Masters and Bachelors degrees in EnvironmentalEngineering from The University of Western Australia. He wasinvolved with research into scaling problems in hydrology.Prior to joining the Bureau, he has worked for JDA ConsultantHydrologists, Water Studies Pty Ltd, and the Department of Land andWater Conservation.Postal Address: Justin Robinson, Bureau of Meteorology, PO Box413, Darlinghurst, NSW 1300E-mail. i. robinson@Bureau.qov.auDelegates ReportsFloodplain Management Association Meetings84 of 214 March 2012 Ordinary Business PaperPage 146 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplainManagementAssociationMINUTES of NOVEMBER 2011 QUARTERLY MEETINGThursday 24 November, 2011McKell House AuditoriumRawson Place, SydneyMeeting commenced at 11:05Item IItem 2Item 3Item 4Item 5Item 6Item 7Item IItem 9Item 10ApologiesConfirmation of Minutes Quarterly Meeting oi 252011 and Business ArisingGhairman's Reportlmmediate Past Chairman's ReportDeputy Chairman's ReportExecutive Officer's ReportTreasurer's ReportReports from Executive CommitteeDirector - TechnicalDirector - Land-Use PlanningCommunications OfficerReports from Conference HostsEu roboda lla 2012 ConferenceTweed 2013 National ConferenceReports from AgenciesOffice of Environment and HeritageState Emergency ServiceBureau of MeteorologyAugust,Chairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer85 of 214 March 2012 Ordinary Business PaperPage 147 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 11Item 12Item 13Item 14FMA Survey - Flood Definition, s149 Certificatesltems Listed by MembersGeneral BusinessNext Scheduled Meeting / Glose1:30 - 2:30 Workshop: "social Media - communication opportunities between andduring floods" Discussion was led by FMA Director Landuse Planning Sue Ribbons. Thepresentation is at Appendix 9.Item I APOLOGIESAttendance and apologies are at Appendix 7.Resolved - That the apologies be accepted.Item 2 CONFIRMATION OF QUARTERLY MEETING MINUTESMinutes of the August 201 1 Quarterly Meeting have been circulated.Resolved - The Minutes as circulated were accepted as a true record of the QuarterlyMeeting of the August, 2011.There was no business arising from the Minutes not covered elsewhere in the agenda.Item 3 CHAIRMAN'S REPORTCirculated ReportIt is my pleasure to welcome all members and visitors to the November 2011 QuarterlyMeeting and thank you very much for your attendance today.During the past 3 months your Executive has been working on severalfronts to promote theinterests of floodplain management and it has been pleasing to note the interest fromoverseas with several speakers travelling to our next conference at their own expense topresent papers and join in with our network.Delegates may also be interested to know that I have changed my professional role as anEngineer and have moved to Moree Plains Shire Council, which is a long standing memberof the FMA. The Council has been unable to attend meetings recently so I am now able tobring a "western" perspective to our discussions as well as my normal role as a Councillorfor Clarence Valley Council.Delegates ReportsFloodplain Management Association Meetings86 of 214 March 2012 Ordinary Business PaperPage 148 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alnternational River SymposiumDuring September I attended the lnternational River Symposium in Brisbane and was ableto make contact with several speakers who will be of considerable interest to all delegates ifwe can recruit them to present at our national conference in 2013.The sessions on the Brisbane and other Queensland floods were particularly interestingand there are many lessons for us all resulting from these events.I was able to promote the FMA during question times and networking throughout each day.I have given a written summary of potential speakers to our Executive Officer and to TweedShire Council who will be hosting the 2013 conference.Discussions with LGSAAs verbally reported to the last quarterly meeting, further discussions have been held withthe LGSA in Sydney on Wednesday 24th August 20111o identify more specifìc areas ofmutual support.It was agreed that the exchange of information via our respective newsleüers would bemutually beneficial and in particular the issues surrounding land use planning and theupcoming review of planning legislation. A meeting will again be held with the LGSA on 23November before our quarterly meeting and a verbal report will be presented to thismeeting.Flood Risk Management Course at University of Technology SydneyThe FRM course has been successfully completed for another year and I particularly wishto thank our Technical Director, David Gibbons, and our Land-use Planning Director SueRibbons for their valuable time and expertise in presenting components of this course.It is a big commitment to prepare and present subject material at this level and all memberscan be assured that the FMA is very well represented by Sue and David in this importantacademic forum.Once again, on your behalf, I wish to express my sincere thanks to Duncan Mcluckie alsofor his continued efforts in delivering our education program and one day workshop serieseach year. The state agencies have undergone some significant changes but thankfully wehave continued our strong partnership thanks to Duncan's long standing commitment.It was particularly pleasing to see a number of Planners this year, and I encourageeveryone to continue signing up more Planners to attend in future years for the benefit offloodplain management.Executive RepresentationWe were indeed fortunate to be represented by members of our Executive at a number ofsignificant recent events. Director-Planning Sue Ribbons and Director-Technical DavidChairman...Delegates ReportsFloodplain Management Association Meetings... ....Executive Officer87 of 214 March 2012 Ordinary Business PaperPage 149 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGibbins have each delivered presentations at the Emergency Management and BusinessContinuity Summit at Darling Harbour, Sydney in September 2011.Deputy Chairman Clr Larry Bolitho has now represented the FMA at the National FloodForum 2011 in Brisbane in October where his expertise on insurance matters wasparticularly beneficial.lnternational Gommission on lrrigation and DrainageThe 63'd Conference of the lnternational Commission on lrrigation and Drainage, thelrrigation Australia Annual Conference and the 7th AnnualAsian Regional lrrigationConference will be held concurrently in Adelaide from 24lo 30 June 2012.The conference is expected to attract in the order of 500. The program includes a floodplainmanagement component, and the FMA has been invited to assist. This is anotheropportunity for the FMA to network with interstate and overseas practitioners, and increaseknowledge of the FMA. The Executive Officer will participate in the conference programorganising committee.OEH Review of Flood ProgramDuring October Land-use Planning Director Sue Ribbons, the Executive Officer and Iaccompanied representatives from Warringah, Shoalhaven, The Hills and the Hunter at ameeting with OEH staff to provide input to the review.The discussions covered a range of issues which have been raised by FMA members,including support for the NSW Floodplain Development Manual (FDM), the need for expertOEH technical staff to assist members and be champions for sound floodplainmanagement; appropriate levels of funding, affordable funding ratios and rolling programsfor capital and maintenance activities; funding for community education and appropriatedevelopment controls; and the need for consistency of planning policies with the FDM.Thank you to those members who provided issues and information to the Executive, andthank you to those members who participated in the meeting. We are looking forward to thenext progress meeting.Season's GreetingsAs this is our final meeting for 2011,1 would like to take this opportunity to thank membersand delegates, and particularly the Executive Team, for the support you have provided tothe FMA throughout the year. I wish you all the best for a safe, happy and prosperousChristmas and New Year.Clr lan DinhamGhairmanResolved -The Chairman's Report be received.Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer88 of 214 March 2012 Ordinary Business PaperPage 150 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 4 IMMEDIATE PAST CHAIRMAN'S REPORTClr Ezzy advised that on 17 October he represented the FMA, LGSA and ALGA at ameeting of the National Flood Risk Advisory Group (NFRAG) in Brisbane. lssues discussedincluded the National Strategy for Disaster Resilience and draft Communications Strategy,the Australian Flood Studies Database hosted by Geoscience Australia, and progress of theQueensland Reconstruction Authority in planning for more resilient floodplains.He also attended the annual Local Government Association Conference in Nowra inOctober, and there are lessons from that event which can be applied to the FMA's annualconference.Resolved - The lmmediate Past Chairman's Report be received.Item 5 DEPUTY CHAIRMAN'S REPORTClr Bolitho noted that while this is a season of glad tidings and joy, we need to rememberthat it is also a time of destruction and devastation for many. Our task is to help reducehardship for our communities.Clr Bolitho advised that he attended the first National Floods Forum in Brisbane on 6 and 7October. The forum was opened by the Attorney General.There were 7 technical presentations on the first day including various forms of temporarybarriers. A presentation was provided by a group called Emergency Architects Australia(EEA) which provided architects, engineers and students to assist people without floodinsurance. EEA reported that most housing is brick veneer on concrete slab, which sustainsmajor damage when inundated. Many builders now have no experience in building otherforms of construction. The group is working with the University of Newcastle to developmodelling of flood liability of building techniques.The second day included a presentation by the lnsurance Council of Australia. A clearmessage was that if funding for flood mitigation is not restored we cannot afford to increasethe number of houses at risk, and the flood disaster scheme would be at risk. There is astrong push for common definitions across all professions involved in floods. He believesthis would be an unmitigated disaster as the many organisations have differing roles andresponsibilities, and different communication needs.The forum was advised that planners responsible for signing off plans for development infloodprone areas do not need to have formal training in floodplain management. Clr Bolithoadvised forum attendees of the UTS Floodplain Risk Management Course developed inpartnership with OEH and the FMA. Allan Gear reminded the meeting that the Planninglnstitute of Australia (PlA) also encourages its members to attend the FMA annualconference, which is accredited for continuing career development points.On 23 November Clr Bolitho and the Executive Officer attended a meeting with the LocalGovernment and Shires Associations' Director - Policy and Policy Officer for EmergencyServices. Arrangements were agreed for a survey of Councils affected by the 2010 and2011 floods to be undertaken in December/January. The survey will assess Councils' rolesChairman...Delegates ReportsFloodplain Management Association Meetings... ... ....Executive Ofñcer89 of 214 March 2012 Ordinary Business PaperPage 151 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aand costs in flood response and recovery, and their experiences with the Natural DisasterRecovery Arrangements (N DRA).The LGSA has accepted an invitation to participate in the 2012 FMA Conference. ShiresAssociation President Clr Ray Donald will deliver an address at the opening ceremony.Clr Bolitho commented that in the coming year the FMA will need to look at the resources ithas to address the huge range of issues ahead of it, particularly as we move towards thenational conference in 20'13.Resolved - The Deputy Chairman's Report be received.Item 6 EXECUTIVE OFFICER'S REPORTCirculated ReportFMA Corporate and Business PlansThe FMA Constitution requires the organisation to prepare an annual Business Plan, and toreview the Corporate Plan every two years. These plans are based on the Constitution,which Members will recall was unable to be amended at the 2011 AGM.The workshop held after the August meeting commenced the business planning process,and discussed priorities for the FMA; what we are good at; what we need to do better; andhow we can do better. The six highest priorities identified were:o improve funding from all levels of governmento proactively influence the insurance industry. remain relevant - importance as a national organisation / national presence. lobby with professionalism. build continuing professional development. build networks and strategic alliancesThe results of the November workshop will be the basis of the Corporate and BusinessPlans to be presented to the February AGM.The other essential document which needs to be prepared for the AGM is the FMA'srevised Constitution. The Executive has decided that a simplified constitution which allowsmore operational flexibility and responsiveness is more appropriate as the needs of theorganisation change. Accordingly I have commenced preparation of a draft constitutionbased on the requirements of the Model Constitution from the Associations lncorporationAct. I will discuss this briefly at the workshop.It is also extremely important that all Full Members attend the Annual General Meeting atthe Conference in February to ensure that the Constitutional changes can be progressed.MembershipsChairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...90 of 214 March 2012 Ordinary Business PaperPage 152 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThank you to the members who have already renewed their memberships - 77 by 16November. Membership fees are the main source of the FMA's operating income so promptpayment will be greatly appreciated.FMA Mem ber RepresentationKempsey Shire Council has written to the FMA concerning the failure of council's floodwarning system during the 2009 and 2011 floods. Council has raised concerns at thenumber of key stakeholders and the complicated interrelationships involved in current floodwarning arrangements. lt has requested a complete review of arrangements for floodwarning systems in NSW.The matter has been referred to the NSW Flood Warning Consultative Committee of whichthe FMA is a member.2014 FMA GonferenceThe venue for FMA Conferences is determined 2 years in advance. ln January | will berequesting nominations from Full Members to host the 2014 Conference. lf yourorganisation is interested please contact me to obtain the Conference Hosting Manualwhich sets out the requirements.Natural Disaster lnsurance Review - FMA SubmissionAs reported to the August Quarterly Meeting the Director-Technical David Gibbins led thepreparation of the FMA's submission on the Australian Government's Natural Disasterlnsurance Review issues paper. The review is looking at insurance and related mattersfollowing the floods in Queensland and other states.The inquiry's report "Reforming flood insurance - A proposal to improve availability andtransparency" provides 47 recommendations and has been made available for commentuntil 30 March. The report is at Appendix 2.On 14 November the Attorney General Robert McClelland and Assistant Treasurer BillShorten released the Australian Government's response to the recommendations. TheResponse is at Appendix 3.FMA WebsiteClr lsaac Smith will report later in the meeting on his progress in developing the new FMAwebsite. The current website is becoming increasingty difficult to manage, and I askmembers to bear with the very limited amount of information we can make available untilthe new website is operating. When there are items of significant interest they are advisedto members by the FMA Flyers, or email.FMA Quarterly Meeting DatesChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer.91 of 214 March 2012 Ordinary Business PaperPage 153 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThe Annual General Meeting and February Quarterly Meeting will be held at Bateman's Bayon Thursday 23 February 2012.2012 Quarterly Meetings will be held on:Thursday 24 MayThursday 23 AugustThursday 22 NovemberThe venue for the meetings is to be confirmed.I look forward to catching up with you at Batemans Bay in February.Glenn EvansExecutive OfficerAdditional comments from the Executive OfficerThis is the last meeting to be held at McKell Building, as the FMA has been unable tosecure the venue for next year. Members confirmed that a location close to Central RailwayStation is preferable.Resolved - The Executive Officer's Report be received.Item 7 TREASURER'S REPORTGirculated Report2011 Financial PlanThe following budget was adopted at the 2011 AGM for the activities of the FMA for thefinancial year ending 31 December 2011.From 1 July the adopted fee structure exclusive of GST is:o Full Members. ....$1,200. Associate & Corporate Members.........$600. Private Members. .$120. Life Members. .........Ni1Progress towards 2011 Financial Plan as at 31 October 2011- tabled page 9Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer92 of 214 March 2012 Ordinary Business PaperPage 154 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alncomeJan-Oct2011 ActualGx GST)2011 Budget(ex GST)2010 Actual(ex GST)2010Budget(inc GST)Membership fees93,340101,64092,70093,500lnterest5,0503,00030431,000Sundry (1)6,4684,000279,000Australian Taxation Office2,000Total lncomeExpenditure104.858Jan-Oct2011 Actual(ex GST)108,640 95,770 105,500201 IBudget (exGSD2010 Actual(ex GSÍ2010Budget(inc GST)Accountancy Fees1,8202,00000Audit Fees8001,3004,0104,000Chairman's Allowances5,0977,0007,5006,000Executive Services42,11355,00043,31435,000Special Executive Services2,0007,000Annual Conference Expenses & Travel1,8078,00034,5048,000Entertainment6711,0001,000Depreciation1,000Media/Promotions3,0005,000Miscellaneous1002,0002524,000Lobbying2,0002,000Printing & Stationery5602,700Website2,65520,0003,0855,000Member Visitation, Travel4,53713,0004,000Legal8364,0002,8704,000Floodplain Professional Education1,00030,00035,000Australian Taxation Office1,000FMA Scholarship2,000Total Expenditure 60,997 127,000 125,536 121,000Surplusi(Deficit) 43,861 (18,360) (29,765) (15,500)Chairman...Delegates ReportsFloodplain Management Association Meetings...........Executive Officer93 of 214 March 2012 Ordinary Business PaperPage 155 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOpening Retained profits202,516151 ,706181,471181,471Net ProfiU(Loss) attri butable(6,949)(18,360)(29,765)(15,500)Closino retained profits 195.567 133.346 151,706 165,971Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer94 of 214 March 2012 Ordinary Business PaperPage 156 of 555 of the March 2012 Ordinary Business Paperl0

Attacment 8.2.aJan-Oct2011 ActualBalancesheef as at 31/10/2011 þx GST)Cash Asseús2010 Actual(ex GST)Cash at bank 43,751 37,474Term deposit 06 2546 50093990 60,060Term deposit #10938,47540,000Term deposit #11792.16140,000Total Currenf Assefs;195,972 155,949Non-Currenf AsseúsPPEWeb designLess AJdepreciationTotal Non-Current AssefsTotalAssets195,971 .61 155.949Current LiabilitiesCurrent Tax liabilitiesGST clearing(177)3,243Amounts withheld from S&W5821.000Total Gurrent LiabilitiesTotal LiabilitiesNet AssetsBalance per bank statement at31t10t2011Less outstanding cheques405 4.243405 4,243195,567 151 ,70653,570.40(8,822.81)Plus Term Deposit #990Plus Term Deposit #11760,059.5492.161.12Total available cash at3111012011. 196,968.25Notes to financial statements(1) Sundry income from 2011 pre-conference workshop registrat¡on fee.Chairman....Delegates ReportsFloodplain Management Association Meetings....Executive Officer......95 of 214 March 2012 Ordinary Business PaperPage 157 of 555 of the March 2012 Ordinary Business Paperil

Attacment 8.2.aCheques Drawn 01 101 12011 - 31 110/,2011Date Cheque Amount Comments24t08t2011 446 941.84 I Dinham US trip exp & Ministerial meetinq 1110824t18t2011 447 5.823.58 G Evans Exec Services & Exp reimbursement25t08t2011 448 339.00 SA & GA Michael- Qtlv meetinq caterinq26t0812011 449 90.80 I Dinham - Qtlv meetinq exp19t0912011 450 4,902.58 G Evans Exec Services4t10t2011 451 1,725.00 I Dinham - River Svmposium exp reimbursement6t10t2011 452 1167.67 I Dinham - Chair allowance Jlv to Sep 201119t10t2011 453 4.335.00 G Evans Exec Services19t1012011 454 2.250.00 Summerland Web Development 50% deposit25t10t2011 455 242.81 I Dinham - Meetinq expenses 191101201131t10t2011 456 396.00 Accountcorp - Jlv to Sept 2011 BAS31t1012011 457 8.184.00 ATO - Jlv to Sept 2011 BASTreasurer's CommentsThe FMA's cash position remains strong. lncome will increase over the next two months asremaining annual membership subscriptions are paid. The FMA presently has two termdeposits for terms of 5 and 3 months with an interest rate of 5.5%.Glenn EvansTreasurerResolved - Treasurer's Report be received.Item I REPORTS from EXECUTIVE COMMITTEE8.1 Director - Technical David GibbinsCirculated ReportMr Gibbins was unable to attend the meeting. His report was presented by the ExecutiveOffìcer.Chairman....Delegates ReportsFloodplain Management Association Meetings-.. ... ....Executive Officer96 of 214 March 2012 Ordinary Business PaperPage 158 of 555 of the March 2012 Ordinary Business Papert2

Attacment 8.2.aUTS Floodplain Risk Management Short Course 2011This course was developed and is presented by the University of Technology Sydney inconjunction with the FMA and NSW Office of Environment and Heritage (OEH). The courseshows how to develop and implement floodplain risk management in accordance with theNSW Government Flood Policy and Manual. lt is taught by industry experts, includingthose from (OEH), NSW State Emergency Service, Local Government and consultancy.The course is managed by Dr Jaya Kandasamy of UTS.Enrolment was at capacity indicating the success of this joint venture. Those enrolled didinclude a wide range of industry and student representation.Presenters at "Block 2" on 15 and 16 September this year included the Chair of the FMAClr lan Dinham, and Mr Duncan Mcluckie (OEH) and myself (Chapter 8: Managing risk inareas of existing development - originally developed by Mr Pas Silveri of WollongongCouncil - and supplemented with my experience of Newcastle 2007 "Pasha" flash floods.)lan gave many cases of interest with compelling images of flood management in real life -and challenged the students with some examples of calculating flood damages to workthrough for themselves during his lecture.I highly recommend this course to FMA members and those associated with them in theoften controversial and difficult journeys encountered in the development andimplementation of Floodplain Risk Management Plans.Emergency Management and Business Gontinuity SummitDirector Land-use Planning Sue Ribbons and I both presented at this summit held inSydney 20 - 21 September. The event was well attended by emergency management,government and business representatives from across Australia - and overseas.The opening keynote speaker was New Orleans' former Mayor C. Ray Nagin whointroduced New Orleans as a city with a rich culture of jazz - devastated by HurricaneKatrina (2005) - and the work towards recovery after his re-election (2006). He was frank,entertaining and presented a rigorous understanding of the issues across human, political,financial and legislative dimensions. Ray was introduced by Professor Ed Blakely(University of Sydney), internationally known for his work in Urban Policy and disasterrecovery. (See http://ussc.edu.au/news-room/Ray-Nagin-on-post-Katrina-New-Orleans forEd interviewing Ray 29 September 2011.)Presenters and delegates came from across Australia, from Government emergencymanagement, and CSIRO - and included former Deputy Director of the NSW SES Dr ChasKeys. Chas observed floodplain risk management in NSW seems to be losing its positionof Australian and even international leadership with reduced land use planning rigour - andneeds a renewed high level of support from Government - State and Federal. Presentationson the innovative use of social media in emergency response were amazing.Sue provided a case study on Sea Level Rise - Understanding and Communicating ClimateRisks for Coastal Communities. I spoke on Flood Response Measures and DevelopingDisaster Resilience Leadership, using Newcastle as a case study. ln Newcastle there isthe potential for the capacity of emergency management to be ovenruhelmed in extremeflash flood events placing many thousands of lives at risk.Chairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...97 of 214 March 2012 Ordinary Business PaperPage 159 of 555 of the March 2012 Ordinary Business Paper13

Attacment 8.2.aI commend the Summit presentations to you, which (as the Executive Officer has previouslyadvised) are at www.halledit.com.aulemergencyemansummitl 1/presentations/2012 FMA GonferenceI have been privileged to participate on the Review Panel for the up and comingConference (www.floodplainconference.com). This year more than 50% more abstractswere received than last year. The diversity of topics and authors - with a significant numberfrom across Australia and overseas - coupled with the very high quality of abstracts -certainly made the Panel's task lengthy and challenging.The result, I believe, will be an outstanding conference hosted by Eurobodalla Shire Councilin the wonderful setting of Bateman's Bay. The theme of the conference is "Riding theFlood of Change - turning risk into opportunity". The conference dates are 21-24 February2012 - with 'early bird' registrations closing Friday 9th December 2011. I urge you toregister - and to register early!Goming: The FMA at a National Flood Modelling and Mapping WorkshopThe National Emergency Management Committee (Australian Government - Attorney-General's Department) has planned that its Risk Assessment, Measurement and MitigationSub-committee (RAMMS) will hold a two day workshop to develop an agreed methodologyto map areas of risk relating to riverine and flash flooding, storm surge and coastalinundation which willfacilitate a nationally consistent approach to future flood mapping andmodelling.Participants at this workshop will include members from RAMMS, the National Flood RiskAdvisory Group, Geoscience Australia, the National Spatial lnformation ManagementWorking Group, Engineers Australia and the Floodplain Management Association. I will berepresenting the FMA, and Mr Duncan Mcluckie (OEH) will also be attending.The workshops are scheduled for 28 and 29 November 2011. I will report to the FMA onthe workshops and outcomes.ThanksThank you for the opportunity to serve the members of the FMA in this way. Please do nothesitate to contact me if there is anything you wish to raise or discuss with me. I will beonly too happy to help in whatever way I can.David GibbinsDirector - TechnicalResolved -The report be received.8.2 Director - Land Use Planning Sue RibbonsNSW Planning ReviewOn 12 July 201 1, the Hon Brad Hazzard, Minister for Planning and lnfrastructure,announced that a total review of the NSW Planning System (particularly the Environmental,Planning and Assessment Act, 1979) would be undertaken in the next 18 months with theChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer...98 of 214 March 2012 Ordinary Business PaperPage 160 of 555 of the March 2012 Ordinary Business Papert4

Attacment 8.2.aaim to create new planning legislation for NSW. The NSW Government has established anindependent panel to review the EP&A Act along with the broader planning system. Thereview has been divided into the following 5 milestones:Milestone 1: Review AnnouncementMilestone 2: Listening and Scoping (current phase) - The Review process commenced withan extensive listening and consultation process between September and December 2011toseek the community's views on what should be the broad underpinning principles for newlegislation to replace the Environmental Planning and Assessment Act l9T9.Consultationinvolved the following: Stakeholder Meetings with a range of peak interest groups inSydney; Community Forums at more than 40 locations across NSW; other writtensubmissions - a written submission was prepared by the FMA (see summary of issuesbelow).All submissions, including the FMA's submission, together with notes taken during theStakeholder Meetings and Community Forums are included on the NSW Planning Reviewwebsite (see link below). Written submissions closed on Friday 4 November 2011 forinclusion in the Milestone 3 lssues Paper.Milestone 3: lssues Paper - An lssues Paper will be released in early December 2011 thatwill cover the ideas and feedback received during the Listening and Scoping phase. Afterthe lssues Paper is released in early December, further feedback and comment will beinvited to be received by Friday 17 February 2012.Milestone 4: Policy Options Release - After considering public comments made during theconsultation phase and in response to the December lssues Paper, a Green Paper will beprepared. The Green Paper will set out the recommended structure for a new planningsystem and will be published by the end of April 2012.Milestone 5: Draft Legislation - A'white paper' and draft legislation will be released forexhibition before a bill is submitted to the NSW Parliament. Details of timing will bepublished in due course.Links to further information about the NSW Planning Review are as follows:NSW Planning Review website: uruvw. plan ning review. nsw. gov.auNSW Planning Review Fact Sheet:www.planning.nsw.gov.au/LinkClick.aspx?fileticket=FTYyGHNqTG0%3d&tabid=68&language=en-AUThe summary of issues presented in the FMA's submission is provided below:Chairman....Delegates ReportsFloodplain Management Association Meetings..........Executive Ofltcer99 of 214 March 2012 Ordinary Business PaperPage 161 of 555 of the March 2012 Ordinary Business Paperl5

Attacment 8.2.aFLOODPLAIN RISK MANAGEMENT STARTS WITH LAND USE PLANNING -SUMMARY OF ISSUES FOR NSW PLANNING REVIEWFloodplain risk management involves protecting life and property from floods. With costlyflood mitigation works becoming further and further out of reach from most local councilsand the ever increasing reliance on evacuation only increasing risk to life during floods, theonly way to prevent the cost of flooding from escalating in the future, is through land useplanning.It is therefore of concern that in the past five years and even in light of the publicitysurrounding the devastating floods in Brisbane in January this year, the Department ofPlanning and lnfrastructure has flouted, and has continued to flout, it's own government'sState Flood-Prone Land Policy, by reducing the controls required for development on floodproneland. This has been carried out through apparent ad-hoc changes to legislationwithout adequate consultation with:. Office of Environment and Heritage-Flood Prone Land Policy;who manage the NSW Government. State Emergency Service-who manage the emergency response toinappropriate development on flood-prone land when floods occur; and. local councils-land.who manage the land use and development on flood-proneIt is therefore RECOMMENDED, as part of the NSW Planning Review, that considerationbe given to the following key issues relating to floodplain risk management:. lssue I the repeal of Planning Circular PS07-003 New Guideline and-Changes to Section 117 Direction and EP&A Regulation on Flood Prone Land;. lssue 2 the need for recognition of flood risks above the 100 year flood level forall development types;. lssue 3 the need for consistency with the state government's own FloodplainDevelopment Manual;. lssue 4 the need for a clear definition of flood-prone land in the Standardlnstrument LEP;. lssue 5 the need for a clear definition of 'significant adverse impacts' in theStandard lnstrument LEP;olssue 6 acknowledgment that flood mapping is highly technical, costly andtime-consuming and so is beyond the resources and expertise of many localcouncils;Chairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer...100 of 214 March 2012 Ordinary Business PaperPage 162 of 555 of the March 2012 Ordinary Business Paper16

Attacment 8.2.aolssue 7 the repeal of that part of State Environmental Planning Policy (Exemptand Complying Development Codes) 2008 that permits complying developmenton flood-prone land.More detail on each of these issues is provided in the full submission - attached asAppendix 4.Review of NSW Flood ProgramOn 19 October 2011,1 was fortunate to be involved in a meeting with representatives fromvarious Councils, the FMA and OEH to discuss a range of issues relating to the Review ofthe NSW Flood Program. This was a great opportunity to discuss a positive path fonruardfor the NSW Flood Program. One of the key messages from the FMA was that the Office ofEnvironment and Heritage, as custodians of the NSW Flood Program, need to championthe NSW Flood Prone Land Policy and the Floodplain Development Manual, providetechnical assistance to local councils (and not merely be grant administrators), as well asensuring a consistent approach to the intentions of the Policy and the Manual across allState Government departments and other agencies.Sue RibbonsDirector - Land Use Planningln regard to the NSW Planning Review Wal Mills noted that there are also flood risks forproperties which are above flood level, such as isolation due to flooded access roads andloss of electricity, water and sewerage services.Resolved -The report be received.8.3 Communications Officer Glr lsaac SmithCirculated ReportWebsite UpdateClr Smith was unable to attend the meeting. His report was presented by the ExecutiveOfficer.Development of the New FMA Website is currently being undertaken by Summerland WebService. The aim is to have the site ready by mid-December, with all functions available formembers to use.What does the development entail?1 - Complete redesign using the open source Content Management System (CMS),Joomla, which is the world's leading CMS for Not for Profit Organisations -http ://www.j oom la. orq2 - lmprovement in the "look and feel" so it is not like the current one, and seems moremodern and useable.Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer101 of 214 March 2012 Ordinary Business PaperPage 163 of 555 of the March 2012 Ordinary Business Papert7

Attacment 8.2.a3 - A redesign of all areas to include the following features:. lnclusion of a public discussion mechanism so members can have their say onissues. This will be in the format of a comment system, not a forum. This will provide amore structured and public discussion.. Newsletter emailed from and linked back to website. This will replace emailed worddocuments.. Latest news and floodplain information. Case studies/project. lnfo on Agencies and Key contacts (including history of acronyms). BOM info reports (McKay update etc.). Funding news. links to relevant national and international groups. Current and past conferences (including all available documents). Committee information (includes papers, meeting info)4. The site will be hosted on a fast and secure Australian Server based in Brisbane.The aim of the redevelopment is to create a useable space for flood managementprofessionals who want current information with the ability to see examples of best practiceprojects and opportunities to network with others in floodplain management.There will be time for members to feedback and "break in" the new site in late December,early January. I hope that it will excite members and provide a fantastic resource forFloodplain professionals across Australia.lsaac SmithCom munications OfficerResolved -The report be received.Item 9 REPORTS from CONFERENCE HOSTS9.1 Report from Eurobodalla,20'12 GonferenceThe Executive Officer provided a progress report.The Call for Abstract was very successful with a record number, 64, being received. Thereview panel had an extremely difficult task selecting the 42 which could be accommodatedin the program. Most abstracts were of very high standard, and it is unfortunate that morecould not be accepted. Thank you to all who contributed.Duncan Mcluckie provided an update on the pre-conference workshops.The conference has been promoted at the Emergency Management and BusinessContinuity Summit, the Queensland and NSW Coastal Conferences and through weekly e-advertising in CareeSpot, GreenCarer and WaterCarer.Almost all sponsorship opportunities and trade exhibition sites have been taken up and at21 November 22 registrations had been received.Delegates were reminded of theChairman..Delegates ReportsFloodplain Management Association Meetings....Executive Officer...102 of 214 March 2012 Ordinary Business PaperPage 164 of 555 of the March 2012 Ordinary Business Paper18

Attacment 8.2.aDecember 9 closing date for the early registration discount, and the need for membership tobe current to receive the members' discount.Resolved -The report be received.9.2 Report from Tweed, 2013 National ConferenceDanny Rose provided a progress report. lnitial planning is proceeding well, and the TwinTowns Resort at Tweed Heads has been reserved for the venue. Tenders for theconference management services are presently being assessed.Mr Rose requested any members who have interstate colleagues to provide him withcontact details.Resolved -The report be received.Item 10 AGENCY REPORTS10.1 Office of Environment and HeritageDuncan McLuckie commented on the Natural Disaster lnsurance Review, and concernsthat there is no standard definition of overland flooding. He advised that this is presentlyappropriately covered by stormwater definitions in most insurance policies.The NSW Flood Database Project is currently being refined, and comments will be soughtfrom the review group which includes the FMA. The project is specifically referenced in thestate plan NSW 2021.Satisfactory progress is being made on the National Flood Manual and Visual Levee AuditMethodology project.Mr Mcluckie advised that a draft revised Temporary Barrier Guideline has been preparedto provide more clarity. lt is now has to go through internal review processes.Steven Molino commented on the 3 manuals covering appropriate building and subdivisiondesigns and planning considerations for the Hawkesbury catchment stating that they couldnot be easily found on government websites. Carolyn Davies advised that they will be madeavailable on the OEH website.Mike Sharpin provided a progress report on the internal review of the flood program. Thereview is to consider the appropriateness, effectiveness and efficiency of the flood programand its delivery. A productive meeting had been held with the FMA at the issues stage.Overall there is no justification for large scale change of the flood program. The focus willbe on improving targeting of resources, improving data management, and more integratedknowledge of where of where flood risks are. For instance at present it is not possible toreport on how many properties have benefitted from investment from the flood program.An action from the review will be some form of rolling program for the preparation of floodrisk management plans, and their implementation.Chairman...Delegates ReportsFloodplain Management Association Meetings..........Executive Officer103 of 214 March 2012 Ordinary Business PaperPage 165 of 555 of the March 2012 Ordinary Business Papert9

Attacment 8.2.aIt is proposed have another meeting with the FMA before Christmas, and to report on thereview findings and recommendations at the FMA Conference.Carolyn Davies advised that in response to the skills shortage across councils and theNSW Government in the floodplain management area OEH will be engaging a consultant toundertake a skills audit. The FMA will be invited to provide input.The audit will identify skills available now, and needs for the future. The audit is planned tobe complete in March.Clr Ezzy commented that in regard to the proposed introduction of a rolling funding programthis is an issue which the FMA has been pursuing for a number of years and OEH is to becongratulated on this undertaking.Resolved -The report be received.10.2 State Emergency ServiceSimon Opper was unavailable to attend due to operational priorities resulting from floodingin northern NSW.10.3 Bureau of MeterologyGirculated ReportNSW River Gauging NetworkThere is currently a review of a number of the activities related to the river gauging networkcurrently operated by the NSW Office of Water (NOW). NOW manages most of the realtime river gauges outside the tidal limit in NSW. A number of agencies contribute to theoperation of this network including State Water Corporation which through its water chargesto irrigators funds about 50% of the real time network (or some 35% of the overall network)as it uses this data for its river and dam operations.There is reportedly a push that State Water Corporation take over these hydrometricactivities of NOW.Data from the NOW network underpins most of the flood warning services provided by theBureau for NSW. The Bureau relies heavily on NOW's technical expertise, support andsystems to provide it with real time data via its FTP link. The Bureau is concerned over thelong term operation of this network with respect to priorities afforded by a water supplyutility to the other 50% of the real time network, which is of no direct concern to them, aswell as their capacity to operate a sophisticated realtime data collection and managementsystem.I presented a paper on this issue to the 2005 FMA Conference at Narooma (see Appendix5)Seasonal OutlookThe outlook for November 2011to January 2012 is that a wetter than average season islikely for large parts or northern, eastern and southwest Australia. The figures belowChairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer104 of 214 March 2012 Ordinary Business PaperPage 166 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.acompare this year's rainfall outlook with last year's. The rainfall outlook for NSW is verysimilar to last year, however, conditions in the Pacific Ocean have just reached La Niñathresholds and forecasts are for it to be a weak to moderate event. At the same time lastyear the La Niña was already at near record levels. A stronger system generally enhancesthe chance of high rainfall.The July to September rainfall in NSW has also been considerably less than last year -which also reflects the climatic conditions.Will there be major flooding in NSW?Obviously there is a higher risk of major flooding during a wetter than average season.However it is not possible to predict the nature or location of floods based upon theseasonal outlook. For example, last year's rainfall outlook for north-west Victoria was for a60% chance of above median rain and they got record rainfall and some record majorfloods in that part of the state. Similarly in NSW, the Gwydir Valley in northern NSW wasthe only major river in the Murray Darling Basin to receive no flood warnings last year,despite the strong 75o/o chance of above median rainfall prediction.Gordon McKayRegional Hydrology ManagerMr McKay's powerpoint presentation is at Appendix 6.Discussion followed on the NSW River Gauging Network.Resolved -1.The report be received.2.The FMA write to the New South Wales Office of Water (NOW) to ask thestatus of River Gauge management and funding.Chairman...Delegates ReportsFloodplain Management Association Meetings.......Executive Officer....105 of 214 March 2012 Ordinary Business PaperPage 167 of 555 of the March 2012 Ordinary Business Paper21

Attacment 8.2.a80fo\\.509tÌT;9o¡0y.ßLtüròü6%5096.15%¿Írss$fòsdrá2Ë36ffioGharceof ørceed¡ru&o nréf,an Räinfaåt¡o'ÆßÈer 201 t h J¿¡lmy â1tFfûducl âl llæ t¡âËonâl clîâts GerrlrÊ8CtåWVr7W6!EtûTrwx$altt,ã,"r¡at6eÞ?Ë$0tr¡ 4Ìri{):iitflq231É?tlt|ûMdffiËla,A&EGhance oi ercêeÉrg fte rcdiaJr FIR¡nfsttlovafte¡ æ1ô ÞJüiqrarf 4!1PfDù.ül Ðl tfÉ liJâltrÊd c&lìdê GãitfÊ'tÊdrtu¡.ùth-4àì\ JUFItem 11 FMA SURVEYFlood Definition / Categorisation and s149 Planning Gertificate MessagesVic Tysoe from Gosford Council provided a presentation on the outcomes of the surveywhich was undertaken on behalf of the FMA. The presentation is at Appendix 7.Chairman...Delegates ReportsFloodplain Management Association Meetings.Executive Officer...106 of 214 March 2012 Ordinary Business PaperPage 168 of 555 of the March 2012 Ordinary Business Paper22

Attacment 8.2.aMr Tysoe advised that he would welcome comments or questions concerning the survey.The Chairman acknowledged the significant effort involved in undeftaking the study, andthe valuable assistance the information provides to members.Item 12 ITEMS LISTED FOR DISCUSSION BY MEMBERSNo business was listed.Item l3 GENERAL BUSINESSSteven Molino advised that he has been working with Newcastle City Council on its citywide flood risk management study and plan. He had been seeking information on criticalinfrastructure which is held by SES for emergency management purposes, but it is not clearif this information is able to be released for use in flood studies. He has been seekingclarification from the Land and Property lnformation Authority. Duncan Mcluckie advisedthat OEH will pursue the issue.Allan Gear advised that he was involved with judging the recent Excellence in PlanningAwards, and he encouraged members with floodplain management elements in their plansto enter the competition next year.He also advised that the Planning lnstitute of Australia (PlA) wishes to be an industrysupporter for the 2012 and 2013 FMA Conferences.Item 14 NEXT MEETINGThe next scheduled meetings are the February Quarterly Meeting and the Annual GeneralMeeting to be held on 23 February,2012 at the 52nd Floodplain Management AssociationConference at Bateman's Bay.The meeting closed at 1 :1Opm.List of AppendicesAppendix I Minutes August Quarterly Meeting - lssued 5 October - available from EOAppendix 2 Reforming flood insurance - A proposal to improve availability and transparency -available from EOAppendix 3 Government Response to the NDIR Recommendations - available from EOAppendix 4 FMA Submission to the NSW Planning Review - available from EOAppendix 5 BoM 2005 Conference Paper - available from EOAppendix 6 BoM 24 November 2011 Report - provided separatelyAppendix 7 Flood Definition Survey- available from EOAppendix I Attendance and ApologiesAppendix 9 Workshop -Floods and Social Media- provided separatelyChairman...Delegates ReportsFloodplain Management Association Meetings....Executive Officer...107 of 214 March 2012 Ordinary Business PaperPage 169 of 555 of the March 2012 Ordinary Business Paper23

Attacment 8.2.aAppendix 924 t 11 t2011NAME ORGANISATION FULLDELEGATESMEMBERBala Sudarson Auburn City Council 1 1Cherie Blackburn Bankstown City Council 2 1Darren Sturgiss Bathurst Council 3 1John Molteno Blacktown City Council 4 1Gordon McKayBureau of MeterologyMaria Pinto Camden Council 5 1Gamini Hattotuwa Campbelltown City Council 6 1Austin Morris City of Ryde 7 1Clr lan Dinham Clarence Valley Council 8 1Nilmini De Silva Fairfield City Council I 1Glenn EvansDaniel ManolacheFMAFM GlobalVic Tysoe Gosford City Council 10 1Phillip Pleffer Hawkesbury City Council 11 1Pam Colman Holroyd Council 12 3Mark Evens Holroyd Council 12Allan Ezzy Holroyd Council 12Dean Chapman Hunter-Central Rivers CMA 13 1Stephen Leeslndividual MemberChairman....Delegates ReportsFloodplain Management Association Meetings..........Executive Officer108 of 214 March 2012 Ordinary Business PaperPage 170 of 555 of the March 2012 Ordinary Business Paper24

Attacment 8.2.aNAME ORGANISATION FULLDELEGATESMEMBERWal Millslndividual MemberPeter Harle Liverpool City Council 11 2Jeff Organ Liverpool City Council 12Arch Humphrey Maitland City Council 13 1Steven MolinoCarolyn DaviesLara DavisDuncan McluckieMike SharpinMolino StewartOEHOEHOEHOEHPaul Hackney Parramatta Council 14 1Ratnam Thilliyar Penrith City Council 15 2Adam Wilkinson Penrith City Council 15Janell Keegan Pittwater Council 16 2Sue Ribbons Pittwater Council 16Terry Kefalianos Randwick Council 17 1MichaelWood Richmond River County Cl 18 1Larry Bolitho The Hills Shire Council 18 2Allan Gear The Hills Shire Council 18Danny Rose Tweed Shire Council 19 1Lindsay Tanner Wagga Wagga City Council 20 1Peter Garland Wollongong City Council 21 1Alam Shah Wyong Shire Council 22 1Chairman...Delegates ReportsFloodplain Management Association MeetingsExecutive Officer......109 of 214 March 2012 Ordinary Business PaperPage 171 of 555 of the March 2012 Ordinary Business Paper25

Attacment 8.2.a22Full Members in attendance 31 Delegates in attendance2 Associate/ Corporate Members in attendance2 lndividual Members Total attendance 41resGlenn MounserJeff BaldockMalikeh MichelsPeter JenningsAllan BrownNorm LehehanBetty GreenGreg Joneslsaac SmithBen BecarriDavid GibbinsSimon OpperJohn CarseDebbi MillenerBillWheeldonADW JohnsonAlbury City CouncilAuburn City CouncilCessnock City CouncilEurobodalla Shire CouncilEurobodalla Shire CouncilKempsey Shire CouncilLake Macquarie City Council (US Study tour)Lismore City CouncilMinistry of Police and Emergency ServicesNewcastle City CouncilSESSydney Metropolitan CMAWarringah CouncilWentworth CouncilChairman....Delegates ReportsFloodplain Management Association Meetings.......Executive Officer...110 of 214 March 2012 Ordinary Business PaperPage 172 of 555 of the March 2012 Ordinary Business Paper26

Attacment 8.2.aFloodplainManagementAssociationBusiness papers2012FEBRUARY QUARTERLY MEETI NGandANNUAL GENERAL MEETINGChairman.......Executive Officer......Delegates ReportsFloodplain Management Association Meetings111 of 214 March 2012 Ordinary Business PaperPage 173 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBLANK PAGEChairman................Executive Officer.Delegates ReportsFloodplain Management Association Meetings112 of 214 March 2012 Ordinary Business PaperPage 174 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplainManagementAssociationBUSINESS PAPERS, FEBRUARY 2012 QUARTERLY MEETING1:15 pm, Thursday 23 FebruârY, 2012The Auditorium, Batemans Bay Soldiers Glub,Batemans Bay, NSWTo be immediately followed by the Annual General MeetingItem 1Item 2Item 3Item 4Item 5Item 6ApologiesConfirmation of Minutes of Quarterly Meeting oÍ 24November,2012Chairman's ReportTreasurer's ReportGeneral BusinessNext Scheduled Meeting / GloseChairman.......Executive OfficerDelegates ReportsFloodplain Management Association Meetings113 of 214 March 2012 Ordinary Business PaperPage 175 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 1 APOLOGIESCall for apologies in addition to those held by the Executive Offlcer.Move ....."Thatthe apologies be accepted."Item 2 CONFIRMATION OF QUARTERLY MEETING MINUTESMinutes of the November 2011 Quarterly Meeting have been circulated.Move....."That the Minutes as circulated be accepted as a true record of the QuarterlyMeeting of 24 November 2011."Business arising from the Minutes not covered elsewhere in the agenda.Item 3 CHA¡RMAN'S REPORTWelcome to the February 2012 Quarterly Meeting.As has become our custom my report is provided in the Annual General Meeting BusinessPapers. Similarly reports by the Executive Officer, Executive Committee Members andAgencies are contained in the AGM papers.The February Quarterly Meeting has the largest attendance of the year, and I would like toinvite you all to also attend our other quarterly meetings held during the year. They provideopportunities for more in depth discussion, and are held in conjunction with afternoonworkshops.This year's Quarterly Meetings will be held at the meeting room of the Bureau ofMeteorology in Sydney on the following dates:Thursday 24 May 2012Thursday 23 August 2012Thursday 22 November 2012I hope to see you there.Clr lan DinhamChairmanMove......"That the Chairman's Report be adopted."Chairman...... ....Executive OfficerDelegates ReportsFloodplain Management Association Meetings114 of 214 March 2012 Ordinary Business PaperPage 176 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 4 TREASURER'S REPOR]2011 Financial PlanThe following budget was adopted at the 2011 AGM for the activities of the FMA for thefinancial year ending 31 December 2011.From 1 July the adopted fee structure (exclusive of GST) is:. Full Members.. ..$1,200. Associate & Corporate Members.........$600. Private Members.. ...............$120. Life Members.. ......Ni|Actual results to 2011 Financial Plan as at 31 December 2011lncome and Expenditure Statement for Period ending 31 December 2011IncomeMembership feeslnterestSundry (1)Australian Taxation Office2011 Actualhx GST)2011 Budget/ex GSI)2010 Actual/ex GSI)2010Budget (incGSn103,060 101,@+0 92,700 93,5006.054 3.000 3043 1.0006,984 4,000 27.27 9,0002,000Totallncome 1 16.098 108.640 95.770 105,500Chairman..........Executive OfficerDelegates ReportsFloodplain Management Association Meetings115 of 214 March 2012 Ordinary Business PaperPage 177 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aExpenditure2011 Actual(ex GSI)2011 Budget(ex GSfl2010 Actual(ex GST)2010Budget (ncGST)Accountancv Fees 1.760 2.000Audit Fees 800 1,300 4,010 4.000Chairman's Allowances 6.847 7.000 7.500 6.000Executive Services 50,783 55.000 43.314 35,000Soecial Executive Services 2.000 7.000Annual Conference Expenses & Travel 7.142 8.000 34.504 8,000Entertainment 972 1.000 1,000Deoreciation 1.000Media/Promotions 572 3,000 5,000Miscellaneous 161 2.000 252 4.000Lobbvinq 2.000 2,000Printinq & Stationerv 560 2,700Website (2) 2,655 20.000 3,085 5.000Member Visitation, Travel 5.776 13,000 4,000Leqal 836 4.000 2.870 4,000Floodolain Professional Education 1,000 30,000 35.000Australian Taxation Office 1.000FMA Scholarship (3) 2,000Total Exoenditure 78,866 127.000 125,536 121 .000Surplus/(Deficit) 37,233 *e36ry 12s,7$e) {r 5,5ûû)Opening Retained prdits : 151,706 151 ,706 181,471 181,471Net ProfiU(Loss) attri butable: 37,233 {1S,3fiü} i2ç,7e53 {1ã,5{iû)Glosing retained profits: 188,939 133,346 151,706 165,971Chairman.......Executive OffìcerDelegates ReportsFloodplain Management Association Meetings116 of 214 March 2012 Ordinary Business PaperPage 178 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBalance sheet as at 31 11212011Cash AsseúsCash at bankTerm deposit 06 2546 50093990Term deposit#109Term deposil#117TotalCurrenf Assefs;2011 Actual(ex GST)37,15460,89292,161190,2072010 Actual(ex GSI)37,47438,47540,00040,000155,949Non-CurrenúAssefsPPEWeb designLess A/depreciationTotal N o n - Curren f ,AssefsTotalAssets190,207155,949Current LiabilitiesCu rrent Tax liabilitiesGST clearingAmounts withheld from S&WTotal Current LiabilitiesTotal LiabilitiesNet Assets1041.1641,2681,268188,9393,2431,0004,2434,243151,706Balance per bank statement at31t12t2011Less outstanding cheques37,424{26s.99iPlus Term Deposit #99060,892.14Plus Term Deposit #1 17161.12Total available cash al 31 1101201 1:190,206.84Chairman..........Executive OfficerDelegates ReportsFloodplain Management Association Meetings117 of 214 March 2012 Ordinary Business PaperPage 179 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNotes to financial statements(1) Sundry income from 2011 pre-conferenceworkshop registration fees $5,316; balance isreimbursement of conference registration for Kempsey member(2) Website - new website provided for a substantially reduced amount to budget.Estimated $5k still to be expended on development related matters.(3) Scholarship tour undertaken and payment anticipated to be made in 2012.Cheques Drawn 01 111 12011 - 3111212011Date Cheque Amount Comments22t11t2011 458 4.398.30 G Evans Exec Services & Exp reimbursement24t11t2011 459 329.00 SA & GA Michael- Qtlv meetinq caterinq1511212011 460 '1.167.67 I Dinham - Chair allowarce Oct to Dec201115112t2011 461 4.646.45 G Evans Exec Services & Exp reimbursement15t12t2011 462 3.027.00 Frame Promotional Prodlcts 50% deposit15112t2011 463 269 99 D Gibbins Accommodation reimbursement15t12t2011 464 2A29.30 Cancelled15t12t2011 465 718-70 I Dinham Travel Exp meetins 1611112011The Esplanade Motor lnn - Annual Conference15t12t2011 466 2.904.00 Accommodation for Executive16112t2011 467 2,030.00Floodplain Mgt Assoc Conference - transfer tworeqistrations incorrectlv oaid to FMATreasurer's CommentsThe FMA's cash position remains strong. The FMA presently has two term deposits forterms of 5 and 3 months with an interest rate of 5.5%.Glenn EvansTreasurerMove......... "That the Treasurer's Report be received".Item 5 GENERAL BUSINESSItem 6 NEXT MEETINGThe next scheduled meeting is the May Quarterly Meeting to be held on 24 May,2012 atthe meeting room of the Bureau of Meteorology in Sydney commencing at 11am.List of AppendicesAppendix IMinutes November 2012 Quarterly Meeting - lssued 13 December, available from EOChairman.......Executive OfficerDelegates ReportsFloodplain Management Association Meetings118 of 214 March 2012 Ordinary Business PaperPage 180 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplainManagementAssociationBUSINESS PAPERS, FEBRUARY 2012 ANNUAL GENERAL MEETING1;20 pm, Thursday 23 Februâry, 2012The Auditorium, Batemans Bay Soldiers Club,Batemans Bay, NSWimmediately following the February Quarterly MeetingItem 1Item 2Item 3Item 4Item 5Item 6Item 7Item IItem 9Item 10Iteml lItem 12FMA Meeting Procedures, appointment of ScrutineersApologiesConfirmation of Minutes oÍ 2011 Annual General MeetingGhairman's Reportlmmediate Past Ghairman's ReportDeputy Ghairman's ReportExecutive Officer's ReportTreasurer's ReportReports from Executive CommitteeDirector - TechnicalDirector - Land-Use PlanningCommunications OfficerElection of Director Land Use PlanningProposed Constitutional GhangesFMA ScholarshipChairman........Executive Officer...Delegates ReportsFloodplain Management Association Meetings119 of 214 March 2012 Ordinary Business PaperPage 181 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 13Item 14Item 15Item 16Item 17Item 18Item 19Agency ReportsOffice of Environment and HeritageState Emergency ServiceBureau of Meteorology2014 Conference Host NominationsTweed 2013 National ConferenceGosford Council Flood Risk Management Videoltems Listed by MembersGeneral BusinessNext Scheduled Meeting / CloseItem 1 FMA MEETING PROCEDURES AND APPOINTMENT OFSCRUTINEERSThe FMA Meeting Procedures are at Appendix 1. The Chairman will call for nominations forup to four scrutineers; scrutineers must be nominated and approved at the AGM.Item 2 APOLOGIESCall for apologies in addition to those held by the Executive Officer.Move ....."That the apologies be accepted."Item 3 CONFIRMATION OF 2011 AGM MEETING MINUTESMinutes of the February 2011 Annual General Meeting have previously been circulated andare at Appendix 2.Move....."That the Minutes as circulated be accepted as a true record of the QuarterlyMeeting of the 24, February 2011."Business arising from the Minutes not covered elsewhere in the agenda.Chairman..........Executive Officer.10Delegates ReportsFloodplain Management Association Meetings120 of 214 March 2012 Ordinary Business PaperPage 182 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 4 CHAIRMAN'S REPORTWelcome to the 2012 Annual General Meeting of the Floodplain Management Association,especially to those attending for the first time. May I offer our sincere thanks to MayorThomson and Eurobodalla Shire Council for hosting this year's conference and providingthis venue for our meeting today.FMA Executive Committee - Director of Land Use PlanningAs members and delegates will be aware, our former Director of Land Use Planning, MsSue Ribbons, has recently resigned her position with the FMA Executive to take up a seniormanagement position with the Office of Environment and Heritage.Sue will be sorely missed as her outstanding knowledge and expertise have beeninvaluable to the FMA during her time on the Executive. She has not only given us highlevel advice on a wide range of planning issues but has represented the FMA in variousforums where she delivered presentations, established working groups and provideddirection at all levels.Anyone who has heard one of Sue's presentations will know that she is a dynamicpresenter who has, amongst other things, shared her professional expertise with studentsat our Floodplain Management Course at the UTS.On behalf of all members I wish to sincerely thank Sue for her dedication and outstandingcontribution to floodplain management generally. We wish Sue well in her new role knowingit will continue to be successful and most beneficial to the Office of Environment andHeritage in their pursuit of ever improving floodplain management.As a result of the vacancy created by Sue's departure, nominations were called for theposition of Land Use Planning Director, and I am delighted to confirm that Ms Nilmini DeSilva was nominated and is now the new Director of Land Use Planning. Nil has a wealth ofexperience which members will recall from her excellent presentations at our conferences,as well as her FMA research scholarship and her lecturing at the Floodplain ManagementCourse.We welcome Nilmini to our FMA Executive and look forward to her advice and guidance onplanning matters in the years ahead.Executive Representation at Various EventsWe have indeed been fortunate to be represented by members of our Executive at variousforums during the year.Former Director-Planning Sue Ribbons and Director-Technical David Gibbins deliveredpresentations at the Emergency Management and Business Continuity Summit at DarlingHarbour, Sydney during September 2011.Deputy Chairman Clr Larry Bolitho represented the FMA at the National Flood Forum 2011in Brisbane during October and, amongst other things, participated in our discussions withthe Local Government and Shires Associations (LGSA) in forming a strategic alliancebetween our associations.lmmediate Past Chairman Clr Allan Ezzy represented the FMA, LGSA and ALGA at theNational Flood Risk Advisory Group (NFRAG) in Brisbane. lssues discussed included theChairman.......Executive OfficerllDelegates ReportsFloodplain Management Association Meetings121 of 214 March 2012 Ordinary Business PaperPage 183 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNational Strategy for Disaster Resilience and draft Communications Strategy, and theAustralian Flood Studies Database hosted by Geoscience Australia.Our Communications Officer, lsaac Smith, has volunteered his considerable expertise toguide us through the highly technical world of website design and we now have a trial sitewhich is currently being tested and refined before "going live". Without lsaac's expertise wewould still be struggling to provide an appropriate website. We look forward to using thefinal product.I wish to take this opportunity to express my sincere appreciation for the time and expertisegiven by our Executive during the year which has not only showcased the FMA in a mostprofessional manner, but also provided us with valuable information from around otherforums.Meeting with Hon. Robyn Parker - Minister for Environment and HeritageThe Executive Officer and I met with the Minister on 11th August in Sydney and thediscussion covered several topics of mutual interest including the current review of thesystems and procedures in floodplain management. We were able to reinforce our view thatFMA should take part in the foreshadowed review of floodplain management processes anddelivery of projects, and it is pleasing that the FMA was indeed invited to participate.The meeting was very positive and we endeavoured to establish a working relationshipwhich will hopefully lead to for future meetings. The Minister is now more aware of the FMAand the 80 local government areas we represent in NSW.We raised the issue of the Office of Environment and Heritage (OEH) website which seemsto "hide" floodplain management to the point where it is invisible. I then asked if this was areflection of current OEH priorities the Minister agreed this would be looked into. This wouldappear to be an issue that needs further follow up.An invitation was extended to the Minister to address our conference dinner and herreaction was encouraging. Unfortunately we have recently been advised that the Minister isunable to attend the conference, and she has asked that I pass on her formal apologies.The Minister's electorate encompasses Maitland and she has a good understanding offlooding issues. The Executive Officer took the opportunity to invite her on a guided tour ofthe Maitland flood mitigation scheme when she is next in her electorate.Meeting with Chris Holstein MPThe Executive Officer and I were able to also meet with Mr Chris Holstein MP, whomembers will remember from his long association with the FMA, including a term as DeputyChairman. Chris was keen to assist our cause and suggested we seek support from otherMP's to gather a "friends of the FMA" group within the government. Such a group of MP'swould carry more weight when seeking an audience with the Minister from time to time andour issues would be considered more seriously if there were several MP's saying the samething.It was particularly pleasing to hear Chris say that he has not forgotten "where he camefrom" and he is available to take up our issues any way he can. I subsequently contactedthe office of the Member for Clarence to facilitate an introduction for Chris and I wouldencourage any members who might be able to do likewise. Your local member would be avaluable addition to the cause.Chairman..........Executive Officert2Delegates ReportsFloodplain Management Association Meetings122 of 214 March 2012 Ordinary Business PaperPage 184 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aMeeting with Parliamentary Secretary Craig Baumann MP - Office of the Minister forPlanning and lnfrastructureA meeting was held with Parliamentary Secretary for Regional Planning Craig BaumannMP on the day before our August quarterly meeting. The Director-Planning Sue Ribbons,the Executive Officer and I tabled a range of issues to discuss and we endeavoured to laythe ground work for future meetings with the Minister.ln particularwe discussed the review of the current planning legislation and the need forimproved harmony with the NSW Floodprone Land Policy.Flood Risk Management Course at UTSOnce again the FRM course was successfully completed at the University of TechnologySydney (UTS), and I had much pleasure in presenting some of the lecturing in conjunctionwith Mr Duncan Mcluckie from OEH, our Technical Director, David Gibbins, and ourPlanning Director Sue Ribbons . There were almost 30 enrolments this year which is theideal number for presenting a high quality interactive course.It is a big commitment to prepare and present subject material at this level and all memberscan be assured that the FMA was very well represented by Sue and David in this importantacademic forum.Once again, on your behalf, I wish to also express my sincere thanks to Duncan Mcluckiefor his continued efforts in delivering our education program and one day pre-conferenceworkshop series each year. The state agencies have undergone some significant changesbut thankfully we have continued our strong partnership thanks to Duncan's long standingcommitment.It was particularly pleasing to see a number of Planners this year and I encourage everyoneto continue signing up more Planners to attend in future years for the benefit of floodplainmanagement.lnternational River SymposiumDuring September I attended the lnternational River Symposium in Brisbane and was ableto make contact with several speakers who will be of considerable interest to all delegates ifwe can recruit them to present at our national conference in 2013.The sessions covering the Brisbane and other Queensland floods were particularlyinteresting and there are many lessons for us all resulting from these events. I was able topromote the FMA during question times and networking throughout each day and we nowhave a summary of potential speakers to consider for the national conference in 2013.Discussions with LGSAFollowing a suggestion from our lmmediate Past Chairman, ClrAllan Ezzy, severalmeetings were held with the LGSA in Sydney to investigate the potential for a strategicalliance between our two Associations and identify specific areas for mutual support.For example, it was agreed that the exchange of information via our respective newsletterswould be mutually beneficial and in particular, the issues surrounding land use planning andthe current review of planning legislation. We also agreed upon a survey of flood affectedcouncils which was undertaken by the LGSA in January and February, and which I hope allselected members responded to.Chairman....Executive Officerl3Delegates ReportsFloodplain Management Association Meetings123 of 214 March 2012 Ordinary Business PaperPage 185 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aWe look forward to continuing liaison between our respective associations to strengthenreciprocal support.Review of Floodplain Management Processes in Office of Environment and HeritageDuring the year, the FMA was invited to participate in discussions with OEH on currentfloodplain management issues and processes. ln October and December Land UsePlanning Director Sue Ribbons, the Executive Officer and I accompanied representativesfrom Warringah, Shoalhaven, The Hills and the Hunter at meetings with OEH staff toprovide input to the review.The discussions covered a range of issues which have been raised by FMA members,including support for the NSW Floodplain Development Manual (FDM), the need for expertOEH technical staff to assist members and be champions for sound floodplainmanagement; appropriate levels of funding, affordable funding ratios and rolling programsfor capital and maintenance activities; funding for community education and appropriatedevelopment controls; and the need for consistency of planning policies with the FDM.We are looking forward to hearing the outcomes at this conference.AFMM - USAFollowing my visit to lllinois in 2010 as a guest of the lllinois Association of Floodplain andStormwater Managers, I was invited to represent the FMA and deliver a keynote address asa guest of the Association of Floodplain Managers Mississippi USA (AFMM) in 2011. Theconference was held 27nnyÑn April 2009 in thr township of Natchez MS and broughttogether floodplain managers from all over the state.The conference was held amidst the backdrop of fatal tornados to the north of the state,and many delegates were in constant communication with their agencies to keep abreast ofthe situation. The huge snow melt this year combined with heavy rainfall in the north hasalso produced record breaking floods along the Mississippi.It was a great opportunity to monitor media reports as these events were happening, andgain an insight into the issues faced by floodplain managers from different communities.It was also interesting to note some of the issues between each state. For example,Missouri is planning a lawsuit against lllinois for blasting a section of levee to reduce floodwater pressures on the levee at the town of Cairo. The resulting spillage into Missouri hasaffected rural areas but the levee was built to this design with the agreement of both states.Also, the state of Mississippi has undertaken their flood modelling which has produced ahigher flood level prediction downstream at the border with Louisiana. The state ofLouisiana will have to increase their predicted flood level to match the Mississippi result andundertake their modelling with this new level as a starting point or boundary condition.These interstate arguments seem to be usually resolved by the intervention of the FederalEmergency Management Authority ( F EMA).The invitation to the AFMM conference was another great opportunity to promote the FMAand our annual conference, and many new contacts were made during the week.Messages for Members for the Year AheadAs can be seen your Executive regularly takes up FMA interests with Ministers and seniorgovernment officers, however the importance of FMA Members also keeping their localMembers of Parliament aware of floodplain management priorities cannot be stressed toostrongly.14Chairman..........Executive OfficerDelegates ReportsFloodplain Management Association Meetings124 of 214 March 2012 Ordinary Business PaperPage 186 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aln 2012 I ask you to deliver these key messages to your Members of Parliament:Capital Funding - There are over 100 completed floodplain risk management plans, whichat the present rate of government allocation will take 20 years to implement. An increase ofNSW Government Capital Works funding to $15 million per year matching an increase inAustralian Governmentfunding of $15 million is required to provide appropriate progress.Maintenance Funding - Many authorities have limited funds to maintain essential leveesystems, which can result in serious and unnecessary risks to life and property for manyfloodplain inhabitants. An increase in the flood mitigation maintenance allocation to $5million per year is required.NSt4/ Government Technical Staff - The number of OEH staff experienced in floodplainmanagement has dropped substantially since 1995, and until very recently little has beendone to recruit new staff. This expertise is essential to assist councils fulfìl their flood riskmanagement responsibilities. OEH is undertaking an analysis of flood related skills in thedepartment and in floodplain management authorities. Appropriately qualified andexperienced personnel need to be appointed as a matter of urgency in response to thesurvey outcomes.OEH/SES/Local Government Flood Database - A centralised database of flood informationis essential for coordinated planning and emergency response. A commitment to promptimplementation and full operation of the state database is required.ln ConclusionIt is very pleasing to note that this year we have an unprecedented number of internationalspeakers at our conference. The Executive will continue to work towards ever increasingliaison with our colleagues overseas in an effort to broaden our perspective and seek waysto further the noble cause of floodplain management in Australia. I hope you all enjoy thedifferent perspectives on floodplain management brought to us by our internationalparticipants this year.Our vision for greater national participation and liaison with our interstate colleagues is alsoa prioriÇ and I encourage all delegates to not only attend the national conference in 2013,but invite any neighbouring Council or agency, and particularly any interstate colleagues, tojoin you in registering for this exciting event. The sharing of knowledge across our stateborders will help us all in our various flood risk management roles.ln closing, I would particularly like to thank our Executive Officer, Mr Glenn Evans, for hisdedication and professional advice over the past year. Glenn's experience in high levelmanagement and floodplain management is an invaluable resource for the FMA and he haswon the respect of all those we have met with and liaised with since he took up the position.May I also thank all those who have participated in our various activities, surveys andworkshops throughout the year and I look forward to another exciting year as we approachthe national conference at Tweed Shire in May 2013.Clr lan DinhamChairmanMove......"That the Chairman's Report be adopted."Chairman....Executive Officerl5Delegates ReportsFloodplain Management Association Meetings125 of 214 March 2012 Ordinary Business PaperPage 187 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 5 IMMEDIATE PAST CHAIRMAN'S REPORTA verbal report will be provided by Clr Ezzy.Move......"That the lmmediate Past Chairman's Report be adopted."Item 6 DEPUTY CHAIRMAN'S REPORTA verbal report will be provided by Clr Bolitho.Move......"That the Deputy Chairman's Report be adopted."Item 7 EXECUTIVE OFFICER'S REPORTNew Look for the FMAResolutions of the 2011 Annual General Meeting allowed the FMA to progress the newimage for the FMA. Our new "trading name", Executive titles and logo were launched inApril, and very positive comments have been received. The "new look" will be complete withthe implementation of our new website.Clr lsaac Smith from Lismore Council was appointed as our new Communications Officer,with the primary role of developing the new interactive website. The intention is to use thewebsite as the main means of internal communication between FMA members and externalnetworking with other practitioners around Australia.Quarterly Meetings and WorkshopsAttendance at Quarterly Meetings has increased during the year, and workshops held aftereach meeting are proving to be very popular. They will be held again this year, and provideopportunities for more in-depth discussion of topical issues. Thank you to all those whohave participated, presented and mediated at these meetings. I encourage all members toprovide at least one delegate to the meetings to participate in the decision makingprocesses, and share experiences.FMA Gonstitution and Strategic and Operating PlansThe FMA Constitution requires the organisation to prepare an annual Business/OperatingPlan, and to review the Corporate/Strategic Plan every two years. Considerable time hasbeen spent in developing the revised Constitution and new Strategic and Operating Planswhich will be considered at this meeting. They will help improve the efficiency of the FMA'scurrent operations, and also provide flexibility for the association to utilise our experienceand resources to develop our national presence in floodplain management.FMA Annual GonferenceThe major logistical responsibility each year is delivering the annual conference, and thisyear it has again been a mammoth, but professionally managed, process. lt is worth notingthat while the FMA conference continues to grow, in 2011 two privately promoted floodconferences were developed, but neither was held due to insufficient registrations.This year's team has put together a first class event on which we can confidently base ourfirst national conference in 2013. Next year's event will require considerably moreresourcing and funding, for which allocations have been provided in the draft Strategic andOperating Plans.Chairman........Executive officer...16Delegates ReportsFloodplain Management Association Meetings126 of 214 March 2012 Ordinary Business PaperPage 188 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.alnternational Commission on lrrigation and DrainageThe 63'd Conference of the lnternational Commission on lrrigation and Drainage, thelrrigation Australia Annual Conference and the 7th AnnualAsian Regional lrrigationConference will be held concurrently in Adelaide from 24 to 30 June 2012. This conferenceis expected to attract in the order of 500 participants from across Australia and around theworld.The one-off conference program includes a floodplain management component, and theFMA was invited to assist in its preparation. This is another opportunity for the FMA tonetwork with interstate and overseas practitioners, and spread knowledge of the FMA. I amparticipating in the conference program organising committee.The conference organisers are presently calling for presentation abstracts, but only a smallnumber of flood related proposals have been submitted to date. I encourage presenters atour FMA Conference to consider developing their presentations for an internationalaudience in Adelaide.The Coming YearOver the last year the FMA contributed to inquiries, summits, workshops and workingparties, many of them at a national level, and requests and opportunities for the FMA toinput its expertise are expected to increase in 2012. There is no doubt that thesecontributions have furthered the development of sound floodplain management policy andinvestment, but they also place a severe strain on the mostly volunteer resources of theFMA. The Executive recognises that more could be done if more resources were available.It is my role to provide the best support for the FMA as it applies its wealth of technical,planning, economic and educational expertise to make NSW communities safer in times offlood, and where appropriate, assist our interstate colleagues in their similar endeavours.However the FMA cannot achieve everything it wishes with its current resources. Thecontribution of members to working groups, and in undertaking specific projects such as thesurvey of council's planning procedures, has been very productive, and is the type of "loadsharing" which your Executive encourages. As the FMA seeks a more national presenceover the next year we need to evaluate the most appropriate means to achieve our goals.2012 Quarterly Meeting DatesAll2012 Quarterly Meetings will be held at the Bureau of Meteorology, 300 Elizabeth Street,Sydney. Thank you to Gordon McKay and the BoM for making this venue available for us.Please place these dates in your diary:. Thursday 24May 2012. Thursday 23 August 2012. Thursday 22 November 2012A light lunch is served after each meeting to enable members to network, followed by aworkshop session of about 90 minutes.I look fonruard to working with you over the coming year.Glenn EvansExecutive OfficerChairman..........Executive Officer\7Delegates ReportsFloodplain Management Association Meetings127 of 214 March 2012 Ordinary Business PaperPage 189 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aMove...... "That the Executive Officer's Report be received".Item I TREASURER'S REPORT2011 Financial Year Audit ReportThe Financial Statements for the year ended 31 December 2011 are at Appendix 6.The report conflrms that the FMA is in a sound financial position with Net Assets of$188,938.2012-2015 Strategic Plan and 2012 Operating PlanThe Strategic and Operating Plans were provided to members on 23 January. The StrategicPlan identifies opportunities and challenges for the FMA, and sets the course for strategicaction in the next four years' Operating Plans. lt has been prepared by the FMA Executiveand draws on the input of members made at the strategic planning workshop held on 25August 2011, and other contributions throughout the year.The 2012 Operating Plan, which includes the 2012 Financial Plan, proposes improvementsin Organisational Capaci$, including an increase in member participation and strengtheningrelationships with interstate flood practitioners and planning for the 2012 nationalconference; an increase in Lobbying activity particularly in the wake of the disastrous floodsaround Australia; maintenance of Educational Services and improving Member Servicesparticularly by improving networking and information sharing through the redeveloped of theFMA website. Some member feedback has been received, and wording and structure havebeen amended to reduce the likelihood of misinterpretation and ambiguity.An adjustment to the membership fees in line with the cost inflation index of 3.3% isrecommended by the Executive Committee to ensure that the FMA is able to serve itsmembers in a professional manner, while resourcing an increased national presence overthe next four years.Glenn EvansTreasurerMove......"That (1)the Treasurer's Report be received(2) the draft 2012-2015 Strategic Plan and 2012 Operating Plan be adopted"Item I REPORTS from EXECUTIVE COMMITTEE9.1 Director - Technical David GibbinsOverviewThis is my flrst year of serving and representing the Floodplain Management Association inthe position of Director Technical. Even in one year I have seen the association advance inits depth and efficiency of organisation, representation of members, and clear advocacy forstrategic and practical floodplain risk management.The need for a national approach seems clearer than ever with the intensity and multi-statedimensions of real flooding as this report is being written - and of course reinforced by thedevastating floods in late 2010 and early 2011 in Queensland and Victoria with tragic lossof life. lt has been encouraging to participate in and represent the FMA in two nationall8.......Executive OfficerChairman...Delegates ReportsFloodplain Management Association Meetings128 of 214 March 2012 Ordinary Business PaperPage 190 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.afocus events: A national conference on Business Continuity and Emergency Management,and a Federal Government initiative to develop national flood mapping standards.The 2012 FMA conference is another example of the growth of the FMA, with a recordnumber of abstracts received - including from across Australia and overseas. lt was both aprivilege and a challenge to serve on the conference abstract review panel. I can vouch forthe great care, integrity and rigour applied by all on the panel, and thank the authors inadvance for what I am sure will be progressive and useful contributions to flood riskmanagement for us all.The year 2012will be significant for me. lt will give the opportunity for serving the membersof the FMA building on my flrst year continuing into my second year. lt will also be the firstyear of extended long service leave from my employment in the Strategic Planning Servicesgroup in the City of Newcastle. This will provide more opportunity to serve the members ofthe FMA.I would very much like to acknowledge the help given by the other members of the FMAExecutive, and to express my admiration and thanks for the work they have done in thepast year. I fìnd them a great team, and I consider it a true privilege to serve with them. Iwish Sue Ribbons well as she leaves the Executive and takes up her new role with theOffice of Environment and Heritage.Some key events and milestones follow.Shelter-in-Place / Entrapment PoliciesAfter the FMA Meeting of 26 May 2011 a workshop was convened on the difficult andsometimes controversial tensions of whether or not to shelter in place - and if there aresome circumstances where shelter in place could be the only viable option.There was a good representation of views and circumstances, including from the SESwhich has conducted extensive research into these issues.Newcastle was presented as a case study, where it is foreseeable that potentiallythousands of lives are at risk in worst case flash flood scenarios in urbanised catchments,but there is simply no time to evacuate. People would likely be placed at more peril if theyattempted evacuation to high ground.It was not possible to reach a consensus or anything approaching a policy position orrecommendation to members for such a complex matter. This topic will continue as a 'hotissue' and developments will be reported to members.UTS Floodplain Risk Management Short Course 2011This course was developed and is presented by the University of Technology Sydney inconjunction with the FMA and NSW Office of Environment and Heritage (OEH). The courseshows how to develop and implement floodplain risk management in accordance with theNSW Government Flood Policy and Manual. lt is taught by industry experts, includingthose from (OEH), NSW State Emergency Service, Local Government and consultancy.The course is managed by Dr Jaya Kandasamy of UTS.Enrolment was at capacity indicating the success of this joint venture. Those enrolledincluded a wide range of industry and student representation.Presenters at "Block 2" on 15 and 16 September this year included the Chair of the FMAchairman..........Executive officer....19Delegates ReportsFloodplain Management Association Meetings129 of 214 March 2012 Ordinary Business PaperPage 191 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aClr lan Dinham, and Mr Duncan Mcluckie (OEH) and myself (Chapter 8. Managing Risk inAreas of Existing Development - originally developed by Mr Pas Silveri of WollongongCouncil - and supplemented with my experience of Newcaslle 2007 flash floods). lan gavemany cases of interest with compelling images of flood management in real life - andchallenged the students with some examples of calculating flood damages to work throughfor themselves during his lecture.I highly recommend this course to FMA members and those associated with them in theoften controversial and difficult journeys encountered in the development andimplementation of Floodplain Risk Management Plans.Natural Disaster and lnsurance ReviewOn 4 Marcn 2011 the Hon Bill Shorten MP, Assistant Treasurer and Minister for FinancialServices and Superannuation, announced an independent review into disaster insurance inAustralia following the floods in January 2011. The FMA provided a submission coauthoredby Deputy Chairman Clr Larry Bolitho and myself.The main points of the submission were:. Floods dominate Natural Disasters. The FMA supports a National approach to flood risk management. Flood risk management principles need to be followed:o The management of risk to life is the highest priorityo Social impacts need to be managedo lt is rarely physically or economically feasible to guard against economiclosses for all possible floodso There are some areas of the floodplains where development should not bepresent.o The management of flood risks is complex and no single managementmeasure will be sufflcient - a mix of measures will be required. Potential consequences can be large. The potentialto mitigate flooding will be limited. A National Flood Database and mapping would be beneflcial.. Liability is an large issue for Government, who hold most of the flood hazardmapping. European experience is that stable government providing mitigation standards overdecades has facilitated the provision of flood insurance. Funding for floodplain risk management in Australia needs to be dramaticallyincreased to become commensurate with the risks.o Management actions in advance of floods are always better than compensation afterfloods.The final report of the Natural Disaster lnsurance Review was provided to the Governmenton 30th September 2011, and was publically released on 14 November 2011. The mainrecommendations were:. All home insurance, home contents insurance and body corporate insuranceproducts need to include flood cover.. Discounted insurance premiums are needed for homes, home contents and homeunits in areas of medium and high flood risk, so as to render flood insuranceaffordable.Chairman..........Executive Officer20Delegates ReportsFloodplain Management Association Meetings130 of 214 March 2012 Ordinary Business PaperPage 192 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a. National coordination of flood risk measurement and mitigation is needed, in order toimprove flood risk management for the beneflt of the community generally and toensure the continuing development of a competitive market for flood insurance.. A mechanism is needed to fund the discounts that are to be offered for affordabilitypurposes.. lnsurers will need access to a government-sponsored reinsurance facility if they areto deliver flood insurance discounts without compromising their own commercialpositions.Emergency Management and Business Continuity SummitDirector Land-use Planning Sue Ribbons and I both presented at this summit held inSydney 20 - 2l September. The event was well attended by emergency management,government and business representatives from across Australia - and overseas.The opening keynote speaker was New Orleans former Mayor C. Ray Nagin whointroduced New Orleans as a city with a rich culture of jazz - devastated by HurricaneKatrina (2005) - and the work towards recovery after his re-election (2006). He was frank,entertaining and presented a rigorous understanding of the issues across human, political,financial and legislative dimensions. Ray was introduced by Professor Ed Blakely(University of Sydney), internationally known for his work in Urban Policy and disasterrecovery. (SeeforEd interviewing Ray 29 September 2011.)Presenters and delegates came from across Australia, from government emergencymanagement, CSIRO - and included former Deputy Director of the NSW SES Dr ChasKeys. Chas observed floodplain risk management in NSW seems to be losing its positionof Australian and even international leadership with reduced land use planning rigour - andneeds renewed high level support from Government - State and Federal. Presentations onthe innovative use of social media in emergency response were amazing.Sue provided a case study on Sea Level Rise - Understanding and Communicating ClimateRisks for Coastal Communities. I spoke on Flood Response Measures and DevelopingDisaster Resilience Leadership, using Newcastle as a case study. ln Newcastle there isthe potential for the capacity of emergency management to be overwhelmed in extremeflash flood events placing many thousands of lives at risk.I commend the Summit presentations to you, visitwww. h a I I ed it. co m. a u/e m e rq e n cve m a n s u m m it 1 1 /prese ntati o n s/Representing the FMA at a National Flood Modelling and Mapping WorkshopThe National Emergency Management Committee (Australian Government - Attorney-General's Department) through its Risk Assessment, Measurement and Mitigation Subcommittee(RAMMS) held a two day workshop to develop an agreed methodology to mapareas of risk relating to riverine and flash flooding, storm surge and coastal inundationwhich will facilitate a nationally consistent approach to future flood mapping and modelling.Participants at this workshop included members from RAMMS, the National Flood RiskAdvisory Group, Geoscience Australia, the National Spatial lnformation ManagementWorking Group, Engineers Australia and the Floodplain Management Association. Irepresented the FMA, and Mr Duncan Mcluckie (OEH) also attended.The workshop's outcomes at the time of writing are expressed in the followingrecommended principles :Chairman..........Executive Offìcer....2lDelegates ReportsFloodplain Management Association Meetings131 of 214 March 2012 Ordinary Business PaperPage 193 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a. Nationally consistent mapping terminology be used.. Flood Mapping be integrated into a management framework. Best available information be used, but limitations are recognised. Flood Mapping is openly available. Modelling and Mapping informs education and promotes resilience. Modelling and Mapping is monitored, reviewed and continuously improved. Modelling and Mapping considers changes in climate, land use and demographics.The FMA will continue to have input into this project.ln ConclusionThere are many'active fronts' in today's floodplain management. I have found in my time ofbeing a member of the FMA and in the last year as Technical Director that the FMA bindstogether a huge resource of membership that would not be possible if we acted alone andin isolation. I do consider it a joy and a privilege to be a part of this.While we should always remember that good flood risk management starts with land useplanning, the existing land uses can present the most challenges. However, our biggestchallenges are not technical - I submit they are that part of our collective human nature thatwants to focus on short term gains at the expense of long term sustainabiliÇ.My hope is that in some smallway I can help to make that critical difference -understanding that it may be the next generation who benefits.David GibbinsDirector - TechnicalMove... "That the report of the Director-Technical be received"9.2 Director - Land Use Planning Sue Ribbons (2010'20111lntroductionIt has now been two years that I have had the pleasure of representing the FloodplainManagement Association in the position of Director Land Use Planning. tt is therefore withsome sadness that this will be my last report representing the FMA. As many of you areaware I have resigned from my position as Principal Offìcer, Floodplain Management atPittwater Council to take up an exciting new position with the Office of Environment andHeritage as the Unit Manager Sydney, looking after the flood, coastal and estuary programsfor the more than 40 councils across the Sydney Region.Over the past two years I have learnt a great deal about strategic planning and legislationas it relates to land use planning. I have also learnt a lot about the frustrations of seeminglyad-hoc planning legislation that does not appear consistent with current flood riskmanagement best-practice. lt is disappointing that some issues have yet to be resolved.It my hope that this knowledge of strategic planning and legislation has been passed on toFMA members and that the FMA has been able to provide sound technical input andopinion in a variety of forums.Chairman..........Executive Officer22Delegates ReportsFloodplain Management Association Meetings132 of 214 March 2012 Ordinary Business PaperPage 194 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNilmini de Silva, Acting Manager of Engineering Services at Fairfield City Council has beenelected to take over the role of Director of Land-use Planning of the FMA. Nil is well knownto many FMA members and I am sure Nil's wide-ranging expertise in flood riskmanagement will be a valuable asset the FMA Executive Team.Land Use Planning Working GroupA significant positive outcome of the past year has been more open communicationbetween the Department of Planning and lnfrastructure (DPl), the Office of Environmentand Heritage (OEH) and the FMA. Although a formalworking group has not beenestablished, regular contact is being maintained between the FMA, DPI and OEH. This isproving to be an effective mechanism by which upcoming proposals to land use planninglegislation can be discussed between all parties, with hopefully mutually agreeablesolutions achieved and appropriate supporting information prepared, before the legislation'hits the streets'. I would like to acknowledge Santina Camroux from DPI for her support inthis regard.Building Code of Australia NSW Advisory Group for New Flood Standard-ln July 2010, the Building Ministers representing the Australian, State and TerritoryGovernments agreed to the Australian Building Codes Board (ABCB) developing aStandard for the design and construction of certain buildings in flood-prone areas. TheStandard will be included in the national Building Code of Australia (BCA) and will beaccompanied by information handbook. To assist the ABCB on this project, a NationalReference Group was formed to provide guidance and comment on the content and scopeofthe draft standard and handbook.The FMA was invited to be part of an informal NSW Advisory Group to provide advice to thestate representatives in advance of each Reference Group meeting. I was fortunate to beinvolved in this project, which included a review of the first draft of the Flood Standard inlate March 2011 and a teleconference meeting on 1 April 2011to discuss NSW's commentsprior to the National Reference Group meeting in early April. The National Reference Groupmet in April and June 2011, in which NSW was represented by Duncan Mcluckie (OEH)and Stephen Durnford (DPl). There has been no further involvement by the FMA on thisproject.It is understood that the ABCB has now developed a draft standard and handbook, with theprimary purpose of the standard being life safety. Subject to compliance with Council ofAustralian Governments (COAG) regulation requirements and ABCB agreement, it isanticipated the standard will be available for adoption in the Building Code of Australia in2013.It is disappointing to report that the Flood Standard for Building in Flood Prone Areas is tobe somewhat limited in its application:. the Standard does not apply in areas subject to storm surge, coastal erosion,landslip or mudslide;. the Standard only applies when:o the maximum flow velocity is less than 1.5m/so the habitable floors are above the flood levelChairman.......Executive Offìcer23Delegates ReportsFloodplain Management Association Meetings133 of 214 March 2012 Ordinary Business PaperPage 195 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.ao the depth of submersion is less than 1mTo keep up to date with the progress, here is the link to the ABCB website project page on"Building in Flood Prone Areas":State Flood Mitigation Assessment Committee (SFMAC)The FMA was invited to participate on the 2011 State Flood Mitigation AssessmentCommittee (SFMAC) in May 2011, which involved review by the Committee of all grantssubmitted under the Floodplain Management Program and Natural Disaster ResilienceGrants Scheme for the 2011-2012 financial year. Again, I was fortunate to be involved inthis project.Review of NSW Flood Programln October 2011,1 was again fortunate to be involved in a meeting with representativesfrom various Councils, the FMA and OEH to discuss a range of issues relating to theReview of the NSW Flood Program. This was a great opportunity to discuss a positive pathforward for the NSW Flood Program. One of the key messages from the FMA was that theOffice of Environment and Heritage, as custodians of the NSW Flood Program, need tochampion the NSW Flood Prone Land Policy and the Floodplain Development Manual toprovide technical assistance to local councils (and not merely be grant administrators) aswell as to ensure consistent approach to the intentions of the Policy and the Manual acrossall State government departments and other agencies.NSW Planning ReviewA key activity of the NSW Department of Planning and lnfrastructure (DPl) for 2011-2012isthe total review of the NSW Planning System (particularly the Environmental, Planning andAssessment Act, 1979) with the aim to create new planning legislation for NSW. The NSWGovernment has established an independent panel to review the EP&A Act along with thebroader planning system. The review has been divided into the following 5 stages:Sfage 1: Review Announcement in July 2011Sfage 2: Listening and Scoprng - The Review process commenced with an extensivelistening and consultation process between September and December 2011 to seek thecommunity's views on what should be the broad underpinning principles for new legislationto replace the Environmental Planning and AssessmentAct 1979. Consultation involvedStakeholder Meetings with a range of peak interest groups in Sydney; Community Forumsat more than 40 locations across NSW; and other written submissions.The FMA prepared a detailed submission to this stage of the NSW Planning Review, withthe following seven recommendations:. lssue 1 - the repeal of Planning Circular PS07-003-New Guideline and Changesto Section 117 Direction and EP&A Regulation on Flood Prone Land;. lssue 2 - the need for recognition of flood risks above the 100 year flood level for alldevelopment types;Chairman..... ..........Executive Officer24Delegates ReportsFloodplain Management Association Meetings134 of 214 March 2012 Ordinary Business PaperPage 196 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.ao lssue 3 - need for consistency with the state government's own FloodplainDevelopment Manual;. lssue 4 - the need for a clear definition of flood-prone land in the Standardlnstrument LEP;. lssue 5 - need for a clear definition of 'signiflcant adverse impacts' in the Standardlnstrument LEP;. lssue 6 - acknowledgment that flood mapping is highly technical, costly and timeconsumingand so is beyond the resources and expertise of many local councils;. lssue 7 - the repeal that part of State Environmental Planning Policy (Exempt andComplying Development Codes (2008) that permits complying development onflood-prone land.The FMA submission provides a summary of key and current issues relating to flood riskmanagement in land use planning. For this reason, the full submission has been providedat Appendix 3.All submissions, including the FMA's submission, together with notes taken during theStakeholder Meetings and Community Forums are included on the NSW Planning Reviewwebsite (www.planningreview.nsw.gov.au). Written submission closed in early November2011 for inclusion in the Stage 3 lssues Paper.lssues Paper of the NSWPlanning System Review'was released in December 2011. The lssues Paper has beenprepared as series of about 240 questions about matters and concerns raised at theStakeholder Meetings and Community Forums held in Stage 2. During this phase,stakeholders and the community are encouraged to provide feedback on the specifìcquestions raised. About seven of the 240 questions relate to FMA issues. These questionsare much more general than the FMA's original submission, but the fundamentals are stillvery relevant. At the time of writing this report, the FMA is currently preparing a submissionfor this round of consultation to the NSW Planning Review. Written submissions close on17 February 2012.Sfage 3: /ssues Paper - 'The Way Ahead for Planning in NSW-Sfage 4: Policy Options Re/ease - After considering public comments made during theStage 2 Listening and Scoping Phase and in response to the December lssues Paper, aworking group in collaboration with the Panelwill produce a document - known as a GreenPaper - which will set out the recommended preferred structure for a new planning system.The Green Paper will be published by the end of April2012.Sfage 5: Draft Legislation - A 'white paper' and draft legislation will be released forexhibition before a bill is submitted to the NSW Parliament. Details of timing will bepublished in due course.ln ConclusionMy aspirations for involvement with the FMA have centred on communication and thesharing of knowledge. Added to this has been great networking and professionaldevelopment opportunities. I am sure these aspirations will continue in my new role withthe Office of Environment and Heritage.Chairman..........Executive Officer25Delegates ReportsFloodplain Management Association Meetings135 of 214 March 2012 Ordinary Business PaperPage 197 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAlways remember that flood risk management starts with land use planning.It has been a pleasure working with you all.Sue RibbonsDirector - Land Use Planning (2010-20111Move.. . ."That the report of the Director - Land Use Planning be received".9.3 Gommunications Officer Clr lsaac SmithlntroductionThe past year has been one of planning for the future of the FMA in the digital domain. Theorganisation recognises the importance of the social media sphere and the profound impactit has had on emergency management since the Queensland flood event in January 2011.The FMA, in its continued attempt to raise our profile as the peak body in floodplainmanagement for local government, is now going to integrate these new social media into itsoperation over 2012. We will be exploring new ways to use these technologies and wouldappreciate any feedback from members as to usage and development.The New FMA WebsiteAlong with our use of social media, the FMA has redesigned its website to provide aresource that is unavailable anywhere else in Australia. The new FMA website will work asa portal for floodplain projects across the country and provide members with the opportunityto discuss these projects and refine their use. These discussions will serve as a livingdocument that gives conference papers and floodplain documents a continued relevance inyears to come.Links and member information on the FMA site will now allow for more information flow andinteraction within the association. Reports and discussion from our quarterly meetings willalso be on the site so members will be able to continue the discussions that took place, orrecap the BOM and SES information that is presented. We hope to build on the informationavailable for past conferences so you can go back and find that paper which wasmemorable and useful. We will be adding as much information as possible relating tofunding opportunities.The new site will also allow members to more easily access our archival information. TheFMA has listened to members who found the old website difficult to use and has completelyredesigned the new site so that it is intuitive and everything can be accessed in just a fewclicks. We hope that members will see the new site as a place where all ideas and issuesfacing floodplain professionals can be explored and expanded upon.ln future the FMA Flyer will also be delivered from the website which gives members instantaccess back to the site and links all the information in one place. This will remove theattachments from our newsletter and allow you to control the information you want toreceive.Chairman..........Executive Officer26Delegates ReportsFloodplain Management Association Meetings136 of 214 March 2012 Ordinary Business PaperPage 198 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aln Gonclusionlf you believe that there is something we need to add to the site please contact us with yoursuggestions. I encourage all members to login on the new site before the end of theconference and begin the discussion. All the conference papers and presentations will beready for you to build on the ideas of your colleagues.lsaac SmithComm u nications OfficerMove...."That the report of the Communications Officer be received".Item 10 ELECTION OF DIRECTOR LAND-USE PLANNINGNominations for the position of Director Land-use Planning were sought from members on 4January.The following nomination was received by the Executive Officer:Nilmini de Silva, Fairfield City CouncilAs only one nomination was received Ms de Silva is elected, and will take up duty at theAnnual General Meeting.Glenn EvansExecutive OfficerMove...... "That the Executive Otficer's Report be receivedIteml 1 PROPOSED CONSTITUTIONAL CHANGESOn 23 January the Executive Officer advised that the FMA Executive will be recommendingthat Full Members approve changes to the Constitution at the Annual General Meeting. Theproposed changes are intended to simplify the constitution, remove inconsistencies andreflect current FMA requirements. Procedural matters are now found in the Strategic Plan.The proposed changes have been reviewed by the FMA's legal advisors, Marsdens LawGroup. While the substance of the document remains the same as that previously providedto members, wording and structure has been amended to improve its effectiveness, andreduce the likelihood of misinterpretation and ambiguity.The proposed changes and commentary are of a confidential nature and were providedseparately to members, however only Full Members and Life Members are entitled to voteon changes to the Constitution.The current 2008 Constitution states: "Proposed changes shall be put to the vote duringthe Annual General Meeting and will require at least 60% of Member Authorities to berepresented at the meeting, and a vote in favour of the change(s) in order for thechange(s) to be effective." The Chairman will indicate whether the requirement has beenmet before any discussion regarding this item proceeds. Failure to meet the 60%requirement will mean this item will not be discussed.Chairman...... ....Executive Officer27Delegates ReportsFloodplain Management Association Meetings137 of 214 March 2012 Ordinary Business PaperPage 199 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThe proposed changes to the Constitution, and accompanying commentary, will beavailable for Full Members from the Executive Officer.Move...... "The proposed changes to the FMA Constitution be approved."Item 12 FMA SCHOLARSHIPThe FMA Scholarship Policy provides for financial support for part expenses of shortcourses, research into relevant matters or educational visits interstate or overseas. TheFMA may provide up to 50% of the cost of the education program, or $2000 whichever isthe lesser. The budget for the Scholarship Program is set by the annual Operating Plan.The Scholarship Policy is at Appendix 4.Applications for the FMA Scholarship were sought from members on 4 January. Noapplications were received. The Executive Committee recommends that fresh applicationsbe sought during the year, however this would require amendment to the Policy. To enablethe scholarship program to be managed more effectively the following changes to the FMAScholarship Policy are recommended:1. General 4. Amend "Such financial support shall be no more than 50% ofexpenses or $2000.00 whichever is the lesser figure"to "Such financial support shall be no more than 50% of expenses or $2500.00whichever is the lesser figure"2. General 6. Amend "Applications should be fonrvarded to the Executive Offlcer ofthe FMA. Closing date for Applications will be the closing date for nominations forBusiness ltems for the Annual General Meeting. The Executive Officer shall call forapplications at the November Quarterly meeting and with the "Notice of AnnualGeneral Meeting"' stating the closing date for the receipt of Applications."to "The Executive Officer shall call for applications and provide at least 14 days'notice of the closing date for applications."3. General 7. Amend "Applications for the awarding of the Scholarship shall bedetermined by members at the Annual General Meeting."to "Applications for the awarding of the scholarship shall be determined by membersat a General Meeting."4. ApplicationsAmend "Applications, following the form provided on the website, must be lodgedwith the Executive Officer by Close of Business on l4th January (or other such dateas may be duly advertised) each year.The FMA Executive will review all applications and make a recommendation to theAnnual General Meeting regarding the awarding of the Scholarship. Awarding of thescholarship will be by resolution at the AGM.'to "Applications must be lodged with the Executive Officer by such date as may beduly advertised. The FMA Executive Committee will review all applications and makea recommendation to a General Meeting regarding the awarding of the scholarship.Awarding of the scholarship will be by resolution at the General Meeting."Chairman..........Executive Officer28Delegates ReportsFloodplain Management Association Meetings138 of 214 March 2012 Ordinary Business PaperPage 200 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a5. Add lVew Secúion "Amendment of the PolicyThe Scholarship policy may be amended by resolution of a General Meeting ofmembers"Move...... "The proposed changes to the FMA Scholarship Policy be approved."Glenn EvansExecutive OfficerItem 13 AGENCY REPORTS13.1 Office of Environment and HeritageA verbal report will be provided.13.2 State Emergency ServiceUpdate on Flash Flood Discussions with DPIln December 2011 NSWSES Commissioner Murray Kear and Director Community SafetySteve Opper met with senior officers of the Department of Planning and lnfrastructure todiscuss the issue of flash flood and how to deal with situations where it appears fromstudies that evacuation will not be possible. The NSWSES has made it clear that at least interms of current understanding of the risk and available emergency management options,the NSWSES will not be signing off on any proposal to develop where evacuation is notpossible. lt was agreed that the issue is serious and could have a significant impact onfloodplain development, and more consultation is planned for 2012.Commencement of Project for Evacuation Gapability AssessmentFollowing on from agreement in 2011 that flood evacuation needs to be assessed using areliable and repeatable methodology in respect of land-use planning issues, the NSWSEShas been provided with funding to develop an Evacuation Capacity Assessment Guidelinefor use by floodplain development consultants and councils. The work is due to becompleted by June 2012 and then further work will be needed to develop animplementation strategy.State Risk AssessmentThroughout20ll NSWSES has contributed to a NSW State Risk Assessment process thathas identified state-level strategic risk issues across all the major natural hazards. Anexample is the maintenance and management of flood protection levees. This work wasdone under the project leadership of Kathy Burstein from the Ministry for Police andEmergency Services in order to comply with a federal requirement under the COAGstrategy national disaster resilience. Further work to plan for how to address identified risksis planned Íor 2012.National Flood Forumln October 2011 NSWSES attended the National Flood Forum in Kedron Queensland. TheForum covered mitigation and technical solutions to manage flooding includingpresentations by manufacturers of portable barrier systems. NSWSES presented flood riskassessment tools in use by the service in the Georges River, Hawkesbury Nepean, theprinciple of the evacuation timeline modelling, and extensive use of flood intelligence toassist planning and pre-emptive operational response.Chairman..........Executive Offlcer29Delegates ReportsFloodplain Management Association Meetings139 of 214 March 2012 Ordinary Business PaperPage 201 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRAMMS Flood Mapping WorkshopNSW SES attended a workshop conducted by the National Emergency ManagementCommittee's Risk Assessment, Measurement and Mitigation Sub-committee (RAMMS) andcontributed to discussion on the status of flood risk mapping and risk assessment.Alongside NSW OEH the comprehensive and functionally operating mapping and floodplainrisk management process in NSW was presented and well received. Particular referencewas made to the NSW flood database project for floodplain risk management informationwhich will be a best practice management tool.Land Use Risk Planning Workshopln January 2012 NSWSES participated in a national consultation project being conductedby the federalAttorney General to develop a snapshot of current practice in respect of landuse management and linkages to emergency management across the major naturalhazards. lt is not clear what the outcome will be apart from a report showing the nationallandscape and presumably suggestions about what constitutes best practice - which NSWshould be very close to achieving, notwithstanding areas for improvement such asresourcing of community education and consistency between bushfire and flood.Simon OpperActing Manager, Emergency Risk Management13.3 Bureau of MeterologyOverview of the yearDuring January 2011 major floods developed along several northern NSW rivers from theweather system that also flooded south-east Queensland. They included the Macintyre,Richmond, Clarence, Culgoa and Barwon-Darling River systems. Moderate flooding alsodeveloped along the Murray River from the major floods that were experienced in northernVictoria.ln March, the Bega experienced its highest major flood since 1971.In June, major floodingoccurred in most NSW northern coastal valleys from the Nambucca to the Hunter.During November, moderate to major flooding occurred along the Gwydir, Namoi,Macintyre, Culgoa and Barwon-Darling River systems. Warnings are still current for theDarling River.Minor to moderate floods were also experienced in several other valleys during 2011.Chairman..........Executive Officer30Delegates ReportsFloodplain Management Association Meetings140 of 214 March 2012 Ordinary Business PaperPage 202 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFlood Watches are issuedahead of flood producingweather systems. They arebased on rainfall predictionsand a daily assessment ofcatchment conditions.Figure 1 shows the continuingimprovement in Flood Watcheswith over 80% of all floodspreceded by a Watch with anaccuracy ot75%. During 2011the NSW State EmergencyService pre-deployed staff toseveral areas predicted to havemajor flooding by the FloodWatch.Figure 1 - FLOOD WATCHES NSW - 5 year weighted average10080U'e70oõ60=o50of40o30s20'10- -Detection- % Flood Warningspreceded by a Flood Watch-Accuracy - % Flood Watchesfollowed by Flood Warnings/ --\-Nl,\/ Iøu f,0s(ocooôt$(o60(\s(o@o@@@o)o)o)o)o)oooooo) o) o) o) o) o, o) o) o o o o o or C{ C! C\,1 C{ C! NFigure 2 shows that over 80%of flood predictions are accurateto within 0.3 metres.There were 664 flood warningsissued during the year making itthe 3'd busiest year since theBureau's flood warning servicefor NSW started in 1962.10090o8oú,Ë70E"? o60.= 50't 40ttä30oa)E20orlos0Figure 2 - FLOOD WARNING ACCURACY - NSW{@æoNç@æoNÍ@€O€O€OøOoooOOOOooooooØøooooooNNNNNN20001800rsoo 8th1400 IUttzoo p'Ë1000 ËÈ800 E oeoo f,ruoj2000Gordon McKayRegional Hydrology Manager NSW - Glimate and Water DivisionItem 14 2014 CONFERENCE HOST NOMINATIONSNominations to host lhe 2014 annual floodplain management conference were sought frommembers on 4 January. The following nominations were received:Shoalhaven City CouncilDeniliquin GouncilEach nominee will be invited to provide a brief presentation to members at the AGM,following which lhe 2014 Conference Host will be determined by the vote of delegates. Theresult will be announced at the Conference Dinner.Chairman.... .....Executive Officer3lDelegates ReportsFloodplain Management Association Meetings141 of 214 March 2012 Ordinary Business PaperPage 203 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 15 TWEED 2013 NATIONAL CONFERENCEThe 2013 Conference will be held at Tweed Heads from 28 to 31 May.Tweed Shire Council has appointed East Coast Conferences as the provider of conferencemanagement services. We very much look foruvard to working with ECC and have beenimpressed with their previous work with Tweed Shire Council on the 2011 NSW CoastalConference and their work on the Batemans Bay FMA conference.The 2013 Conference is the first national conference of the FMA, and Tweed Shire Councilis honoured to be the hosts of such a prestigious event. Tweed was one of the earlymembers of the FMA, and previous host of the state conference on a number of occasions.Our aim for the National Conference is to attract the foremost minds in the fìeld of floodplainmanagement from across the country, in the technical, political, environmental, climatechange and emergency response spheres. We aim to find out how things are done in otherjurisdictions, under different organisational and budget structures, and whether thesealternative approaches can be beneflcial for our own challenges.Danny RosePlanning and Infrastructure EngineerItem 16 GOSFORD COUNCIL FLOOD RISK MANAGEMENT VIDEOGosford Council received funding from the Natural Disaster Resilience Grant Scheme toproduce a Floodplain Risk Management Video based on a workshop at the 2010conference. Vic Tysoe from Gosford Council will provide a presentation on the video, andhas a limited number of DVDs which will be made available to members.Item 17 ITEMS LISTED FOR DISCUSSION BY MEMBERSItem 18 GENERAL BUSINESSItem 19 NEXT MEETINGThe next scheduled meeting is the May Quarterly Meeting to be held on 24 May,2012 atthe Bureau of Meteorology, 300 Elizabeth Street, Sydney.List of AppendicesAppendix I FMA Meeting ProceduresAppendix 4 FMA Scholarship PolicyAppendix 2 Minutes 2011 Annual General Appendix 5 FMA Constitution 2008MeetingAppendix 6 Audited Financial Statements forAppendix 3 FMA Submission to NSWthe year ended 31 DecemberPlanning ReviewChairman..........Executive Officer32Delegates ReportsFloodplain Management Association Meetings142 of 214 March 2012 Ordinary Business PaperPage 204 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAPPENDIX 1Floodplain Management AssociationMeeting ProceduresVoting1. Each Full Member listed may appoint two (2) only of its delegates to vote on motionsbefore the meeting.2. Each of the Associate and Corporate Members listed may appoint one (1) only of itsdelegates to vote on motions before the meeting.3. Voting delegates shall signify their vote by showing their voting card.4. A decision of a simple majority of the voting delegates who vote shall be the decisionof the meeting.5. Should there be an equality of votes the Meeting Chairperson is entitled to exercisea second or casting vote.Participation by Persons who are not Voting Delegates1. At the Chairperson's discretion, any representative or guest is welcome to participatein debate and discussion during the business and technical sessions.Motions and Amendments1. Any motion on a matter not included in the business papers shall be ruled out oforder unless the voting delegates decide by majority vote to agree to accept such amotion for consideration by the meeting.2. When an amendment is before the meeting no further amendment shall bediscussed until such first amendment has been disposed of.3. Not more than one amendment upon any motion shall be considered unless noticeof such further amendment is given before the amendment under discussion hasbeen disposed of.4. The mover of an amendment which has been adopted as the motion shall (as in thecase of the original motion) have the right of reply to any further amendmentssubmitted.Speakers and Debate1. Each time a person rises to speak, he or she shall first state their name and theorganisation they represent.Chairman..........Executive Officer33Delegates ReportsFloodplain Management Association Meetings143 of 214 March 2012 Ordinary Business PaperPage 205 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBLANK PAGEChairman..........Executive Offìcer34Delegates ReportsFloodplain Management Association Meetings144 of 214 March 2012 Ordinary Business PaperPage 206 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAPPENDIX 2Floodplain Management AuthoritiesMINUTES, ANNUAL GENERAL MEETING1:50 pm, Thursday 24 February, 2011Tamworth Regional Entertainment and Conference Centre,Greg Norman Drive, TamworthItem 1Item 2Item 3Item 4Item 5Item 6Item 7Item IItem 9Item10Item 11Item 12Item 13Item 14Item 15FMA Meeting Procedures, appointment of ScrutineersAttendance and ApologiesConfirmation of Minutes of 2010 Annual General MeetingChairman's ReportExecutive Officer's ReportTreasurer's ReportExecutive Members' ReportsFMA Office Bearers' PositionsLife Membership NominationProposed Constitutional ChangesFMA Scholarship ApplicationReports from Agencies12.1 DECCW12.2 State Emergency Service12.3 Emergency Management NSW12.4 Bureau of MeteorologyReports on Future Conferences13.1 2013 NationalConference - Tweed13.2 2012 Conference - EurobodallaGeneral BusinessNext Scheduled Annual General MeetingChairman.....Executive Officer35Delegates ReportsFloodplain Management Association Meetings145 of 214 March 2012 Ordinary Business PaperPage 207 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 1 Introduction, FMA Meeting Procedures and Appointment ofScrutineersThe meeting observed one minute of silence to reflect on the losses in the recent floods,and the New Zealand earthquake.Members noted the FMA Meeting Procedures. The acting Chairman called for nominationsfor up to four scrutineers.Resolved - Clr Fred Borg, Clr Kevin Crameri and Clr David James be appointed asscrutineers for the meeting.Item 2 Attendance and ApologiesThe Executive Officer advised that Chairman Allan Ezzy is recovering from surgery, andunable to attend the meeting. As provided for by the Constitution in the absence of theChairperson and a Deputy Chairperson, the Executive Officer Glenn Evans is actingChairman.Attendance and apologies are at Appendix 7.Resolved -The apologies as noted be accepted.Item 2 Confirmation of Minutes of the 2010 Annual General MeetingDraft Minutes of the 2010 AGM had been circulated.Resolved - The Minutes as circulated be accepted as a true record of the Annual GeneralMeeting of the 25 February,2010.There was no business arising from the Minutes not covered elsewhere in the agenda.Order of BusinessClr Bolitho (The Hills) moved suspension of standing orders to allow Agenda ltem 8 'FMAOffice Bearers' Positions" to be moved fonuard so that the incoming Chairman could chairthe meeting. Seconded Clr James (Pittwater).Resolved -Standing orders be suspended and Agenda ltem I be dealt with immediately.Item I FMA Office Bearers' PositionsExecutive Officer's circulated report:"Nominations for FMA office bearers' positions were sought from members on 6 January.The following nominations were received by the Executive Officer:Chairperson. Clr lan Dinham, Clarence Valley CouncilDeputy Chairperson: Nonechairman..........Executive offìcer...36Delegates ReportsFloodplain Management Association Meetings146 of 214 March 2012 Ordinary Business PaperPage 208 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aExecutive Member-Technical: David Gibbins, Newcastle City CouncilExecutive Member-Planning: Sue Ribbons, Pittwater CouncilAs only one nomination was received for each position those nominees are elected, and willtake up duty at the Annual General Meeting. Congratulations to lan, David and Sue.ln regard to the vacant position of Deputy Chairperson the Constitution allows the Chairmanto nominate a member to fill the vacancy as an acting executive committee member untilthe next AGM, or to direct the Executive Officer to undertake an election at the nextquarterly meeting. I will therefore await the directions of the Chairman.Glenn EvansExecutive Officer"Resolved - The Executive Officer's Report be received.Delegates congratulated the incoming offìcers by acclamation.Chairman lan Dinham assumed the chair.Clr Dinham thanked delegates for their support over the past 8 years he has served on theExecutive, and paid tribute to former chairs Allan Ezzy and Harold Sternbeck, who had "intheir own ways brought great credit and respect to the organisation." He congratulated SueRibbons and David Gibbins on their appointments, and thanked them for volunteering forthis important service. The FMA now has a new-look team and today marks the start of anew chapter for the organisation.Item 3 Ghairman's ReportThe Outgoing Chairman's Girculated Report was read by the Executive Officer."Welcome to our 2011 Annual General Meeting.A warm welcome to all delegates, especially to those attending for the first time and to ourguest keynote speaker Dr Jon Wicks, from the Halcrow Group in the United Kingdom.Welcome to Australia. We are pleased that you could make yourself available to attend our51st Annual Conference and share your experience with us.A lot has happened since we met twelve months ago on the Central Coast. Sadly we havelost our former Chairman and Life Member Harold Sternbeck. We then welcomed our newExecutive Services Provider Glenn Evans (no stranger to flood mitigation) who has workedtirelessly to become familiar with the internal workings of the FMA, and with the executivemembers. We also welcomed on board our new Executive Member - Planning Sue Ribbonswho wasted no time in getting involved in meetings with the Department of Planning andmaking presentations at the quarterly meetings.We were also honoured at our fifty year conference to be presented with a proclamationfrom the Association of State Floodplain Managers (ASFPM) of the USA by our Americanguests which formerly recognises us as partners in future efforts of concern to our nations.Chairman.......Executive Officer1tDelegates ReportsFloodplain Management Association Meetings147 of 214 March 2012 Ordinary Business PaperPage 209 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aHowever during this period of time I was very disappointed at the decision of KempseyCouncil to withdraw from the FMA, (as well as other organisations) which then forced theresignation of our Deputy Chairperson Clr Betty Green. Thank you Betty for all your veryhard work for the FMA, I hope your council soon reverses that decision.As FMA members we have responsibilities to our respective communities to protect peopleand infrastructure, and to educate residents and professionals. During the past twelve yearsthat I have been Chairman, the FMA has constantly led the way in stepping up to the Stateand Federal governments to give appropriate priority to flood plain management issues -planning, education, and funding.Practioners and Councillors in other states of Australia have expressed their appreciation ofthe work of the FMA, in that NSW is far ahead of other states with our FloodplainDevelopment Manual, generally appropriate standards, and proactive stand on floodingissues. While NSW has made good progress, local government and developers do strugglein their dealings with multiple agencies, which at times have inconsistent flood policies. Thenext obvious step for improving floodplain management in NSW is for there to be a singleagency and minister, not three, with responsibility for supporting local government in itsmanagement of flood risk.Representatives from other states have said that they hoped that their own states wouldfollow many of the standards that exist in NSW thanks to the work of the FMA. That thereare different approaches to flood mitigation around Australia is of concern, and I will besaying more about this at the conference.I must admit that at times I have felt like the ancient Noah of biblical fame in stating tonumerous ministers and senior advisors that "the Drought won't last forever, it will rainagain and we must prepare, and spend the money in preparation". Sadly governments atall levels stood shoulder to shoulder, embracing their developer benefactors and saying"We know better, WE HAVE TO DEAL WITH A DROUGHT" or "we need more housing".Well, Mother Nature has shown us who really is in charge, and the devastating floods inQueensland, Victoria, Tasmania and indeed parts of NSW since Christmas have shown thefolly of not being prepared, as well as the short-sightedness of building on known floodplains. May I at this point, on behalf of the FMA, express our deepest sympathy to thefamilies of those who lost their lives in these recent floods, and our thoughts are with thosewhose homes were flooded, or simply washed away.It is hoped that the recently announced Royal Commission in Queensland will fully look atall the issues; in particular flood mitigation, planning and insurance issues, and that otherstates, our own included, will act responsibly on the findings.The members of the executive have been busy since the November Quarterly Meeting indiscussion with government on a number of issues relating to development and flooding, aswell with a section of the lnsurance lndustry which had sought a meeting with us. Hopefullythis will lead to further discussions.Also discussions have been undertaken with the Planning lnstitute of Australia led by AlanGear, which is very positive and I welcome those members of the lnstitute in attendance.The success of the U.T.S Course continues to show the wisdom of the FMA in pursuing itsestablishment. Many thanks to lan Dinham for his continued efforts with this course, andChairman.......Executive Ofücer38Delegates ReportsFloodplain Management Association Meetings148 of 214 March 2012 Ordinary Business PaperPage 210 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aalso to Duncan Mcluckie of DECCW and his department for their assistance over manyyears.At the November Quarterly Meeting I announced my intention not to stand for re-election asChairman at this Conference. After twelve years as your Chairman I felt it was time for aninfusion of new blood, and new ideas to ensure the continued success of the FMA as thePeak Body on Flood Mitigation in Australia.As I look back and see where we have come from to where we are today, I feel justiflablyproud of what we have achieved as an organisation of over fìfty years - successful lobbying,establishing an education program, building a great association that is financially sound,with connections in the UK and America, and member orientated.For the FMA to remain meaningful and the leader in the field, we must develop"sustainable" relevancy on all issues. By this I mean relevant policy positions succinctlyexpressed; well developed linkages to government at all levels; a structure which supportsand facilitates delivery of sound policy objectives; and leadership which will support,nurture, develop and deliver the FMA program in an inclusive framework.I wish your new executive well as they face the challenges ahead, and the possibility of anew State Government to deal with. But remember they can only be as effective as you willallow them to be by ensuring that you provide feedback. Also it is vital that your ownorganisation fully participates in making sure your local Member of Parliament is constantlyinformed of issues, and asked to assist in lobbying relevant Ministers in relation to planningand flood related issues.At this AGM there is a number of amendments you will be asked to vote on in relation tochanges to the Constitution and the structure of the FMA, which will make our organisationmore effective, and which I hope you will favourably consider.Finally thank you to Glenn Evans, lan Dinham, Betty Green, and Sue Ribbons for yourassistance and hard work over the past year, and to you Delegates who have supportedand trusted me over the past twelve years as your Chairman and voice in dealing withGovernment, and the Media, to get the message out in respect of sound floodplainmanagement, education and financing of such issues.It's been a privilege.Kind RegardsClr Alfan Ezzy APMChairman"Executive Officer's comments: Clr Ezzy's Conference Address elaborated on issueswhich were raised in the Chairman's AGM Report, and the Executive Officer suggested thatdelegates formally endorse the seven priority points for action by governments. Clr Ezzy'sAddress is at Appendix 8.Resolved -1. The Chairman's Report be adopted2. The FMA Executive and Member Authorities pursue the following sevenpriority issues with the NSW Government and Opposition, and the Australian Government:Chairman..........Executive Officer39Delegates ReportsFloodplain Management Association Meetings149 of 214 March 2012 Ordinary Business PaperPage 211 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRestore NSW Government Funding Levels for Flood Mitigation lnfrastructure to $15million per year for capital works, and $5 million per year for maintenance of worksRestore NSW Government Specialist Staff Levelslncrease Funding for Local Government StaffFinalise Flood Mitigation lnfrastructure DatabaseEstablish a Single NSW Ministry and Agency for FloodsAny NSW Flood Review should be independent, whole of government and includethe FMA and Local Government input to the terms of reference and SteeringCommitteeEstablish a Cooperative Research Centre for Floods similar to that which exists forbushfireItem 5 Executive Officer's ReportExecutive Officer's circulated report:"Executive CommitteeOn 19 July lofficially took on the role of Executive Services Providerforthe FMA. lthankthe FMA for the opportunity to contribute to the future of this great organisation.The previous Executive Services Provider, Wilton Boyd made a great contribution to theFMA over a long period, and what is probably not well recognised is the large amount ofeffort he expended behind the scenes to achieve the FMA's many positive outcomes. I wishto thank Wilton for his patience and perseverance during the handover period.The last seven months have provided a very steep learning curve for me, and it has beenquite a challenging time for the Executive Committee as new processes were set up formanaging the administrative and financial functions. Then most unfortunately, Clr BettyGreen was required to relinquish her position as Deputy Chair following withdrawal ofKempsey Council from FMA membership. Betty's role was very much "hands on", dealingwith many day to day issues and following up actions arising from members' meetings. Hercontribution was much appreciated. More recently Clr Allan Ezzy's health has preventedhim from fully participating in FMA business, although he has continued to contribute whilerecuperating.It has been a great pleasure to work with Allan over this seven months, and although I haveknown Allan since he became Chairman 12 years ago, I was not fully aware of the numberof committees and boards in which he participates, the extent of his networking and theamount of effort he puts in to pursuing FMA issues. I have no doubt that Allan will continueto make a great contribution as our next lmmediate Past Chairman.I also wish to acknowledge the passing of past Chairman, Harold Sternbeck, last July.Harold was an FMA delegate initially from Cessnock Council in 1972, then from the HunterCatchment Management Trust; he was FMA Chairman from 1991 to 1999, then DeputyChairman in 2003 and 2004. Harold's prowess as a persuasive campaigner for floodChairman........Executive Offìcer...40Delegates ReportsFloodplain Management Association Meetings150 of 214 March 2012 Ordinary Business PaperPage 212 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.amitigation continues to be recognised through the FMA's Sternbeck Medal which isawarded for outstanding presentations at the annual conference.ln 2011 our Executive will evolve with the "graduation" of Clr lan Dinham to Chairman aftereight years as Executive Member - Technical, another term for Sue Ribbons in thePlanning role, and appointment of long time contributor David Gibbins to the Technical role.You indeed have a very talented executive team.National Organisation Progress Reportln addition to the numerous activities and meetings which the Chairman and ExecutiveMembers are reporting on, the issue of a national FMA organisation has occupied muchtime. The 2010 AGM resolved:"That the AGM requests that the FMA Executive pursue the development of a federal FMAby the formation of an incorporated body within the ACT..."And "That the name "Flood Mitigation Authorities of Australia" be reserved as firstpreference , "Floodplain Management Authorities of Australia" the second preference..... "Advice was sought from Marsdens Law Group on options for forming a national body, andtheir report and commentary were provided to the November Quarterly Meeting. Themeeting discussed incorporation and becoming a company limited by guarantee; costsassociated with set up and continuing reporting requirements; and the need for a new formof constitution.The meeting also discussed a third model of an informal association of state and territoryflood practitioners, a similar arrangement to that used effectively by the 56 CatchmentManagement Authorities across Australia when communicating with the CommonwealthGovernment.As reported to the November meeting I discussed these three options with Victorian FloodConference attendees, including two CMA CEOs present. While there was generalagreement that there would be mutual beneflts in Victoria and NSW holding more joint floodconferences, such as the 2009 conference, there appeared to be only limited support forjoining a national organisation at this stage. The general view was that the FMA's structureand aims are quite different to those of the Victorian organisation and it would be difficult ofalign the interests of both states.There is no doubt that floodplain management would benefit from national networking andrepresentation, but the best mutually acceptable method needs to be determined.Considerable setup and ongoing reporting costs would be required if the FMA were toincorporate, or become a company, and at this stage, there is not demonstrable interestfrom states and territories to justify this investment.Priority actions and funding to progress this matter are included in the 2011 Business Plan:networking with flood practitioners in other states and territories; where appropriatecontributing to interstate flood inquiries; and planning for a National FMA Conference 2013.The Goming YearThe FMA has great opportunities and challenges in the wake of the flood disasters of thelast few months. Until very recently there has been little comprehension outsideprofessional floodplain management circles that flooding is an ever-present risk to personalsafety, property and the national economy. Over the last decade government budgets andChairman..............Executive Officer4lDelegates ReportsFloodplain Management Association Meetings151 of 214 March 2012 Ordinary Business PaperPage 213 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.atechnical support related to flood issues have shrunk dramatically. As the tide ofunderstanding begins to turn the FMA and its members will need to ensure that they arepositioned to advise and influence governments as they reconsider their floodresponsibilities.It is my role to provide the best support for the FMA as it applies its wealth of technical,planning, economic and educational expertise to making NSW a safer place in times offlood, and where appropriate, assists our interstate colleagues in their similar endeavours.But the FMA cannot achieve everything it wishes without a greater voluntary input frommembers. The contribution of members to recent planning groups has been veryproductive, and is the type of "load sharing" which the Executive will be encouraging in thecoming year. lt is therefore important that members send at least one delegate to each ofour Quarterly Meetings.2011 Quarterly Meeting DatesAll 2011 Quarterly Meetings will be held in the McKell Building Auditorium, Rawson Place,Sydney. Please place these dates in your diary:¡ Thursday 26 May 2011. Thursday 25 August 2011¡ Thursday 24 November 2011A light luncheon is served after the meetings to enable members to network.I look forward to working with you over the coming year.Glenn EvansExecutive Officer"Resolved -1. The Executive Officer's Report be received2. The FMA progresses the formation of a national association as set out inthe 2011 Business Plan, which identifies as priority actions: networking with floodpractitioners in other states and territories; where appropriate contributing to interstate floodinquiries; and planning for a National FMA Conference 2013.Item 6 Treasurer's ReportTreasurer's circulated report:"6.1 2010 Financial Year Audit ReportThe Financial Statements for the year ended 31 December 2010 are at Appendix 3The report confirms that the F MA is in a sound financial position with Net Assets of$151 ,706.6.22011 Business PlanThe 2011 Business Plan, which includes the 2011 Financial Plan, was prepared by theExecutive Committee and has been provided separately to financial members.The Plan proposes improvements in Organisational Capacity, including an increase inmember participation and strengthening relationships with interstate flood practitioners; anChairman.......Executive Officer42Delegates ReportsFloodplain Management Association Meetings152 of 214 March 2012 Ordinary Business PaperPage 214 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aincrease in Lobbying activity particularly in the wake of the disastrous floods aroundAustralia; and maintenance of value Member Services including redevelopment of the FMAwebsite. An adjustment to the member fees is recommended by the Executive to ensurethat the FMA is able to serve its members in a professional manner, while retaining itssound financial position into the future.Alternative FMA logo designs, referred to in the Plan, will be displayed at the conference.Glenn EvansTreasurer"The 2011 FMA Business Plan is at Appendix 9.Resolved unanimously - 1. The Treasurer's Report be received2.The draft2011 Business Plan be adopted.Item 6.3 2011 Business Plan lmplementationThe Chairman advised that there was not the required quorum of 60% of Full Memberspresent to enable the constitutional changes to be progressed, therefore the followingBusiness Plan actions were recommended for adoption under the current constitution toeffect some of the proposed organisational changes."Organisational Capacity Action Plan5. Update the Presentation of the FMAThe FMA's name, officers' titles and logo have remained unchanged for manyyears and no longer reflect modern practice. The 2011 AGM will consider changesrecommended by the FMA Executive."Executive Officer's ReportThe following actions which are consistent with the 2008 Constitution are recommended forapproval:FMA to be known as "The Floodplain Management Association"This title more appropriately reflects the membership of councils, county councils, CMAs,agencies, businesses, individuals and interstate organisations, and is consistent withterminology used by similar overseas organisations. The abbreviated title FMA isunchanged.Executive Members to be called "Directo/'Executive Member-Technical and Executive Member-Planning are cumbersome andconfusing titles. "Director" more accurately portrays the role and is consistent withterminology used in common usage. The roles and duties remain as in the Constitution.New Volunteer Gommunications Officer role be created.Chairman.......Executive officer...43Delegates ReportsFloodplain Management Association Meetings153 of 214 March 2012 Ordinary Business PaperPage 215 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThe FMA needs to greatly improve its internal and external communications, engage morewith our interstate colleagues and become a respected first port of call for information onflood issues. A key mechanism to achieve this is using a modern interactive website whichcan serve as a communications hub for floodplain management issues, provide linkages toother relevant sites, facilitate online discussion and information exchange, and be amarketing tool where "The FMA' would come to the head of website searches related to"flood". The main role of the Communications Officer would be development of the website,and its day to day management. A volunteer or volunteers would be sought from amongFull Members, with operating guidelines to be developed by the FMA Executive.New FMA LogoThe Executive foreshadowed in the draft Business Plan that it would recommend that a newlogo be adopted to portray a fresh progressive image for the FMA.Two alternative logos, together with the existing logo, have been on display at the FMAbooth since the beginning of the conference.Delegates will be asked to vote for the logo which they consider best depicts Australia'sleading Association of Floodplain Managers.Logo ILogo 2Logo 3FLOODPLAIN MANAGEMENT AUTHORITI ESChairman..........Executive Officer44Delegates ReportsFloodplain Management Association Meetings154 of 214 March 2012 Ordinary Business PaperPage 216 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aGlenn EvansExecutive OfficerResolved unanimously -1. The FMA to be known as "The Floodplain Management Association"2. Executive Members to be called "Director"3 A new Volunteer Communications Officer role be created4. The preferred logo for the FMA be determined by a vote of members.The Chairman called for Delegates to vote for their preferred logo.Results:Round: 1 Logo 1-3votes, Logo 2-39 votes, Logo3-29votes. Logo l eliminated.Round: 2 Logo 2 - 37 votes, logo 3 - 26 votes.The Ghairman declared that Logo 2 will be adopted by the FMA, noting that the word"Authorities" will be replaced by "Association" at the appropriate time.Item 7 Executive Members'Reports7.1 Executive Member - Technical lan DinhamCirculated Report"Floodplain Risk Management CourseOnce again the 2010 FRM course has been successfully completed with thanks to all of thepresenters as well as those Councils who enrolled their representatives in the course. Thefeedback has again been very positive and the course continues to improve with further"fine tuning" each year.The 2010 year attracted 28 industry representatives and 16 undergraduates which is anexcellent response all round. ln addition to the many councils who enrolled representativesthis year, there were also representatives from state agencies and private consulting. Thepositive feedback from the Town Planners present was particularly pleasing and reinforcedthe relevance of the course to all participants including our Town Planning colleagues.The 2011 year will be our 4th year of running the FRM course and your support in sendingyour staff and Councillors is very much appreciated. We would like to encourage all FMAmembers to enrol staff and Councillors, including strategic Town Planners to at least attendBlock 3 of the course.I wish to thank all those involved at all levels and thank those Councils who have shownsupport this year as well as those who will support the course in the coming year.Chairman.... ....Executive Officer...45Delegates ReportsFloodplain Management Association Meetings155 of 214 March 2012 Ordinary Business PaperPage 217 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOne Day Pre-conference Workshops - 2010Two one day workshops were conducted at the 2010 Annual Conference in Tumbi Umbiwith the following themes:-1. Managing Changing Standards in Flood Risk AssessmentThis workshop concentrated on the current review of Australian Rainfall and Runoff. Theworkshop was very interactive with good exchange of ideas between speakers and theaudience. Much of the discussion was of a technical nature but the workshop generallyprovided an excellent forum to gain insight to the issues involved in the updating AR&R by2012.2. Managing Flood Risk with Land Use PlanningThis workshop was an excellent mix of presentations delivered by representatives from theNSW Department of Planning, local Government, DECCW and the SES.Many interesting and different challenges were illustrated by the presenters including theimpossible position confronting local government and floodplain management authorities asa result of inconsistency between planning guidelines and the NSW FloodplainDevelopment Manual.The workshop also provided an opportunity to discuss our problems over lunch with theNSW Department of Planning representatives. The feedback from both workshops wasvery positive in the ensuing days of the conference proper, and all those involved are to becongratulated.ln particular, Duncan Mcluckie is to be congratulated for his tireless efforts in the planningand staging of these workshops and his continued involvement with the FRM Course atUTS in 2010. Also, lwish to thank all those who prepared and delivered presentations andall those who attended this year's valuable workshops.National Flood Management Workshop - EMAln April 2010, our Chairman Allan Ezzy and I attended the National Flood ManagementWorkshop at Mount Macedon, Victoria.The workshop generally worked through the Emergency Management Australia FloodManuals which were launched in October 2009 by the Federal Attorney General. The forumincluded presentations from SES and other state agencies as well as the lnsurance Councilof Australia.Attendees from all over Australia were present and there were good opportunities for inputto the discussion about strategies and policies for the future. The workshop was hosted freeof charge for delegates by Emergency Management Australia.IAFSM Gonference - Ghicago lllinoisAt the invitation of the lllinois Association of Floodplain and Stormwater Managers, Iattended their 2010 conference as a keynote speaker in March this year. (Note: There wasminimal cost to the FMA as the IAFSM paid the airfares and accommodation)The conference was attended by approximately 550 delegates who showed a keen interestin our Australian methods for planning and floodplain management. My keynote addressChairman........Executive OfficerDelegates ReportsFloodplain Management Association Meetings156 of 214 March 2012 Ordinary Business PaperPage 218 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.awas well received with many questions and enthusiastic comments forthcoming at theconclusion.I was also asked to jointly present a paper with Paul Osman. Members will remember Paulfrom his outstanding presentation to our 2009 conference at Albury. The theme of our jointpresentation was a comparison of floodplain management measures between our twocountries with the "Two Graftons" in NSW and lllinois. This paper was then published in theIAFSM newsletter and circulated in the USA.The visit has further strengthened our "partnership" in sharing floodplain managementexpertise with our American colleagues for the benefit of both our respective communities.There was also ample opportunity to promote our own annual conference and muchinterest was expressed by many of the conference delegates in attending these in thefuture.Final CommentsAfter 8 years in the position of Executive Member - Technical, I have decided it is time for achange and I have not nominated for this position for another term.I very much thank all members of the FMA for the opportunity to be part of the Executiveduring this time and I hope that my effofts on your behalf have been helpful in promotingthe cause of floodplain management generally.As I leave the position, I particularly wish to pay tribute to Mr Duncan Mcluckie for hisprofessional advice and input to the development of the FMA Education program. We havespent countless hours together shaping the FRM Course and the One Day Workshops andnone of it would have been possible without his invaluable expertise and dedication.I very much wish to thank our Chairperson, Clr Allan Ezzy, and fellow members of the FMAExecutive, both past and present, for their advice and teamwork over the years, and Iextend my very best wishes to Mr David Gibbons, who has kindly nominated for this role asour next Executive Member- Technical.lan DinhamExecutive Member - Technical"Resolved - The report of the Executive Member - Technical be received.7.2 Executive Member - Land Use Planning Sue RibbonsCirculated Report"lntroductionIt has now been almost a year that I have served the position of Executive Member - LandUse Planning on the FMA following the resignation of Allan Gear in early 2010. Allan'sshoes were big shoes to fill and it was important to build upon Allan's work andachievements from his three years serving the FMA. Summarised below are some of thekey activities of the FMA in 2010 that relate to land use planning. Many issues have,frustratingly, yet to be resolved.Land Use Planning Working PartyA Land Use Planning Working Party has been established between the FMA, Departmentof Environment, Climate Change and Water (DECCW) and the NSW Department ofChairman..........Executive Officer47Delegates ReportsFloodplain Management Association Meetings157 of 214 March 2012 Ordinary Business PaperPage 219 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aPlanning. lt is envisaged that this Working Party will provide a mechanism by whichupcoming proposals for changes to land use planning legislation can be discussed betweenall parties, with hopefully mutually agreeable solutions achieved and appropriate supportinginformation prepared, before the legislation 'hits the streets'. The flrst preliminary meetingof the Working Party was held in late December 2010 to develop a list of key agenda itemsfor future meetings. lt is hoped that the Working Party will meet at least quarterly, with theflrst full meeting planned in March or April 2011.Local Environmental Plan (LEP) - Model Clause for Land Use PlanningThe model clause for flood planning to be used in the Standard lnstrument for preparingLocal Council's LEPs is an ongoing issue that is yet to be resolved. ln October 2010, theDepartment of Planning released a first draft of a Practice Note to accompany the LEPModel Clause for Flood Planning. lncluded in the draft Practice Note was an updated draftof the LEP Model Clause for Flood Planning. Once again, it was of concern that the DraftPractice Note and Model Clause, do not refer to 'flood-prone' land as defined by theFloodplain Development Manual. Consequently, this issue is a key agenda item for theLand Use Planning Working Party.NSW legislation relating to LEPs, the Standard lnstrument, Model Clauses, PlanningCirculars and the like, are topics that many councils' 'flood engineers' have not had totraditionally deal with. To help put this legislation into perspective for FMA members, Iprovided a short presentation and discussion about this issue at the FMA Quarterly Meetingin May. My paper at the 2011 FMA Conference in Tamworth expands on this presentationto help put this legislation into perspective for a wider audience of flood risk managementpractitioners.Complying Development on Flood Gontrol LotsThis is another issue that came as a surprise to many flood risk management practitionerswhen it was released by the Department of Planning in December 2010 for implementationin February 2011. This issue involvesthe amendment of the State Environmental PlanningPolicy (Exempt and Complying Development Codes) 2008 (the Codes SEPP) to allowcomplying development (residential development) to proceed on low flood risk and mediumflood risk properties, without the need for a Development Application. The complyingdevelopment will have to apply the flood-related development controls listed in the CodesSEPP, which override Council's flood-related development controls.Again, this issue is a key agenda item for the Land Use Planning Working Party. ln mid-January, an FMA Technical Working Group of interested flood risk managementpractitioners met to discuss this issue with the aim of assembling a single consistent list ofcomments and suggestions to present to the Department of Planning. The Department ofPlanning has indicated that it is willing to meet with this Technical Working Group to discussthe issue, and it is hoped that this meeting can take place in February or March.The FMA has written to the Department of Planning suggesting that it may be beneficial tohold a series of workshops across the state to provide information and explain this latestlegislation to all Councils in NSW. Whether these workshops will take place, has yet to beconfirmed.Section 149 Planning CertificatesThe provision of notations relating to flooding on property planning certificates attached tothe title of the land (known as Section 149 Certificates) has long caused angst and evenhostility within many local communities. The community regards the flood notation as'property devaluers' and often blames the Council for'suddenly making me flood-prone'. lnChairman.......Executive Officer48Delegates ReportsFloodplain Management Association Meetings158 of 214 March 2012 Ordinary Business PaperPage 220 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.asimple terms, if 'flood-related development controls' apply to a property (not necessarilyhow or whether the property is flood-affected), Councils must apply a relevant notation tothe Section 149 Planning Certificate for that property.Again, to help provide additional information and promote discussion on this issue, Iprovided a short presentation and discussion at the FMA Quarterly Meeting in November.To assist the FMA gain an overall picture of how Councils are dealing with the issue ofSection 149 Planning Certificates, Gosford Council have initiated a survey of all FMAmembers that relates to Section 149 Planning Certificates, floodplain categorisation andflood mapping. I encourage you to complete the on-line survey which will be sent to allFMA members in February or early March.Presentation at Natural Advisory Council of NSWThe Natural Resources Advisory Council of NSW (NRAC) invited the FMA to give apresentation at their August meeting about the FMA and flood risk management in NSWgenerally. lt was with great pleasure that I accepted the invitation from the FMA to give thatpresentation. NRAC was established by the NSW Government in 2004 as a single sourceof integrated stakeholder advice on high level natural resources management and land useissues. NRAC reports to the Hon. Frank Sartor MP Minister for Climate Change and theEnvironment and, Minister Assisting the Minister for Health. NRAC draws its members fromfive government departments and 22 community and stakeholder groups.For the information of members, I presented the same presentation at the FMA QuarterlyMeeting in August.Aspirations for the FutureMy aspirations for my future involvement with the FMA revolve around communication andknowledge. ln 2010, lhave learnt a great deal about strategic planning issues andlegislation as it relates to flood risk management. I have also learnt a lot about thefrustrations of seemingly ad-hoc state government requirements that do not appearconsistent with current flood risk management best-practice.My aspiration is to see the FMA grow into a hub of knowledge of information, made up of arange of like-minded professionals who understand that flood risk management starts withland use planning. Please remember though, that the FMA, by itself, does not have thebudget or the resources to be a 'magic wand' to solve, deal with or even understand all ofthe ever-increasing land use planning issues that relate to flood risk management. But theFMA is certainly working on it and moving forward, albeit with 'baby steps'. lt will only bewith the support, the input and the comradery of our fellow FMA members that theseaspirations will be realised.I look forward to working with you all.Sue RibbonsExecutive Member - Land Use Planning"Resolved - The report of the Executive Member- Land Use Planning be received.Chairman.......Executive Officer49Delegates ReportsFloodplain Management Association Meetings159 of 214 March 2012 Ordinary Business PaperPage 221 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 9 Life Membership NominationThe FMA Constitution provides for the category of Life Member in recognition ofoutstanding meritorious service. The only previous Life Member was the late HaroldSternbeck, who served as an FMA delegate from 1972, as Chairman from 1991 to 1999,then Deputy Chairman in 2003 and 2004.The following nomination has been received for the category of Life Member:"Re: Life Member NominationThe current Chairperson of the FMA, Mr Allan Ezzy, has indicated that he will not bestanding for re-election at the forthcoming Annual General Meeting in February 2011.Through his leadership, Allan has made an outstanding contribution to the progress of theFMA and the promotion of sound floodplain management practices across NSW andAustralia.He has served as Chairperson for the past 12 years and represented the FMA in a widerange of forums. His work in making deputations to Ministers, issuing press releases andpersonal representations has furthered the cause of floodplain management significantly.During his period as Chairperson, the FMA has moved with the times and become a moreprofessional organisation. Such initiatives as the preparation of a business plan, theadoption of a constitution, the establishment of an internet website and the broadening ofthe FMA Executive to include a Technical Member and a Planning Member have allcontributed to the improved profile of the FMA.I therefore have much pleasure in nominating Cr Allan Ezzy for Life Membership of theFMA in recognition of his achievements and his ongoing involvement as lmmediate PastChairperson.I would be prepared to speak further to this nomination if requested to do so.Yours Faithfullylan DinhamFMA Executive Member Technical"Executive Officer's Gomments: ln my opinion the nomination satisfies the requirementsas set out in the Constitution. The flnancial implications for the FMA are annual conferenceregistration and accommodation costs of up to approximately $2 000 and a foregone annuallndividual Membership fee of $110. These costs could be accommodated in the FMAbudget. The nomination is supported.Resolved unanimously - Life Membership be conferred on Clr Allan Ezzy in recognition ofhis outstanding meritorious service to the FMA.Item 10 Proposed Constitutional Changes - deferred until end of meetingItem 11 FMA Scholarship ApplicationThe 2010 AGM endorsed the FMA Scholarship Policy which provides forfinancial supportfor part expenses of short courses, research into relevant matters or educational visitsChairman...... ....Executive OffìcerDelegates ReportsFloodplain Management Association Meetings160 of 214 March 2012 Ordinary Business PaperPage 222 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.ainterstate or overseas. The FMA may provide up to 50% of the cost of the educationprogram, or $2000 whichever is the lesser. The Scholarship Policy is at Appendix 4.Applications for the FMA Scholarship were sought from members on 6 January. Oneapplication was received, from Greg D. Jones Senior Floodplain Management and ClimateChange Officer - Environmental Security, Lake Macquarie City Council.Mr Jones' proposal is for a maximum one month duration study tour of various locations inthe State of Nevada, USA to investigate and report back to the FMA and Lake MacquarieCity Council on emergency and floodplain management practices undertaken in theaffected Nevada regions.The tour will be undeftaken and funded on a private basis by the proponent, sanctioned byLake Macquarie City Council. The estimated cost of the program is between $4973 and$6752, depending on the length of the tour. Financial assistance requested from the FMA is$2000. Mr Jones proposal is at Appendix 5.The proposal has been reviewed by the Executive. lt satisfies the FMA Scholarship Policyrequirements, and is recommended for approval.Glenn EvansExecutive OfficerResolved - The FMA provides up to 50% of the cost of Mr Jones' study tour of Nevada,USA, or $2000 whichever is the lesser, on condition that:1. A written report of a standard acceptable to the Executive of the FMA is tabled at thenext available Quarterly Meeting and next AGM after completion of the education program.2. A presentation regarding the Scholarship is provided at the Annual Conference followingcompletion of the program.Item 12 Reports from Agencies12.1 DECCWA verbal report was provided by Duncan Mcluckie.NSW Flood DatabaseMr Mcluckie noted that there was some confusion about ownership and development ofthe database. lt is a government concept, not a private concept, and will be made freelyavailable to councils if it is developed further. The data which has been collected will bemade available back to the councils that provide data. Cardno is a consultant working forDECCW on the project; Cardno is not working on the database for itself, or to sell the data.Brochures were made available to delegates.Pre-conference Workshop on LeveesA brochure was distributed by Flood Barriers Australia Pty Ltd at the workshop which statedthat DECCW has agreed to review a guideline it has in relation to temporary flood barriers.DECCW has in fact only agreed to review a letter provided by FBA, not the guideline.UTS Flood Risk Management GourseDelegates were reminded that the course is running again this year, and brochures wereavailable from the FMA booth.Chairman..........Executive Officer5lDelegates ReportsFloodplain Management Association Meetings161 of 214 March 2012 Ordinary Business PaperPage 223 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aResolved - The report from DECCW be received.12.2 State Emergency ServiceA verbal report was provided by Steve Opper, Director Emergency Risk Management. Thereport concentrated on issues which had not been discussed elsewhere at the conference.SES RestructureThe SES has undergone a significant restructure resulting in the organisation being splitinto two business arms Operations, and Corporate Services and Planning. TheOperations group now has an East and West Division based on the Great Dividing Rangewhich will facilitate communication and sound business planning. Mr Opper is in CorporateServices and Planning and heads the Community Safety Directorate.Flood GaugesThe SES is participating in a working group set up under the State EmergencyManagement Committee which has been looking at management of flood gauges. TheCrown Solicitor has advised that not one agency has authority to influence the managementor operation of gauges used in flood warning. Some legislative change may be needed toresolve this situation.Land Use PlanningThe SES has no legislative role in land use planning, but much of the advice which SESprovides needs to be taken more seriously. Options are being explored by SES, andenquiries into floods in various places may make some recommendations in that regard.Ministerial CouncilThe Ministerial Council on Police and Emergency Management met in Canberra on 11February, and framed a communiqué with 11 priorities mostly focussed on flood. Thosepriorities have been directed to the National Emergency Management Committee, the peakemergency management body in Australia. At least 7 recommendations have direct orindirect implications for the SES.Resolved - The report from the SES be received.12.3 Emergency Management NSWThe following report provided by Mr Ben Becarri was read to the meeting by the ExecutiveOfficer:"Emergency Management NSW - Report to the Annual General Meeting of theFfoodplain Management Authorities, 24 February 2011Over the past 12 months Emergency Management NSW has continued the implementationof the joint State - Commonwealth four year Natural Disaster Resilience Program (NDRP).The evaluation of the various mitigation programs is ongoing. Past and current projectmanagers may be requested to provide information to support this work.Chairman.......Executive Officer52Delegates ReportsFloodplain Management Association Meetings162 of 214 March 2012 Ordinary Business PaperPage 224 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNatural Disaster Mitigation Programme - Outstanding ProjectsA number of projects funded under the NDMP are yet to be completed. Councils areencouraged to complete these projects as soon as practicable.Natural Disaster Resilience Program - Funding Arrangements for 2011-12Funding for floodplain risk management projects formerly allocated through the NDMP andNatural Disaster Resilience Grants Scheme (NDRGS) is now being allocated through theState Floodplain Management Program. Enquiries regarding flood specific grants should bedirected to the Department of Environment, Climate Change and Water.Two new programs established under the NDRP for 2011-12 will be administered byEmergency Management NSW:tr The Auxiliary Disaster Resilience Grants Scheme to fund locally-based, multi-hazarddisaster resilience and emergency management projects or projects addressing hazardsother than flood and bush fire. Councils considering all-hazard emergency managementprojects with a flood component may wish to consider submitting an application for theAuxiliary Disaster Resilience Grants Scheme.n The State Projects Program assists emergency management organisations operating atthe State level to deliver projects relating to natural disaster risk knowledge gaps, trial orenhance programs contributing to a community's natural disaster resilience or enhanceemergency management capability on a State-wide basis. The Floodplain ManagementAuthorities is eligible to apply for this program (with sponsorship from an appropriate body).An example of a potential project that may be eligible under this program would be thefurther development of the floodplain risk management videos being funded under thecurrent NDRGS.Further information on current and former grants programs is available on the EmergencyManagement NSW Website http:/lwww.emergency.nsw.gov.au/fundingawards/ndrp"Resolved - The report from Emergency Management NSW be received.12.4 Bureau of MeteorologyFlood Warning Activities 2010111Mr McKay spoke to his circulated report."Overview of the yearMajor floods occurred in all NSW western flowing rivers except for the Gwydir River, whichonly had some minor events. Moderate to major floods also occurred in the Richmond,Wilsons, Clarence and Bellinger Valleys on the NSW north coast. Figure 1 showscontinuing improvement in Flood Watches with over 80% of all floods preceded by a Watchwith an accuracy of 72o/o. Figure 2 shows that the previous record number of flood warningsestablished in 1997/98 has been smashed by nearly 50% with still 4 months to go. Over80% of flood predictions are accurate to within 0.3 metres.Chairman.......Executive Offìcer53Delegates ReportsFloodplain Management Association Meetings163 of 214 March 2012 Ordinary Business PaperPage 225 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFþue I -FI@DWÆO€S ISW -51æar wifttedaeraçFþure 2 - FLOOD WARI{Ì,¡G ACCURACY lllswoP. 70oEoos¡50ofæo30s n100træ€d* Accuracy - % Flood Watchestuhild b/Fbodl ârilsby a Flood Vlâcht(oc00N\t(o60Nt@ooæcoOOo¡o,o)o)OOOOoFoooo)oÚ)o)o)ooooooNNNNNNø 100EËe0Eaoílci 70,= 60Ë50o403soo9zoott 10:eo€ONT@FONç@OO6ôOOOOêOOFNoFoOÈOFo0NoE€OOOOOOêOOOoooøooooooooFNNNilN2000tt1800 q,freoo $1400 o Elrzoo .EÊ,looo ãroo ì tt600t400 r¡-zoo i0The major floods were estimated to have wiped some $500 million of the value of crops inNSW as well as causing damage to roads and property. One benefit, however, is thatoverall water storage capacity in NSW is currently over 68%, up from only 28o/o last year.Refertohttp://water.bom.gov.au/waterstorage/awr¡s/index.html#urn:bom.gov.au:awris:common:codel ist: reg ion. state : newsouthwales fo r fu rthe r deta i ls.Key issue - river gauges used for flood warningsThe NSW flood warning service is underpinned by real time information from some 1,500river gauges that are owned and operated by a number of state and local governmentagencies. The State Emergency Management Committee established a working group,which included a number of Flood Warning Consultative Committee members, to providerecommendations to ensure the flood warning capability of the NSW river level gaugenetwork.Currently there is no specific legislative authority to require flood gauges to be maintainedor operated. A number of agencies, including councils, are under financial strain whichcould threaten the future of the NSW network in several areas. Any reduction in the size ofthe network will affect the accuracy and timeliness of flood forecasts as the Bureau's realtime flood modelling is calibrated against this live data. As well, the community and SESrely on this information to help them assess local flooding conditions at locations for whichspecific forecasts are not issued by the Bureau.Gordon McKayRegional Hydrology Manager NSW - Climate and Water Division"Resolved - 1. The Bureau of Meteorology's Report be received2. The FMA pursue resolution of ownership and funding of rainfall and rivergauges used for flood warning through the Flood Warning Consultative Committee, and atagency and ministerial level.Chairman..........Executive Officer...54Delegates ReportsFloodplain Management Association Meetings164 of 214 March 2012 Ordinary Business PaperPage 226 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 13 Reports on Future Gonferences13.1 2013 National Conference - TweedThe Chairman declared a non-pecuniary interest as he is an employee of Tweed ShireCouncil, and left the meeting for this item. The Executive Officer assumed the chair.Circulated Report by the Executive Officer"Applications for the hosting the 2013 Annual Conference were sought from members on 6January. Members were advised that the FMA Executive recommends that the 2013Conference be a National Conference to be held in NSW in May. The following nominationwas received from Tweed Shire Council."Re: Nomination to Host FMA Conference 2013I am pleased to advise that Tweed Shire Council, at its meeting of the 18th January 2011,resolved to nominate as host for the FMA Conference to be held in May 2013.Council has considered the guidelines for hosting the conference and is prepared to do soin accordance with the stipulated requirements.Tweed Shire Council has the necessary expertise and financial resources to provide a flrstclass professional conference and a memorable experience for all attendees.I understand that the FMA is considering staging the 2013 conference as a nationalconference and Tweed Shire is an ideal venue for such an event as there are numerousvenue options and ample accommodation of all standards from luxury to budget level.Coolangatta airport provides an extensive range of direct flights within Australia as well assome international routes. Brisbane airport is also within easy reach via freeway forinternational delegates and anyone who may prefer that option.I look forward to discussing Council's nomination further with you at your convenience and Iwould be pleased to provide any additional information you may require.Yours FaithfullyMike RaynerGeneral ManagerTweed Shire Council"As only one nomination was received the 2013 Conference will be hosted by Tweed ShireCouncil. Congratulations TSC."Glenn EvansExecutive OfficerResolved - The Executive Officer's Report be received.Clr Dinham returned, and resumed chairing the meeting.Chairman.......Executive Officer55Delegates ReportsFloodplain Management Association Meetings165 of 214 March 2012 Ordinary Business PaperPage 227 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a13.2 2012 Eu robodal la GonferenceCirculated Report"lnvitation to attend the 2012 FMA Conference - Batemans BayOn behalf of Councillor Fergus Thompson, Mayor of Eurobodalla Shire, the programorganising committee invites delegates to the Flood Management Authorities conference tobe held in Batemans Bay between February 20 and 24 2012.Batemans Bay caters for everyone as a conference destination with plenty ofaccommodation options and everything you need to work, relax and have fun close at hand.The cafes and restaurants are sensational and good coffee is not hard to find.Within minutes of the town centre you'll find excellent fishing, swimming, snorkelling, diving,kayaking, beach walks, headlands and lookouts. For those of you who wish to stay activewhile working away from home, there is an Olympic swimming pool, gymnasiums, sportsflelds and an extensive pathway along the foreshore for walkers, joggers and cyclists.Batemans Bay is a four hour drive from Sydney, 1.5 hours from Canberra or an easy flightto the regional airport at Moruya.We look forward to welcoming you at next year's conference and guarantee to provide youwith a great venue and a challenging program.Update on progress of Organising Committee for the 2012 GonferenceThe program organising committee has been finalised with representatives from the hostCouncil, the FMA and State Agencies. A separate sub-committee to review the abstractshas been formed that draws on technical and planning expertise.Eurobodalla Shire Council resolved to appoint a professional firm to manage theconference in 2012. Expressions of interest from three flrms have been considered. Theprogram organising committee will have a full twelve months to plan, promote and organisethe conference. This is considered to be a sufficient amount of time based on recentexperience gained from hosting the NSW Coastal Conference in 2010. The FMA will beupdated quarterly during this period.Norm LenehanCoastal & Flood Management PlannerEurobodalla Shire Council"Clr Wheeldon (Wentworth) advised that the February conference date clashes with theannual Western Shires Group Conference, and he suggested that the FMA Conference beput back two weeks. The Chairman advised that this will be taken up with the FMAconference host, however from 2013 the conference will be held in May.Resolved - Eurobodalla Shire Council's Report be received.Chairman..........Executive Officer56Delegates ReportsFloodplain Management Association Meetings166 of 214 March 2012 Ordinary Business PaperPage 228 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aItem 14 General Business1 4.1 Pre-conference Workshop OutcomesDuncan Mcluckie advised that in regard to the Levee Workshop the following issues wereraised.. Funding for maintenance of levees. Need for operation and maintenance manuals -examples for the FMA to circulateNo agency with oversight of levees, similar to the Dam Safety CommitteeDiverse range of development controls behind leveesTemporary levees, DECCW has a guideline (will be provided with the minutes. Need for centralised database of flood mitigation infrastructureDECCW will provide templates orSue Ribbons advised that in regard to the lnsurance Workshop the following issues wereraised:. Flood insurance has come a long way in a short time, 4 years ago there would nothave been enough information to run a workshop. Karl Sullivan was unable to talk about the lnsurance Council of Australia's 10 PointPlan. Main issue is inconsistency of definition of "flood". Need for consistency in flood mapping. Need for better communication and collaboration.14.2 Gosford Floodplain Management VideoVic Tysoe (Gosford) advised that the Gosford FMA conference produced an amateureducational video based on the DECCW Floodplain Development Manual. lt is proposed toupdate the video and delegates were invited to participate. Those interested should contactVic Tysoe or Sue Stanford.14.3 Climate GhangeClr Kerry Lucas (Liverpool) asked whether there had been a recent conference based on aclimate change theme. The Chairman advised that the Wollongong conference 3 years agofocussed on climate change, and that various papers including one by Duncan Mcluckie atthis conference dealt with aspects of climate change.1 4.4 lnformation SharingVic Tysoe (Gosford) asked whether a research project could be undertaken to collateinformation on the various investigations being undertaken by members. Duncan Mcluckiewill provide a précis of DECCW research.Delegates suggested an email or website based discussion group.Chairman.......Executive Officer57Delegates ReportsFloodplain Management Association Meetings167 of 214 March 2012 Ordinary Business PaperPage 229 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aIteml 0 Proposed Gonstitutional GhangesOn 24 January the Executive Officer advised that the FMA Executive will be recommendingthat Full Members approve changes to the Constitution at the Annual General Meeting. Theproposed changes are to remove inconsistencies, clarify deflnitions, improve FMA servicesand update the image of the FMA. The proposed changes and commentary are of aconfidential nature and were provided separately to financial Full Members, as only FullMembers and Life Members are entitled to vote on changes to the Constitution.The current version of the Constitution states: "Proposed changes shall be put to the voteduring the Annual General Meeting and will require at least 60% of Member Authorities tobe represented at the meeting, and a vote in favour of the change(s) in order for thechange(s) to be effective."The Chairman advised that the requirement had not been met therefore the matter will notbe discussed.Clr Bolitho (The Hills) moved, lsaac Smith (Lismore) seconded, that the FMA seek adviceand if found appropriate conduct a postal ballot on the proposed constitutional changes.Resolved - The FMA seek advice and if found appropriate conduct a postal ballot on theproposed constitutional changes.Item 15 Next Scheduled Annual General MeetingThe Chairman thanked delegates for their attendance and their productive input to themeeting.The next scheduled AGM is to be held on 23 February 2012 at the annual FMA Conferenceat Bateman's Bay.The meeting closed at 3:55 pmChairman.Executive Offìcer58Delegates ReportsFloodplain Management Association Meetings168 of 214 March 2012 Ordinary Business PaperPage 230 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAPPENDIX 3Ftoodplain Management Association(formerly Floodplain Management Authorities)Caring for People and the Environmentwww.floods.org.au ABN 67 007 279 179Chairman: Ctr lan Dinham 0435 946 525Mr Tim Moore and Mr Ron DyerPlanning System ReviewGPO Box 39SYDNEY NSW 2OO11November,2011Dear Sirs,Submission to the NSW Planning ReviewThank you for the opportunity to contribute to the NSW Planning Review.The Floodplain ft/anagement Association (Ffi/A) represents the interests of 100 local governmentcouncils, Catchment Management Authorities, consultants, businesses and individuals involved inreducing future flood losses.The attached submission summarises concerns raised by FMA members about changes to planninglegislation whicfr are inconsistent with the New South Wales Government Flood Prone Land Policy.The FMA would be pleased to provide any further information or details which may be of assistanceto the review.Yours faithfully,r2 .¿ æ¿-'€-. ¿2*-A*Glenn EvansExecutive OfficerPlease address correspondence to:Glenn Evans Executive Officer Floodplain Management Association115 Marshall Street Garden Suburb NSW 2289 Email glennevans.fma@gmail.com Ph 0415 873353Chairman..........Executive Officer59Delegates ReportsFloodplain Management Association Meetings169 of 214 March 2012 Ordinary Business PaperPage 231 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFtoodplain Management AssociationCaring for People and the Environmentwww.floods.org.au ABN 67 007 779 179Chairman: Cl lan Dinham 0435 946 525SUBMISSION TO NSW PLANNING REVIEW1 NOVEMBER 201''FLOODPLAIN MANAGEMENT ASSOCIATIONWHO IS THE FLOODPLAIN MANAGEMENT ASSOCIATION?The Floodplain Management Association (FMA) (formerly the Floodplain Management Authorities ofNSW was formed after the disastrous floods in NSW in the mid-1950's to support and promote bestfl oodplain risk management practice.The FMA currently has a membership of 100 local government councils, Catchment ManagementAuthorities, consultants, businesses and individuals involved in floodplain management.Membership and participation includes both technical staff and elected representatives. The FMAhas links to equivalent organisations in the Unites States and Great Britain.The FMA is recognised by State and Federal Government agencies as representing the interests ofNSW floodplain communities and those authorities responsible for reducing future flood losses. TheFMA meets regularly with State and Federal ministers and their departrnents.Other positive partnerships witr government include:rgood working relationships with Department of Planning and lnfrastructure (DoPl),Office of Environment and Heritage (OEH), State Emergency Service (SES) and theBureau of Meteorology (BoM);. developrirent of the Flood Risk Management Course at the University of TechnologySydney (UTS) in association with the Office of Environment and Heritage and theState Emergency Servicer pârticipation in high level flood-related committees, for example the Flood WarningConsultative Committee, Building Code of Australia Advisory Group for the New FloodStandard and the State Flood Mitigation Assessment Committee.The FMA's annual Floodplain Management Conference is now in its 52nd consecutive year andprovides a great opportunity to promote and network best practice to the members, by themembers.FLOOD RISK IN NSWFlooding is the most costly natural disaster in Australia. More than 100,000 buildings are at risk offlooding in NSW, and the average damage from flooding in coastal New South Wales and inlandurban centres is around $200 million a year. The damage bill from the recent floods in Queenslandis now in excess of $2 5 billion. Floods in the Hunter Valley and Newcastle in June 2007 cost thelocal communities around $1.5 billion.Chairman........Executive Officer.Delegates ReportsFloodplain Management Association Meetings170 of 214 March 2012 Ordinary Business PaperPage 232 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFlooding is also the most manageable of natural disastersjust don't know when. The facts-are:we can work out where it will flood, we. there is a 1% chance EVERY yearthat a 1-in-100 yearflood OR LARGER will happenin that year;. floods larger than a 1-in-100 year flood CAN and HAVE occurred.FLOODPLAIN RISK MANAGEMENT STARTS WITH LAND USE PLANNING _ SUMMARY OFISSUES FOR NSW PLANNING REVIEWFloodplain risk management involves protecting life and property from floods. With costly floodmitigation works becoming further and further out of reach from most local councils and the everincreasing reliance on evacuation only increasing risk to life during floods, the only way to preventthe cost of flooding from escalating in the future, is through land use planning.It is therefore of concern that in the past five years and even in light of the publicity surrounding thedevastating floods in Brisbane in January this year, the Department of Planning and lnfrastructurehas flouted, and has continued to flout, it's own government's State Flood-Prone Land Policy, byreducing the controls required for development on flood-prone land. This has been canied outthrough apparent ad-hoc changes to legislation without adequate consultation with:. Office of Environment and Heritage-Prone Land Policy;who manage the NSW Government Flood. State Emergency Servicedeveloprnent on floodprone-land when floods occur; and. local councils who manage the land use and development on flooGprone land.-who manage the emergency response to inappropriateIt is therefore RECOMMENDED, as part of the NSW Planning Review, that consideration be givento the following key issues relating to floodplain risk management:. lssue 1 the repeal of Planning Circular PS07-003 New Guideline and Changes to-Section 1 17 Diredion and EP&A Regulation on Flood Prone Land;. lssue2 the need for recognition of flood risks above the 100 yearflood level for alldevelopnent types;. lssue 3 the need for consistency with the state government's own FloodplainDeveloprnent Manual;. lssue 4 the need for a clear definition of flood-prone land in the Standard lnstrumentLEP;. lssue 5 the need for a clear definition of 'significant adverse impacts' in the Standardlnstrument LEP;. lssue 6 acknowledgrnent that flood mapping is highly technical, costly and timeconsumingand so is beyond the resources and expertise of m any localcouncils;. lssue 7 the repeal of that part of State Environmental Planning Policy (Exempt andComplying Development Codes) 2008 that permits complying developmenton flooGprone land.More detail on each of these issues is provided below.Chairman..........Executive Officer....6tDelegates ReportsFloodplain Management Association Meetings171 of 214 March 2012 Ordinary Business PaperPage 233 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aISSUEI: REPEAL OF PLANNING CIRCULAR PS07-003-NEW GUIDELINE ANDCHANGES TO SECTION 117 DIRECTION AND EP&A REGULATION ON FLOOD-PRONE LANDPlanning Circular PS07-003 was issued in January 2007 and marked a turning point in flood riskmanagement in NSW. Many practitioners in flood risk management view this Planning Circular as aretrograde step in flood risk management that moved away from the principles of the FloodplainDeveloprnent Manual (2005) that had operated successfully for more the 20 years.The key requirement of Planning Circular PS07-003 is that localcouncils should adoptthe 1OO-yearflood as the Flood Planning Level (which is calculated as the 1OO-year flood level plus 0.5m forfreeboard) for residential development, unless there are'exceptional circumstances'. Local councilsshould not impose flood related development controls on residential development on land above theresidential Flood Planning Level, unless there are 'exceptional circumstances'. No further guidanceis provided in the Planning Circular about how Council's can apply for 'exceptional circumstances'.The Planning Circular is not consistent with the Floodplain Development Manual and does notrecognise flood risk above the 100 year flood level for residential development as the 'rule' ratherthan the'exception'It is therefore RECOMMENDED that, as part of the NSW Planning Review, Planning Circular PS07-003 be REPEALED for the reasons set out below in lssues 2to 7.ISSUE 2:NEED FOR RECOGNITION OF FLOOD RISK ABOVE 100 YEAR FLOOD LEVELFOR ALL DEVELOPMENT ryPESThe identification and management of flood risks greater than the level of the 100 year flood levelare of critical importance to disaster management.Planning Circular PS07-003 and Clause 7.3 of the Standard lnstrument LEP infer that flood riskmanagement and disaster planning should be restricted to areas defined by the Flood PlanningLevel.There is a duty of care by all agencies, including the DoPl, to recognise that flood risk managementand disaster planning must consider all possible floods. Failure to do this may leave localcommunities unnecessarily exposed, both in terms of risk to life and risk to property. The economicgains from permitting developnent in potentially dangerous locations could be far outweighed bythe damage caused to these communities when an extreme flood occurs.It is therefore RECOMMENDED, as part of the NSW Planning Review, that all DoPl documentationemphasises thatthere is a need to recognise all flood risks up to the probable maximum flood.ISSUE 3:NEED FOR CONSISTENCY WITH STATE GOVERNMENT'S OWN FLOODPLAINDEVELOPMENT MANUALThe 2005 Manual is clear in outlining a Floodplain Risk Management Approach to natural disastermanagement, with Flood Planning Levels determined for a particular location based on a thoroughknowledge of the flood risks. Whereas the Section 117(2) Direction 4.3 clearly states that the LEPshall be consistent with The 2005 Manual, Planning Circular PS07-003 and Clause 7.3 of theStandard lnstrument seem to have abandoned the manual's risk management approach andreverted floodplain risk management back some 20 or 30 years to a standardised flood planninglevel of the 100 year ARI flood with no requirement to consider all the possible consequences offlooding.Chairman..........Executive Officer62Delegates ReportsFloodplain Management Association Meetings172 of 214 March 2012 Ordinary Business PaperPage 234 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFor example, in the Hawkesbury-Nepean floodplain, the flood of record (i.e. a real flood) is morethan 2m (i.e. one storey) higher than the 100 year flood. Clearly there is a risk to life in floodsgreater than the 100 year flood.Again, it is therefore RECOMMENDED, as part of the NSW Planning Review, that all DoPldocumentation emphasises that there is a need to recognise all flood risks up to the probablemaximum flood.ISSUE 4:NEED FOR CLEAR DEFINITION OF FLOOD PRONE LAND lN THE STANDARDINSTRUMENT LEPClause 7.3 (Flood Planning) of the Standard lnstrument and the Section 117(2) Direction 4.3 FloodProne Land, both make reference to the fact that a LEP should be consistent with the NSWGovernment Floodplain Development Manual (2005) (The 2005 Manual). However, Clause 7.3 failsto emphasise the definition of flood prone lard.Flood prone land is clearly defined in The 2005 Manual as all land affected by flooding in all floodsup to and including a probable maximum flood (PMF).It is therefore RECOMMENDED, as part of the NSW Planning Review, that a clear deflnition of floodprone land, whidr is consistent with The 2005 Manual, be provided in all Department of Planningand lnfrastructure (DoPl) documentation.ISSUE 5:NEED FOR CLEAR DEFINITION OF 'SIGNIFICANT ADVERSE IMPACTS' lN THESTANDARD ¡NSTRUMENT LEPBoth Clause 7.3 of the Standard lnstrument and the Section 117(2) Direction 4.3 refer to "signiflcantadverse impacts" or similar phrases in several locations. Experience has shown that to define"significant adverse impacts", let alone evaluate whether a development proposal will have"signiflcant adverse impacts", is extremely difficult and often leads to varying subjedivity of theimpacts. Only with a true risk management approach, as outlined in The 2005 Manual, will impactsbe adequately and more objectively assessed.It is therefore RECOMMENDED, as part of the NSW Planning Review, that the Department ofPlanning and lnfrastructure documentation specifically refer to the 2005 Floodplain DevelopmentManual for an appropriate methodology for the assessment of flood impacts.ISSUE 6:ACKNOWLEDGEMENT THAT FLOOD MAPPING IS TECHNICAL, COSTLY ANDTIME.CONSUMINGIt is important for all councils to identify all flood prone land (i.e. up to a level of the probablemaximum flood), not just flood planning areas. lt is also important that this mapping is readily andfreely available to the local community.However, DoPl must acknowledge that flood mapping is a costly and time-consuming exercise, withmany councils simply not having the technical expertise and/or the resources to undertake thecomplex flood studies required to produce flood mapping. Many councils have a program of floodstudies to be completed that span several years or more. Some councils have floodplains that maynever be mapped.It is noted though that there is a requirement in the NSW Coastal Planning Guideline:Adapting toSea Level Rise (and the two associated risk management guidelines) for councils to have a 'rule ofthumb' to identify 'investigation areas' for locations that may be affected by sea level rise wheredetailed flood studies are not available.Chairman..........Executive Officer...63Delegates ReportsFloodplain Management Association Meetings173 of 214 March 2012 Ordinary Business PaperPage 235 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aA similar simple 'rule of thumb' for determining flood-prone land is simply not possible.It is therefore RECOMMENDED, as part of the NSW Planning Review, that Clause 7.3 of theStandard lnstrument requires councils to map all flood-prone areas as well as flood planning areasas deflned.Also, it is therefore RECOMMENDED, as part of the NSW Planning Review, that DoPl formallyrecognise that flood mapping is a technical, costly and time-consuming exercise, by providingadditional technical assistance (and possibly grant funding assistance) to councils. Additiondtechnical assistance could be provided by working with the current flood and coastal groups at theOffice of Environment and Heritage.ISSUE 7:REPEAL THAT PART OF STATE ENVIRONMENTAL PLANNING POLICY(EXEMPT AND COMPLYTNG DEVELOPMENT CODES) 2008 THAT PERMTTSCOMPLYING DEVELOPMENT ON FLOOD.PRONE LANDDespite all the publicity of the devastating floods in Brisbane in January this year, the revision ofSEPP (Exempt and Complying Development Codes) 2008 (the Codes SEPP) to permit complyingresidential developnent on flood-prone land, and the speed of the revision and its implementation,came as a surprise to many floodplain risk management practitioners as this was yet anotherreduction on the controls required for development on the floodplain.The rhetoric suggested that local government requested the change to the Codes SEPP, but it isunderstoodthat less than a handful of local councils requested the change (out of more than 150local councils in NSW and over 80 represented by the Floodplain Management Association (FMA)).ln addition, recommendations by the industy went substantially unheard.Key concerns reported by local councils to the FMA included:. With flood-related development controls in the Codes SEPP overriding those incouncil's own Development Control Plan, the revisions to the Codes SEPP erodeCouncil's efforts to prepare a merits-based approach to their flood-relateddevelopnent controls, that take into account local flood conditions and the social andenvironmental implication of the local community;. The revision to the Codes SEPP relies on councils having not only mapped their floodproneareas but also having categorised their floodplains into areas of flood risk, floodhazard, floodway, flood storage and overland flow. Very few councils have thisinformation (see lssue 6 above);. While some councils may have mapped some floodplains, even fewer have associatednotations included on Section 149 Planning Certificates. lt is still important howeverthat it be made compulsory for private certifiers to obtain Section 149 Certificates aspart of any complying development application.It is therefore RECOMMENDED, as part of the NSW Planning Review, that the part of the CodesSEPP that permits complying development on flood-prone land be REPEALED. Without therelevant information, the FMA and many councils are concerned that applicants will assume that theproperty is not flood-affected and this will further increase inappropriate developnent of flood-proneland in NSW.SUE RIBBONSDIRECTOR, LAND USE PLANNING, FLOODPLAIN MANAGEMENT ASSOCIATIONChairman.....Executive Officer64Delegates ReportsFloodplain Management Association Meetings174 of 214 March 2012 Ordinary Business PaperPage 236 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAPPENDIX 4Floodplain Management AssociationScholarship PolicyObjectives of ScholarshipThe objective of this scholarship is to provide an incentive for floodplain management practitionersemployed by FMA member organisations to broaden theirfloodplain knowledge and in turn makethat knowledge available to all members of the FMA.General1. The Floodplain Management Association shall support continuing education for its memberorganisations and nominated staff of such organisations by the provision of financial support toundertake an education program subject to specific criteria.2.The proposed education program must be relevant to the objectives of the FMA. The Scholarshipis not intended to support Applicants undertaking education programs usually associated with primedegrees usually associated with employment.3. Such financial support may be for part expenses of short courses, research into relevant mattersor educational visits interstate or overseas.4. Such flnancial support shall be no more than 50% of expenses or $2000.00 whichercr is thelesser figure.5. The Applicant may only receive one (1) Scholarship, that is an Applicant may not receive morethan one grant.6. Applications should be forwarded to the Executive Officer of the FMA. Closing date forApplications will be the closing date for nominations for Business ltems for the Annual GeneralMeeting. The Executive Officer shall callfor applications at the November Quarterly meeting andwith the "Notice of Annual General Meeting"' stating the closing date for the receipt of Applications.7. Applications for the awarding of the Scholarship shall be determined by members at the AnnualGeneralMeeting.8. Unless specifically authorised by the Membership at the time of awarding the Scholarship, theScholarship Grant must be expended in the year following the awarding of the Grant.9. On completion of the education program the successful Applicant is required to provide a writtenreport and presentation to the next FMA Annual Conference. The written report is to be of astandard acceptable to the Executive of the FMA and is to be tabled at the next available QuarterlyMeeting alter completion of the education program. The successful applicant must also undertake apresentation regardirg the Scholarship at the Annual Conference following completion of theprogram.2 of210. Acceptance and presentation of the Report and Presentation to the Annual Conference willsignify completion of the Applicant's obligations under this Scholarship.GriteriaTo be eligible for consideration the applicant must be employed by an organisation which has beena flnancial member of the FMA for at least two (2) consecutive years at the time of application and isa cunent financial member.Applicants must be working wihin the member organisation in an area associated with floodplainmanagement.Chairman.......Executive Officer65Delegates ReportsFloodplain Management Association Meetings175 of 214 March 2012 Ordinary Business PaperPage 237 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aContinuation of Employment in Floodplain Managementln the event of the successful applicant leaving employment associated with FloodplainManagement within two (2) years following the awarding of their scholarship program then apercentage of the scholarship may be required to be repaid to the FMA, such percentage beingproportional to the time involved.ApplicationsApplications, following the form provided on the website, must be lodged wih the Executive Officerby Close of Business on l4th January (or other such date as may be duly advertised) each year.The FMA Executive will review all applications and make a recommendation to the Annual GeneralMeeting regarding the awarding of the Scholarship. Awarding of the scholarship will be by resolutionat the AGM.Chairman.Executive Officer......66Delegates ReportsFloodplain Management Association Meetings176 of 214 March 2012 Ordinary Business PaperPage 238 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAPPENDIX 5MISSION STATEMENT:FLOODPLAIN MANAGEMENTAUTHORITIES2OO8 CONSTITUTIONTo facilitate the reduction of the impact of flooding and flood liability on life and property, on theeconomic and socialwell being of communities with due regard to the environment and sustainabledevelopment, by the development, implementation, ongoing operations, and maintenance ofeffective Floodplain Management processes and procedures.OBJECTIVES:General1. Support the primary objectives of floodplain management policy, namely to reduce theimpact of flooding and flood liability on individualowners and occupiers and to reduce privateand public losses from flooding.2. Press for optimum financial assistance by State and Federal Governments to FloodplainManagement in order to implement the Government's Floodplain Management Policy.3. Support the implementation of Total Catchment Management principles in the context offlood mitigation works, management of floodplains, river management and streamstabilisation.4. Provide a forum for exchange of information and ideas related to Floodplain Manaçment.5. Foster good relationships and effective liaison between the Authorities, State andCommonwealth Government Departments and other relevant organ isation.6. Assist both the State and Federal Governments to prioritise funding proposals for FloodplainManagement projects.Education7. Promote the need to maintain public awareness of the significance of floods and appropriatecommunity responses to flooding.8. Work to inform and educate State and Federal Members and policy makers of theimportance and scope of Floodplain Management9. Develop edrcation and information resources for members.Representalion10. Make representations and recommendations to State and Federal Governments onFloodplain Management related matters11. Where appropriate, to act in support of any Membeis representations to Government onlocal fl ood related matters.12. Where appropriate, make representations to Local Government bodies in support ofFloodplain Management principles.Chairman..........Executive Officer...67Delegates ReportsFloodplain Management Association Meetings177 of 214 March 2012 Ordinary Business PaperPage 239 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aMemberchip13. Encourage Local Councils and other relevant Authorities involved in Floodplain Managementto become Members and Associates.14. Encourage Consultarrts, Government Departments, Educational lnstitutions andBusinesses engaged in Floodplain Management to become corporate members.MEMBERSHIP:(i)Full Members:ii)All local government councils, catchment management trusts and catchment managementauthorities and other approved organisations involved in floodplain management in NewSouth Wales are eligible.Associate Members:All interstate local government councils, catchment management trusts and catchmentmanagement authorities and other approved organisations involved in floodplainmanagement are eligible.(¡ii) lndividualMembers:All individuals involved in floodplain management or with an interest in floodplainmanagement are eligible.(iv) Life Members:Life Membership may be conferred on an indivi

Attacment 8.2.aFull MembersFull members may be represented at meetings by three representatives. Voting eligibility of fullmembers will be restricted to two votes per member .Associate MembersAssociate members may be represented at meetings by three representatives. Associate membersare entitled to participate in the affairs of the Floodplain Management Authorities. Voting eligibility ofassociate members will be restricted to one vote per member; associate members however areprecluded from voting on constitutional change.lndividual Memberslndividual Members may attend meetings and are entitled to participate in the affairs of theFloodplain Management Authorities; they are however precluded from voting.Life MembersLife Members may attend meetings and are entitled to participate in the affairs of the FloodplainManagement Authorities. Life members are entitled to vote.Corporate MembersCorporate members may be represented at meetings by three representatives. Corporate membersare entitled to participate in the affairs of the Floodplain Management Authorities. Voting eligibility ofcorporate members will be restricted to one vote per member; corporate members however areprecluded from voting on constitutional change.EXECUTIVE COMMITTEE:The Executive Committee shall comprise the Chairperson, Deputy Chairperson, Executive Member- Technical, Executive Member - Planning, the lmmediate Past Chairperson and Executive Officer.The Chairperson will assign specific areas of responsibility to each Executive MemberThe Committee shall carry out all routine administrative functions of behalf of the Floodpla'nManagement Authorities. Each member of the executive is entitled to one vote in relation to mattersconsidered by the Executive Committee. A Majority of votes will determine issues considered by theExecutive.Chairperson:(¡) Shall be a Councillor, Trustee or a Board Member of a Full Member Authority.(ii) ls to hold office for a period of two years.(iii) ls eligible for re-election.(iv) Elections for Chairperson shall be held at the Annual General Meeting.(v) Shall cease to be Chairperson if not re-elected a councillor or appointed a trustee orboard member of a member authority.Chairman.........Executive Officer...69Delegates ReportsFloodplain Management Association Meetings179 of 214 March 2012 Ordinary Business PaperPage 241 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a(vi) ln the event of the death, incapacity or ineligibility of the Chairperson, the DeputyChairperson shall act as Chairperson until the position is filled at an election held at the nextmeeting.Deputv Chairperson:(i)Shall be a Councillor, a Trustee or board member of a Full Member Authority.(ii) ls to hold office for a period of two years.(ii¡) ls eligible for re-election.(iv) Elections for Deputy Chairperson shall be held at the Annual GeneralMeeting.(v) Shall cease to be Deputy Chairperson if not re-elected a councillor or appointed a trusteeor board member of a member authority.ln the event of the death, incapacity orineligibility of the Deputy Chairperson, the Executive Officer shall act as DeputyChairperson until the position is filled at an election held at the next meeting.Executive Member - Technical(i)Shall be a staff member of a Full Member or a delegate of an Associate or CorporateMember or an lndividual Member.(ii) ls to hold office for a period of two years.(ii¡) ls eligible for re-election(iv) The election for Executive Member -(v) ln the event of death, incapacity or inelþibility of the Executive Member -Technical shall be held at the Annual General Meeting.Technical, theposition will remain vacant until the position is filled either at an election held at the nextmeeting of members or by immediate appoittment by the Chairman.Executive Member - Planninq(¡) Shall be a staff member of a Full Member or a delegate of an Associate or CorporateMember or an lndividual Member.(ii) ls to hold office for a period of two years.(iii) ls eligible for re-election(iv)The election for Executive Member -Planning shall be held at the Annual General Meeting(v) ln the event of death, incapacity or ineligibility of the Executive Member - Planning, theposition will remain vacant until the position is filled at an election held at the next meeting ofmembers or by immediate appointment by the Chairman.lmmed iate Past Chairoerson :Shall be the chairperson before the election of the current chairperson.Executive Officer:Shall be the General Manager or Chief Executive Officer or other officer of the Executive Servicesprovider, nominated and agreed by the Authorities.Chairman..........Executive OfficerDelegates ReportsFloodplain Management Association Meetings180 of 214 March 2012 Ordinary Business PaperPage 242 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aCasual Vacancv:ln the event of a casual vacancy on the Executive Committee, the Chairman may immediatelynominate an eligible member to flll the casual vacancy as an acting executive committee memberuntil the next AGM and report such action to the next quarterly meeting, or , may direct theExecutive Officer to undertake an election at the next quarterly meeting of the Authorities. Eledionprocedures shall be as for the normal election of offlce bearers. The newly elected member of theexecutive committee shall hold office for the remainder of the term of office of the former offlceholderand shall be eligible for re-eleclion. There may only be one acting member of the ExecutiveCommittee at any one time.Executive Sub Committees:lnorder to assist the Executive to develop and expand the range of services provided by the FMA,the Executive shall create appopriate subcommittees.Subcommiüees shall. Consist of at least three persons, one of whom must be an executive member with overallresponsibilty for the subcommittee to the Executive.. Be permenant (that is a standing committee) or casual (that is formed for the life of aspecified objective). Have a specified brief, objectives, reporting timetable and sunset dateExecutive Services P roviderThe Authorities shall prepare a Specification which details the duties required to be carried out bythe Executive Services provider. The Executive Services provider shall appoint an Executive Offlcerwho will be the primary contact between the Authorities and the service provider and will beresponsible for the completion of Specification dúies.The Executive Service Provider is to nominate a person acceptable to the Executive Committee toact as Treasurer of the Floodplain Management Authorities for the period of appointrnent asExecutive Service Provider.Executive Services shall be tendered and awarded by the Authorities. An Executive Servicesprovider shall be appoinÞd to provide administrative support and infrastructure, for a period of twoyears, renewable.This appoinhent may be terminated after three months notice by either party. Tenders shall becalled from amongst Member Authorities for the provision of executive services, but if no suitabletenders are received, the process shall go to open tender.Fees and Expenses:The Chairperson shall be paid an annual fee determined by the Authorities and subject to annualreview at the adoption of the budget.The provider of the executive services shall be paid a fee for the term of their appointment, paidannually and subjed to CPI review or in accordance with an agreed contractural arrangement.Executive members shall be reimbursed reasonable expenses when attending the specific businessof the Floodplain Manaçment Authorities.Where the prior approval of the Chairman is obtained, reasonable expenses will be reimbursed tosubcommittee members.Chairman........Executive Officer71Delegates ReportsFloodplain Management Association Meetings181 of 214 March 2012 Ordinary Business PaperPage 243 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aMEETING PROCEDURES:1. The Authorities shall meet at least four times each year.2. The Executive Officer shall give Members at least 14 days notice of all meetings.3. The Chairperson may call extraordinary meetings at short notice in exceptionalcircumstances.4. The business to be transacted at all meetings shall be restricted to that included in thecirculated agenda with the Chairman to exercise his discretion to allow introduction ofbusiness for whidr due notice has not been given.5. ln the absence of the Chairperson, Deputy Chairperson, Executive Member - Planning andExecutive Member - Technical, the Members present shall elect a Chairperson for thatmeeting.6. Each Full Member organisation in attendance shall be entitled to two votes on any issue,each Associate Member one vote and each lndividual Merber one vote.7. Should there be an equality of votes at any meeting the Chairperson is entitled to exercise asecond or casting vote.8. Member's delegates are not entitled to vote on any issue, if any money due and payable tothe Autrorities is outstanding.9. There will be no provision for proxy votes. Each delegate has only one vote and must bepresent to exerclse such vote.MEMBERSHIP FEES/SUBSCRIPTIONS:All Members with the exception of Life Members shall pay an annualsubscription to be determinedas part of the budgeting process.ELECTION OF OFFICE BEARERS:l. Elections, if required, for the position of Chairperson Deputy Chairperson, ãecutive Member- Planning or Executive Member - Technical shall be conducted at the Annual GeneralConference. The election of the Chairperson, Deputy Chairperson, Executive Member -Planning or Executive Member - Technical should take place at the same Annual GeneralMeeting and will serve their terms concurrently. Nominees for these positions shall be givenan opportunity to address the Annual General Meeting prior to voting.2. The Executive Officer shall be the Returning Officer for all such elections. The DeputyReturning Offìcer shall be the General Manager or Chief Executive Officer of the Conferencehost Anthority.3. Nominations for election of office bearers shall be called by the Returning Officer byNotice to all Member Authorities at least six weeks before the Annual Conference.4. Nominations for vacant positions shall be in writing, endorsed by two voting delegates,include the consent of the person nominated and be lodged with the Returning Officer notless than 30 days prior to the commencement of the Annual Conference. Nominations shallbear the candidates name and organisation; the nominatois name, organisation andChairman..........Executive Officer72Delegates ReportsFloodplain Management Association Meetings182 of 214 March 2012 Ordinary Business PaperPage 244 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.asignature; the seconder's name, organisation and signature; and the nominee shall indicateacceptance by signing the nomination form.Nomination details should be sent to Member Authorities pria to the Conference.5.6.7.I9.10.lf there is only one nomination then that person is elected.lf there is more than one nomination the election shall be by preferential ballot with allsquares to be numbered 1-2-3-etc in the order of the voter's choice to be a valid vote. Wheremore than one nomination is received for any position the Returning Officer shall.(i)prepare a list of eligible voters for the ballot,(ii) prepare ballot papers.Positions on the ballot paper shall be drawn from an appropriate receptacle in the presenceof the candidates or their representatives.The Returning Officer shall provide a ballot box that can be locked or sealed in the presenceof appointed scrutineers. Voting shall take place at the AnnualGeneral Meeting.A ballot paper that has been initialled by the Returning Officer shall be issued to eligibledelegates, who shall identify themselves and have their names crossed out from the voterslist.At the conclusion of the ballot the Returning Officer and Deputy Retuming Offlcer shall:(i) check and record the number of ballot papers issued including spoilt ballot papers,(i¡) check that all votes cast have the Returning Offlcers initial on the back of the ballotpaper,(iii) allocate first preferenc€s, at the same time checking that every square is numberedin a sequential order,(iv) if no candidate has an absolute majority, the Returning Officer shall eliminate thecandidate with the lowest primary vote, and distribute that persons secondpreferences,(v) this process shall continue until a candidate has acquired a majority vote'(vi) the Returning Officer shall then declare the results of the election,(vii) The Returning Officer shall retain allvoting papers for a period not exceeding 14 daysbefore destroying.These election proceedings shall be overriding, however, in other respects the electionproceedings shall be conducted in accordance with the NSW Local Government (Elections)Regulation.The Executive Officer shall maintain discrete accounting records and shall operate an appropriatelynamed account in he name of the Floodplain Management AuthoritiesAll income received shall be deposited in the relevant account and all disbursements authorised bya delegated person. Signatories to the account shall be any two of the following: Chairperson,Deputy Chairperson, Executive Member - Technical, Executive Member Planning or ExecutiveOfficer.Each meeting of the Aúhorities shall be provided with:(i)a listing of all disbursements since the previous meeting.Chairman........Executive Officer73Delegates ReportsFloodplain Management Association Meetings183 of 214 March 2012 Ordinary Business PaperPage 245 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a(i¡) a summary of income and expenditure for the current financial year to date and acomparison of that income and expenditure against the estimated annual estimate.An estimate of income and expenditure shall be prepared and approved by the Authorities at theAnnual Conference, prior to the commencement of each financial year, whicft shall begin on IJanuary each year.At the conclusion of each financial year, an annual report of income and expenditure shall beprepared and presented to the Annual General Meeting.Auditors shall be appointed by the executive services provider and shall be requested to reportannually on all matters concerning the financial affairs of the Authorities. Every endeavour shall bemade to have the audited report available for the Annual General Meeting, but in any case, theaudited report is to be provided at the quarterly meeting following Annual C¡eneral Meeting.STRATEGIC PLAN and ANNUAL BUSINESS PLAN:The Authorities shall consider and adopt a four year strategic (corporate) plan at its Annual GeneralMeeting. Such plan shall be developed by the Executive Committee and submitted to the AnnualGeneral Meeting for adoption. The plan shall be circulated at least 30 days before the AnnualGeneral Meeting to members.The Authorities shall review the Stategic Plan at intervals no longer than two years. Such reviewshall be submitted to the Annual General Meeting. The first corporate plan was adçted in 2000..The Strategic Plan and Annual Business Plan shall be prepared by the Executive Committee andsubmitted to the Annual General Meeting for adoption by the members. The Annual Business Planshall be circulated at least 14 days prior to the Annual General Meeting.Each Plan will incorporate agreed or proposed goals, objectives, strategies and actions, and detailsof proposed income and expenditure. The Annual Plan will contain a brief summary of goals &objectives together with achievements and performance.ANNUAL CONFERENCE:1.23.4The Authorities shall convene an Annual Conference which may be hosted by any fullMember Authority.Each full Member Authority shall be entitled to two votes when voting on any matter providedthat there will be no provision for proxy votes. That is, only delegates in attendance may castvotes.Applications to host the Annual Conference shall be in writing and be lodged with theSecretary not less than 30 days prior to the commencement of the Annual Conference.Applications to host the Conference will be decided two years in advance of the proposedConference date and where practicable, the Conference venue shall be rotated around theState.Determination of the Conference host shall be by Conference delegates and if more thanone application is received, by preferential ballot under the jurisdiction of the ReturningOfficer, during the Conference.5.The conference host may charge a registration fee for each person attending theConference. This Conference fee is to be approved by the Executive Committee of theFloodplain Management Authorities.Chairman.......Executive Officer74Delegates ReportsFloodplain Management Association Meetings184 of 214 March 2012 Ordinary Business PaperPage 246 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a6 The Conference host in consultation with the Authorities shall be responsible for:-. Providing a suitable venue and facilities.. Organising allspeakers.. Organising inspections as appropriate.. Seeking appropriate sponsorship.. Co-ordination of accommodation and sustenance for participants.. Submission of a comprehensive Debrief Report and Statement of lncome andExpenditr,rre to the following Quarterly Meeting to assist in the organisation offuture Annual Conferences.. Complying with the Authorities Standard Operating Procedures for the AnnualConference.7The conference host will endeavour to conduct the conference on a cost recovery basis.Any profit generated by the conference (after applying accepted accounting standardsand allowance for all related expense induding due allowance for labour cost of the hostauthority's stafQ is to be shared on an equal basis between hat Authority and theFloodplain Management Authorities. Such Profìt & Loss Statement is to be provided tothe Floodplain Manaçment Authorities within three months of the conferencecompletion.Any loss incurred by the host Authority will be underwritten by the Floodplain ManagementAuthorities to a maximum sum of eight thousand dollars ($8000-00).This Constitution may only be reviewed or altered at the Annual Conference of the Authorities. AllMember Authorities must be advised in writing of proposed changes at least 30 days prior to theConference. Proposed changes shall be put to the vote during the Annual General Meeting and willrequire at least 60% of Member Authorities to be represented at the meeting, and a vote in favour ofthe change(s) in order for the change(s) to be effective.END ofDOCUMENTChairman..........Executive Officer...75Delegates ReportsFloodplain Management Association Meetings185 of 214 March 2012 Ordinary Business PaperPage 247 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aBLANK PAGEChairman.......Executive Officer76Delegates ReportsFloodplain Management Association Meetings186 of 214 March 2012 Ordinary Business PaperPage 248 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Management AssociationFinancial StatementsFor the year ended 3L December 2011Accountcorp Group ServicesThe Terracesl/l lolanthe Street, Campbelltown 2560Phone: 02 4625 9411 Fax:. 02 4628 7449Email: access@accountcorpcom.auDelegates ReportsFloodplain Management Association Meetings187 of 214 March 2012 Ordinary Business PaperPage 249 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Management AssociationContentslncome and Expenditure StatementDetailed Balance SheetNotes to the Financial StatementsStatement by Members of the Committeelndependent Audit Report to the MembersDelegates ReportsFloodplain Management Association Meetings188 of 214 March 2012 Ordinary Business PaperPage 250 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Management Associationlncome and Expenditure StatementFor the year ended 31 December 201120LLs20L0$lncomeMem bership subscriptionslnterest receivedSundry incomeWorkshop incomeTotal incomeL03,060.006,054.151,668.185,315.51.r.r.6,097.8492,700.003,043.1827.2795,770.45ExpensesAccountancyAudit feesBank Fees And ChargesChairman wageAnnual conference expenses & travelEducation expensesEntertainmentExecutive servicesLegal feesMember Vísitation, TravelPromotional ProductsPrinting & stationerySubscriptionsWebsite Maintenance & DevelopmentTotal expensesProfit from ordinary activities before income taxlncome tax revenue relating to ordinaryactivitiesNet profit attributable to the associationTotal changes in equity ofthe association1,760.00800.007t.L96,847.237,L42.47972.O2s0,783.31836.005,776.r957L.82560.0090.002,655.4678,86s.6937,232.L537,232.L537,232.15L,960.002,050.005.547,500.0034,50/..2830,000.0043,3L4.422,870.00156.6590.003,084.85r25,535.74129,765.291129,765.291(29,765.291Opening retained profitsNet profit attributable to the associationClosing retained profitsL51,705.8437,232.t5188,937.99L8L,47L.L3.29,765.29l'151,705.84The accompanying notes form part of these financial statements.Delegates ReportsFloodplain Management Association Meetings189 of 214 March 2012 Ordinary Business PaperPage 251 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Ma nagement AssociationDeta¡led Balance Sheet As At 31 December 201120lls2010$Current AssetsCash AssetsCash At BankTerm depositTerm Deposit #109Term Deposit #11737,153.5860,892.1492,L6r.r2190,206.8437,473.6038,475.2440,000.0040,000.00155,948.84Total Current Assetst9o,2ú,u 155,9¿18.84Non-Current AssetsProperty, Plant and EquipmentWebsite designLess: Accumulated depreciation8,086.37(8,086.37)8,086.37(8,086.37)Total Non-Current AssetsTotal Assets190,206.84 155,9¿18.84Current LiabilitiesCurrent Tax LiabilitiesGST clearingAmounts withheld from salary and wages104.19t,\il.663,243.001,000.001,258.85 4,243.OOTotal Current liabilities1,268.85 4,243.OOTotal liabilities1,268.85 4,243.@Net AssetsL88,937.99 151,705.84The accompanying notes form part of these financial statements.Delegates ReportsFloodplain Management Association Meetings190 of 214 March 2012 Ordinary Business PaperPage 252 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Ma nagement AssociationDeta¡led Balance Sheet As At 31 December 2011Note 20ll 2010s$Members'FundsAccumulated surplus (deficit)Total Members' Funds188,937.99 151,705.84188,937.99 151,705.84The accompanying notes form part of these financial statements.Delegates ReportsFloodplain Management Association Meetings191 of 214 March 2012 Ordinary Business PaperPage 253 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFloodplain Management AssociationNotes to the Financial StatementsFor the year ended 31 December 2011Note 1: Summary of Significant Accounting PoliciesThis financial report is a special purpose financial report prepared in order to satisfy the financialreporting requirements of the Constitution of Floodplain Management Association. Thecommittee has determined that the association is not a reporting entity.The financial report has been prepared in accordance with the cash basis of accounting wherebyrevenue is recorded when it is received, and expenses are recorded when they are paid, withthe exception that certain assets and liabilities are recorded on the balance sheet as determinedappropriate by the council of management.The following significant accounting policies, which are consistent with the previous periodunless otherwise stated, have been adopted in the preparation of this financial report.(a) Cash and Cash EquivalentsCash and cash equivalents include cash on hand, deposits held at call with banks, and othershort-term highly liquid investments with original maturities of six months or less.(b) Revenue and Other lncomeRevenue is measured at the fair value of the consideration received.lnterest revenue is recognised when it is received.All revenue is stated net of the amount of goods and services tax (GST).(c) Goods and Services Tax (GST)Revenues, expenses and assets are recognised net of the amount of GST, except where theamount of GST incurred is not recoverable from the Tax Office. ln these circumstances, theGST is recognised as part of the cost of acquisition of the asset or as part of an item of theexpense.(d) Property, Plant and EquipmentThe Committee has determined that from 1 January 2011, costs incurred in the developmentof the new website will be expensed as incurred.Delegates ReportsFloodplain Management Association Meetings192 of 214 March 2012 Ordinary Business PaperPage 254 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFfoodplain Management AesocþtionStatement by Members of tlre CommitteeFor the year ended 3l December 20llThe Committee has determined that the association ¡s not a repofting ent¡ry and that this specialpurpose financial report should be prepared ln accordance with the accounting policies outlinedin Note 1to the financial statements.ln the opinlon of the Committee the lncome and Expenditure Statement, Statement of FinancialPositlon, and Notes to the Financial Statements:t. Presents fairly the financial positlon of Floodptain Management Assocíatíon âs at 31December 2011 and its performance for the year ended on that date.Z. At the date of th¡s statement, thefe are reasonable grounds to believe that the associatíonwill be abte to pay its debts a¡ and when they fall due.Thls statement ¡s made in accordance with a resolution of the Committee and ls sígned for andon behatf of the Committee bY:ChalrmanThc aæompqnylng notet ûorm part of tfiase tlnilcl¡l 6l¡têrnent3'Delegates ReportsFloodplain Management Association Meetings193 of 214 March 2012 Ordinary Business PaperPage 255 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aAccountcorpÅr:c,runlan:s & Advisrj¡sINDEPENDENT AI.,'DITOR'S REPORTTO THE MEMBERS OFFLOODPLAIN MANAGEMENT ASSOCIATIONRepoil on the Financial ReportWe have audiled the accompanying financial report, being a speciai purpose financial report, of FloodplainManagement Associatìon, which comprises the detailed balance sheet as at 31 December 2011, and the income andexpenditure statement for the year then ended, a surnmary of significant accounting policies and a statement bymembers of lhe committee.The Responsibility of the Gornmittee for the Financial RsportThe Committee of the association are responsible ior the preparation and fair presentation of the financial report andhave determined that lhe accounting policies described in Note 1 to the financial statements which form part of thefinancial report ar€ appropriate to meet the fìnancial reporting requirements of the association's constitution and areappropriate to meet the needs of the mernbers. The Commïttee's responsibility also includes establishing andmaintaining internal control relevant to the preparation and fair presentation of the financial report that is free frommaterial misstatement, whether due to fraud or error; selecting and applying appropriate accounting policies; andmaking accounting estimales that are reasonable in the circumstances.Auditor's ResponsibilityOur responsibility is to express an opinion on the financial report based on our audit. No opinion is expressed as towhether the accounting polìcies used, as described in Note'1 , are appropriate to meet the needs of the members. Weconducled our audit in accordance with Australian Auditing Standards, These ,\uditing Standards require that wecomply with relevant ethical requirernents relating to audil engagements and plan and perform the audit to obtainreasonable assurance whether the financial report is free from material misstatement.An audit involves performing procedures to obtain audit evidence about the amounts and disclosures in the financialreport. The procedures selected depend on the auditor's judgment, including the assessment of the risks of materialmisstatement of the financial report, whether due to fraud or error. ln making those risk assessments, the auditorconsiders ínternal control relevant to the association's preparation and fair presentation of the financial report in orderto design audit procedures that are appropriate in the circumstances, but not for the purpose of expressing an opinionon the effectiveness of the associalion's internal control. An audit also includes evaluating the appropriateness ofaccounting policies used and the reasonableness of accounting estimates made by the Committee, as well asevaluating the overall presentation of the financial report.The financial report has been prepared for distribution to members of Floodplain Management Association for thepurpose of fulfilling the Committee's financial reporling reguirements under the association's constitution. We disclaimany assumplion of responsibility for any reliance on this report or on the financial report to which it relates to anyperson olher than lhe members, or for any purpose other than that for which it was prepared.We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our auditopinion.Agi{ i;;ì i.:

Attacment 8.2.aAccountcorpAcc¡¡Lrrrlarits å AdvisÉ)rslndependenceln conducting our audit, we have complied with the ìndependence requirements of Australian professional accountingbodies.Auditor's Opinionln our opinion, the financial report presents fairly, in all material respects, the financial position of FloodplaìnManagement Assocìation as at 31 December 2011 and of its financial performance for the year then ended inaccordance with the accountìng policies described in Nots 1 to the financial statements.Basis of AccountingWithout modifying our opinion, we draw attention to Note 1 to the finanoial report, which describes the basis ofaccounting. The financial report hâs been prepared to assist Floodplain Management Association to meet lhe lìnancialreporting requirements of its constitution. As a result, the financial repori may not be suitable for another purpos€.ACCOUNTGORP GROUP SERVICESDated in Gampbelltown on 2 February 2012ÀnN $214.ìÊ.:î ¿73nonúld N fçâ¡àfiêJ FCPÂ. ÇFFCf3¡s odêrv¿hn i?,]Ãxåccountcotp Group SeruìcesOFFICË 'll:e ]ìrracæ J,'l k¡aritlv¡ SÌC,tmÉbÊllo"rlFOSTAL i-ì0. tlor 3$5 C8¡;rlihÍ!l?D$"¡ ziìfa)T 1':i1 2 ¿6f1t f¡411F r0l24eæ7445e

Attacment 8.2.aFMA quarterly meet¡ngGordon McKay24 November 2OLLDelegates ReportsFloodplain Management Association Meetings196 of 214 March 2012 Ordinary Business PaperPage 258 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOutline1. NSW river gauging network2. Seasonal outlook for floodingDelegates ReportsFloodplain Management Association Meetings197 of 214 March 2012 Ordinary Business PaperPage 259 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aNSW river gauging networko Review of NOW networko State Water funds about 50o/o of the real time networko Bureau relies heavily on NOW's technical expertise,support and systems to provide it with real time datao Concerned about possible takeover by a water supplyutility with respect to priorities (particularly coastcatchments) and caPacitYo See paper presented to FMS Narooma conferenceDelegates ReportsFloodplain Management Association Meetings198 of 214 March 2012 Ordinary Business PaperPage 260 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aSeasonal outlook compared to last year.-this year807ctb%70%ú1øoû/.Ärßlf¡ll¿¡ lilìÌtrlllnèilIt¡¡h"'âlr ól M¡r¡ún tôe}Chanoe of exceedirqthe m€dan RainfaüNovenùer 2011 to JaruüY 2012Prduct ol lh€ NåliJrial G'Érale C€nlrÞ. /"¿'-,/w.-¿?_lOcañrrõü dÁ¡6lE|iã)11,4¡Éda &rN lU**Elast yearDelegates ReportsFloodplain Management Association Meetingsch nfafl ,çjCh.ffi{fr d,lfrl¡Ð1t &b¡ lhud U#W199 of 214 March 2012 Ordinary Business PaperPage 261 of 555 of the March 2012 Ordinary Business Paperty

Attacment 8.2.aLa Nina years - pos¡t¡ve SOI - generalty wetter cond¡t¡ons - major widespead flooding often occurswhen SOI changes from negative to positive - significant flood years indicated in top half of graph.30(#) 5 wettest years1917 1970's - wettestdecade in NSW200010120'86187 1910,gg 1893100(ELo(E -10F'65 '72 '77- {r¡ ?oE-20(0 1940's - driest(#) 5 driest years1 896 1 905decade in NSWCLoØILCLIoØoct)WeakerLa Ninathan lastyearIf'oloo|(,o|oo¡oo{?o|ooIf-)glooroo|4lol(,olooIÍ'o¡: @ @ CD o) õ ö Ë Ñ Ñ eâ co =É 1. !Q,o co (o ¡: Þ æ @ o) o) o o -@ æ € æ oo O) O) O) GD GD d ö ¿t, O, O, O, o¡ O, O¡ O¡ O) O) O) Ol O) O O OrF çF- FFNN ñl- - - - --- - - - - - - - - - - - -El Nino years - negative SOI - generally drier conditions - major drought years shown in bottomhalf of graph. The first half of the 1900s also had 20% less rain that the second half.Delegates ReportsFloodplain Management Association Meetings200 of 214 March 2012 Ordinary Business PaperPage 262 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aWinter rain (May to Oct) compared to last year\Murtây-DÈrl¡rrq Eãirìfäll tlccilßDislriE0sùfl Þ6d on (htud D¡tåPÉ'lær ôl ftt€ iÈliffd cÍiÉrÔ csdí¡,iI Mál' lo gl o'Íobèr ?01'lthis yeardrierßâ¡niallDoeilþ &rtü6€llm*10IIilJffi*itg ,j Ãb0reÄveradeo"' :* -.-,n*rn*e.31tp ,ila¡çlr Àdciõnrläi;;xm;d'rr tiøryãry¡Plast yearDelegates ReportsFloodplain Management Association MeetingsÐG.@dnCrrdd{¡rott'årr.t¡ts rk@¡ d t¡õt ddofv lÞ @dÉ^tæ201 of 214 March 2012 Ordinary Business PaperPage 263 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.allnregulated inflowForecast Períod: HovPercentage of, forecart in eech tercileHume dam inflow outlook compared to last yearHrndcasf RlvlSEP : ¡$tlH;gh skill)to Ht¡me Dam2OLI -Jan 2OL2Terciles aPPlied toforËcäst dìstributionTerciles from historicêl datèUnregulated inflow to Hume DamForecaÉt pGrlod: Nov ZO1O - Jan 2O1lPËrcert,3g€ Ðt 5Ffñ.a.rçt f o'eceEt ¡n €ã€h cãrh tercile ferÌlÉT.erc¡les äPPl¡ëc füÍorecest dlstribltiono rÕ ì.-rt10 ÚeoTerci¡6 frorn h¡sl0r¡ral dètaSrreamllow tGL))ì;$ túfiu i)[uStrearnflow (ËL]Delegates ReportsFloodplain Management Association Meetings202 of 214 March 2012 Ordinary Business PaperPage 264 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aForecast inflows last yearIlnregulated inflow tc Hurne tamForetast perlod: Ilec 2O1O - Feb UtlI¡ fÅ.-rrrnul,âti:Dfl mÐnthfltl FúFetrãst dlstflbutlonH lstorlcål dat!¡ {A"f cumulâtl:D g mÐnthfy)Recorded inflowwas much higherthan "expected" forthis periodDateNormallsed fr€quencyI .;;l:'i 1,.r,!r.l r't' ì i'Delegates ReportsFloodplain Management Association Meetings203 of 214 March 2012 Ordinary Business PaperPage 265 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFlooding in NSW this summer?o Obviously there is a higher risk of flooding during awetter than average seasono It is not possible to predict the nature or location offloods based on seasonal outlooko Computer models of the weather can provideoutlooks of around 7 to 10 days for the developmentof major flood producing weather systemsDelegates ReportsFloodplain Management Association Meetings204 of 214 March 2012 Ordinary Business PaperPage 266 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aOperations today - rain to 9am z4lLIlnxI,,J+¡2';¿'rf'{iPld.t!ctà24 Hour RaínFalIsto 9ÊFl ?{itL/tLr tö0+ nm* 5t to 99 t¡¡r* ZE to49mnr t0 to24mnr )0.2 to I mm" Ö¡tHiiir¡i;,li:,no :,Jl{.¡ìúV'iDelegates ReportsFloodplain Management Association Meetings205 of 214 March 2012 Ordinary Business PaperPage 267 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aRain outlook - today and FridaYPossi bl e rainfall total (mm) for Thu Nov 24Possible hisher rainfall total (mm) for Fri Flov 25 ztlll EDIImäge crea¿Pd Og an Thunsday 24 NouerÙer 2011 (locål tine).Êustral lôn Dlgtt¿l ForÉcæt DatabaseOCopgriÉht Csrlnonr¡ealth of Australia 2011, Bureau of l'leteÞnologgDelegates ReportsFloodplain Management Association MeetingsIrìdEe creaÈed 09 am Thursdau 24 Ìlovemh 2011 (locaMme)'A¡stral i¡n DÍSitat Forecast Oatabase@CopyrighL Connonr,re¿lth of fustralia 2011, Êureau oÊ fiet'eorolo{g206 of 214 March 2012 Ordinary Business PaperPage 268 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aThank yolt...Gordon McKay(02) 9296 1s11Email g, mckaY@bom.gov.auDelegates ReportsFloodplain Management Association Meetings207 of 214 March 2012 Ordinary Business PaperPage 269 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aFMA quarterly meeting November 2011Delegates ReportsFloodplain Management Association Meetings208 of 214 March 2012 Ordinary Business PaperPage 270 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.a-cl #, Io)l! $tt-l=l clCUI-l Jolclñl-olØlr-II-lmlCDI=t olclOIml

Attacment 8.2.ao Social Media is mo e versatile androbust than all other communicationoptionso Studies show that people are far lesslikely to lie when using electroniccommunicationo Social Media is now a key componentof any emergency response effortDelegates ReportsFloodplain Management Association Meetings210 of 214 March 2012 Ordinary Business PaperPage 272 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aoBrisbane City Council had 2 Person"social media" teams worki ng 24 hoursduri ng the emergencyfaeehsok"Delegates ReportsFloodplain Management Association Meetings- 1 rfiTûÉlø lncreaßÊ in I i kes- 759 ll'lçes ts 1Ê,679 llkes- 1?,54ü üomrfi#nw- 4,ü41,ËüE post vlews- 21,ËEi views o n'Façebosk l'åotes'- 1Ê6 Faaeboolt Hotes- 18û% lncnease in follawers- fl,955 followersto 8-Ê91 followers- 5fr 1 twe€ts Ësnt thrsughout January- Ê,gtT re-ñ¡reets (FiÏ- 8,ü22,51 6 im presslo ns211 of 214 March 2012 Ordinary Business PaperPage 273 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aøfi ny0$t-? I L4 â"iÎ _,1:4Èh fi Ê iãr $. Ihink thf,y arÊ ¡'reðr a p{n;:r c.nllxitodci?lfEl N4yrthûr (ut íÈ ñÉ¿.r';erry tlrn¡¿e. ß¡rt lTrefly ril rB lh, T{vtaerc tfiql are.-Y V Feard¡ foe "frqldfioad#Lrcdn*

Attacment 8.2.ao Online communities using social mediaare extend¡ng and reconnecting realcommunitieso lmproved social capital greatly reducesthe negative impacts of naturald¡sastersDelegates ReportsFloodplain Management Association Meetings213 of 214 March 2012 Ordinary Business PaperPage 275 of 555 of the March 2012 Ordinary Business Paper

Attacment 8.2.aWh¡le ¡t m ay not be a partnership that isacknowledged by legal documentationor public representatiorl , emergencymanagement services must partner w¡thsocial media services to better manageinformation sources and crisis responseDelegates ReportsFloodplain Management Association Meetings214 of 214 March 2012 Ordinary Business PaperPage 276 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 DELEGATES REPORTS8.3. NAMOI COUNCILS WATER WORKING GROUP (JC:EL)RECOMMENDATION: That the Council receive and note Cr Clements’ DelegatesReport on the Namoi Councils Water Working Group meeting held 8 th December 2011.On the 8 th December 2011 I attended the Namoi Councils Water Working Group meeting inGunnedah.Discussion was as per the minutes.The following documents from the said meeting are shown at Attachment 8.3.a: Agenda for Water Working Group Meeting 8 th December 2011; Previous Minutes from meeting held 9 th June 2011; Minutes for Water Working Group Meeting 8 th December 2011.Cr J ClementsDELEGATEDELEGATES REPORTS PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THENARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH 2012.GENERAL MANAGERMAYORPage 277 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aNamoi GouncilsPO Box 555 TAMWORTHNSW 2340Telephone: (02) 6767 5267Email: namoicouncils@tamworth.nsw. gov.auABN: 35 540425772NAMOI COUNCILS WATER WORKING GROUP AGENDA1 0:OOAM-THURSDAY, I DecemseR 2011BOARDROOM, LEVEL 1, NAMOT CMA OFF|CES, 55-57 ABBOTT STREET, GUNNEDAH1.Apologies2.Minutes of Previous Meeting2.1. Approval of Minutes.2.2.Updated Actions.2.3. Foreshadowed General Business ltems.3. Correspondence\M¡t/G correspondence to Peel Valley Water Users Association (P\A/ÚUA) indicating \M/t/G beliefthat Namoi Water was the irrigators representative.4. MDBA Basin Plan -lmplications for the Northern Basin &Namoi(To be released on 28111111 -copies will be distributed to \AANG Members).5. Progress on NamoiGouncils DEWHA'Sustaining Basin Gommunities' ProgramGrant ($7eOX¡Dan Terrill (Access Economics) to join by telephone (11:00am - 11:30am) to provide anupdate on progress with the socio-economic modeling of the impacts of reduced wateravailability stemming from the MDB reforms.6. Project Proposals for Namoi lnfrastructure and Efficiencies Program(s) - SEWPAC.Paper to be tabled at the meeting. Matt Norrie (Namoi Councils) to discuss.Namoi Councils' members are Gunnedah, Liverpool Plains and Narrabri Shire Gouncils, Tamworth Regional Gouncil, WalchaGouncil and Namoi Catchment Management AuthorityOur Mission is fo provide sfrong leodershþ ond work co-operotively for Ìhe susloinobility & imoge of fhe Nomoi throughodvococy on ogreed regionol pnorifies.Delegates ReportsNamoi Councils Water Working Group Meetings1 of 18 March 2012 Ordinary Business PaperPage 278 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.a7. Namoi CMA's Risk Management Methodology on Gumulative lmpacts of Miningplus bio-regional assessments under the MRRT LegislationPresentation by Chair. Copy of the full Scoping Study attached.L Regional Development Australia (North lnland NSW)See email from David Thompson on AG water efficiency and other related water issues.9. General Businessá*4.*JBruce BrownChairNamoi Councils Water Working GroupNamoi Councils' memberc are Gunnedah, Liverpool Plains and Narrabri Shire Councils, Tamworth Regional Gouncil, WalchaCouncil and Namoi Gatchment Management Author¡tyOur Mission is lo provide slrong leodership ond work co-operotively for lhe susloinobility & rmoge of lhe Nomoi fhroughodvococy on ogreed regÌonol príoritíes.Delegates ReportsNamoi Councils Water Working Group Meetings2 of 18 March 2012 Ordinary Business PaperPage 279 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aPREVIOUS ACTIONS2.1 Chair to develop the concept of a\ A/VG 'TechnicalWorking Group'with David Thompson (RDA -Nl), including membership andTOR. Paperto be brought backto the ! A/VG for approval.2.3 NamoiWater to prepare a paperto the \ A¡úG outlining the keyissues of the Metering ProgramProposal.3.1 David Thompson (RDA-Nl) toforward to the Chair forcirculation to the \ l1/ÚG a list offunding programs that could beavailable to the \,/^ ¡úG in thegeneral area of increased waterefficiency.3.2 Chair and Dan Terrill to organisea suitable date for DeloittesAccess to provide the !AA/úG witha presentation (including O&A)on the socio-economic modellingbeing undertaken as part of the'Sustaining Basin Communities'Program Grant.3.3 Chair to correspond with the PeelValley Water Users Associationnoting the V1Â/t/G's belief that theAssociation was represented onthe \M/VG by NamoiWater.Chair/ RDA (Nl)NamoiWaterEOChairChairChairBernie Georgeprovided anupdate ofdiscussions at theNorthern lrrigatorsGroup Meeting(3/06/11) on theproposed NSWMetering Project.See Agenda ltem8.Dan Terrill to join\ /WG Meeting viateleconference on8112111 to providean update.Correspondenceforwarded to PeelValley WaterUsers Association.\ A/t/G decisionsupported byNamoi Councils ata later meeting.Namoi Councils' members are Gunnedah, Liverpool Plains and Narrabri Shire Councils, Tamworth Regional Council, WalchaCouncil and Namoi Catchment Management AuthorityOur Mrssion rs to provide strong /eodership ond work co-operotively f or the susfoinobilily & imoge of lhe Nomoi throvghodvococy on ogreed regîonol prioritîes.Delegates ReportsNamoi Councils Water Working Group Meetings3 of 18 March 2012 Ordinary Business PaperPage 280 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.a3.4 Namoi Water to present theProject Proposals for the Namoilnfrastructure and EfficienciesProgram(s) - SEWPAC at thenext \AM/G Meeting.3.5 Sally Benham to provide theChair with an overview of AWE'sCorporate Profile. Chair tosubsequently circulate profile toall\MA/G Members.EO, NamoiWaterChairPaper to be tabledatW\A/G Meeting.ln the absence ofNamoiWater EO,Matt Norrie (NW)will discuss.Circulated.4Namoi Gouncils' members are Gunnedah, Liverpool Plains and Narrabri Shire Councils, Tamworth Regional Council, WalchaGouncil and Namoi Catchment Managemont AuthorityOur Milsion rs fo provide slrong leodershþ ond wok co-operolively for the susfoinobilify & imoge of fhe Nqmoi lhroughodvococy on ogreed regionol prionfies.Delegates ReportsNamoi Councils Water Working Group Meetings4 of 18 March 2012 Ordinary Business PaperPage 281 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aNamoi CouncilsPO Box 296 QUIRINDINSW 2343Telephone: 0267 463142Fax'.0267 462190Email: NamoiROC@bigpond.comABN: 35 540425772NAMOI COUNCILS WATER WORKING GROUP MEETING MINUTESMeerrruc No 3THURSDAY, 9 JUNE 201 1BOARDROOM, LEVEL 1, NAMOI CMA OFFICES, 55.57 ABBOTT STREET, GUNNEDAH35-37 ABBorr srREET, GUNNEDAHMeeting Opened 10:15amPRESENT:Tamworth Regional CouncilAuscott LimitedLiverpool Plains Shire CouncilNamoi GMAVisitorsMr Bruce Logan, Director - Water EnterprisesMr Bernie George, General ManagerMr Rod Batterham, Water Services ManagerMr Bruce Brown, General Manager (Chair, WWG)Mr David Thompson, MDB Project Officer -Regional Development Australia - Northern lnlandMs Sally Benham, Strategic Advisory ServicesManagement - Australian Water Engineering1. ApologiesDr Jurgen Shaeffer, Technical Services Manager - Shenhua Watermark Coal.Clr John Clements - Narrabri Shire Council.Ms Jon-Maree Baker, Executive Officer - Namoi Water.Mr Col Murray, Mayor - Tamworth Regional CouncilMr Henry Segerius, Operations Manager - Grain Products Australia Pty LtdMr Stephen Bartlett, Executive Officer - Namoi Councils2. Minutes of Previous MeetingResolution 3.1 - That the Minutes from Namo! Cou¡tcils 1/1/WG Meeting 2(29/03/1 1) be accepted.Carried* Gunnedah * Liverpool Plains * Narrabri " Tamworth * Walcha *Namoi CMAMissionTo provide slrong iocoi governmenl ieodershþ, to work co-operolively f or lhe sustoinobilily & imoge of NomoiROC ond lhe Nomoi region, ond effeclively odvocofe on ogreed regionoi posilions ond priorifies.Delegates ReportsNamoi Councils Water Working Group Meetings5 of 18 March 2012 Ordinary Business PaperPage 282 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.a3. GorrespondenceChair tabled correspondence received from the Peel Valley Water UsersAssociation (29103111) requesting representation on the Namoi Councils \ /WGand advised that the matter would be discussed under Agenda ltem 7.4. Future Linkages with Regional Development Australia (Northern lnlandNSW) & Governance Structures on Environmental Water & MDB Reformlncentive FundingChair welcomed David Thompson to the Meeting and tabled two papers providedby RDA-NI to the \A /VG entitled the 'Structure and Role of the Water WorkingGroups' and the'Environmental Water in the Northern-lnland Region of NSW'.David noted that the \AM/G's Environmental Water Networks'fundamental rolewould be to assess environmental assets and water requirements within theregion and develop an environmentalwatering plan, along with the generation ofwater projects for the \AAIVG's approval.David advised that the 'Water for the Future' and 'Sustainable Rural Water UseEfficiency' Programs were the two main sources of funding currently available forwater efficiency projects.Bernie George queried the role and function of the Environmental Water NetworkGroups in future project activity. Chair advised that the Groups would beresponsible for identifying and developing funding projects which would then bepassed up to the \ A¡r/G for approval prior to being fonruarded to the Northernlnland Water Management Group (NIWMG).David noted that the next round of RDA funding (due to be released inSeptember 2011) would include funding opportunities for "spade ready" regionaldevelopment projects. Chair queried whether David could provide the VIM/G witha listing of all related programs.Action 3.1 - David Thompson (RDA-NI) to forward to the Chair for circulation tothe IArWG a list of funding programs that could be available to the lltlwc in thegeneral area of increased water effiaency.Chair thanked David for attending the Meeting.5. Progress on Namoi Gouncils DEWHA'Sustaining Basin Gommunities'Program Grant'($ZeOf¡Chair welcomed Dan Terrill to the \ A¡úG Meeting (via teleconference) and askedhim to provide the \A/\/VG with a brief update on the progress of the socioeconomicmodelling being undertaken by Deloittes Access.* Gunnedah * Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi CMAMissionTo provide slrong locol governmenf leodershþ, lo work co-operotiveiy for the susioinobilify & rmoge of NomoiROC ond ihe Nomoi region, ond effeclively odvocoie on ogreed regíonol posilions ond priorilies.Delegates ReportsNamoi Councils Water Working Group Meetings6 of 18 March 2012 Ordinary Business PaperPage 283 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aDan noted that he and Ric Simes were keen to provide the \AA/VG with a formalpresentation on the progress of the socio-economic modelling by late June 2011.Action 3.2 - Chair and Dan Terrillto organise a suitable date for DeloittesAccess to provide the IITWG with a presentation (including Q&A) on the socioeconomicmodelling being undedaken as parl of the 'Sustaining BasìnComrnunities' Program Grant.Dan noted that the third project milestone was due to be submitted by 30/06/11,the fourth by 31112111 and the last by 30105112.Dan provided the \AAffG with a brief overview of the three main types of modelsbeing undertaken by Deloittes Access: the Land Use and Water Use Model, theGeneral Equilibrium Model and the Community/Regional lmpact Modelling.Chair enquired whether data from the CGE Modelling would be available by theend of October for possible provision to Craig Knowles (Chair, MDBA) during theMDBA's 16 week consultation period following the release of the revised BasinPlan. Dan advised that preliminary figures would be available and could beprovided.Brief discussion also occurred on negative economic multiple impacts of reducedwater availability.Chair thanked Dan for providing the \M/VG with an update.6. Discussion on Namoi Gouncils WWG Meeting with MDBA Ghair, GraigKnowles on Friday,20 May 2011Chair provided a brief overview on the meeting held between the \AA/úG andCraig Knowles on 2OlO5l11 and this was followed by general discussion. Chairnoted that Craig Knowles had advised the revised MDBA Basin Plan would bereleased by the end of July 2011.Chair stated that the Windsor lnquiry on the MDB reforms had been released on2106111, and that the \ A¡r/G had received good value for money from its writtenand verbal submissions since it had been quoted up to 8 times within the Report.7. Peel Valley Water Users Association Membersh¡p of the WWGChair noted that the PeelValley Water Users Association's request formembership on the \ had been passed back to the \M/t/G by NamoiCouncils for decision. ^¡úGBrief discussion was held noting that membership on the \MffG was currentlylimited to the peak bodies across the Catchment with the Peel lrrigators beingrepresented by Namoi Water.* Gunnedah * Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi GMAMissionTo provide slrong locol governmenl leodershþ. lo work co-operolively for the sustoinobi/ify & imoge of NomoiROC ond lhe Nomoi region, ond effeclively odvocofe on ogreed regíonolposilions ond príorities.Delegates ReportsNamoi Councils Water Working Group Meetings7 of 18 March 2012 Ordinary Business PaperPage 284 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aAction 3.3 - Chair to correspond with the Peel Valley Water Users Associationnoting the lÃtWG's belÌef that fhe Association was represented on the VI|WG byNamoiWater.8. Metering Project Proposal (NSW Office of Water) -NamoiKey lssues for theChair tabled the Minutes from the Northern Valley lrrigator's Group Meeting on3106111 and noted that the Group had discussed the proposed NSW MeteringProject. Bernie George advised he had attended the meeting and he provided abrief overview of the discussions.Bernie noted that State Water believed current water meters were inaccurate,and as a result had put forward a business case to upgrade all current meterswithin NSW. Bernie advised that State Water believed the new meters wouldprovide at least 3% water savings and that these savings be transferred to theCommonwealth. lrrigators doubted State Water's estimate of water savings.Additionally, Bernie noted that the irrigators had also been unwilling to supportthe metering project due to the ongoing metering maintenance costs that wouldbe borne by irrigators.9. Project Proposals for Namoi lnfrastructure and Efficiencies Program(s) -SEWPACChair noted that due to the absence of Namoi Water at the Meeting, the ProjectProposals for the Namoi lnfrastructure and Efficiencies Program would bedeferred until the next \M/úG Meeting.Action 3.4 - Namoi Water to present the Project Proposals for the Namoilnfrastructure and Efficiencies Program(s) -l0.General BusinessSEWPAC at the next IA|WG Meeting.Presentation by Sally Benham - Strategic Advisory Services Manager,Australian Water Engineering.Chair welcomed Sally to the meeting and thanked her for taking the time tospeak to the \ A¡úG.Sally provided the \ A/r/G with a brief overview of the role and functions ofAustralian Water Engineering (AWE) - Strategic Advisory Services Division. Shealso provided a summary of the irrigation efficiency programs AWE was currentlyinvolved with.Chair noted that Sally could possibly assist the \AA/ÚG in developing the fundingapplications for any future water efficiency programs." Gunnedah " Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi CMAMissionTo provide slrong locol government leodership, lo work co-operotively for the susloinobiiity & rmoge of NomoiROC ond ihe Nomoi region. ond eff ectively odvocole on ogreed reglonolposiiions ond priorilies.Delegates ReportsNamoi Councils Water Working Group Meetings8 of 18 March 2012 Ordinary Business PaperPage 285 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aSally provided the \ /WG with a Corporate Prospectus for the AWE StrategicAdvisory Services Division.Actíon 3,5 - Sally Benham to provide the Çhairwith an ave¡view of AWE'sÇarporate Profile. Chaír fo subseqøently circulate profile ta all I/\/WG Members.Chair thanked Sally for attending the Meeting.Meeting C/osed 12:30pmt Gunnedah * Liverpool Plains " Narfabr¡ * Tamworth * Walcha *Namoi CMAMissionTo provide sirong locol government leodershþ, 1o work co-operofively for fhe sustoinobilfty & imoge of NomoiROC ond the Nomoi region, ond effecllvely odvocste on ogreed reg¡onol posilions ond priorities.Delegates ReportsNamoi Councils Water Working Group Meetings9 of 18 March 2012 Ordinary Business PaperPage 286 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aRESOLUTIONSThat the Minutes from Namoi Councils \ M/G Meeting 2 (29103111) be accepted.* Gunnedah * Liv.erpool Plains * Nar¡ahri * Tamworth r Walcha *Namoi GMAMlssionIo provide slrong locol governrnenf leodership. to work co-operofMel¡u for lhe susfoinobil¡fy & ifnoge of NomoiROC ond fhe Nomoiregion. ond effectively odvocofe on ogreed regionolposifions ond pr¡orfies.Delegates ReportsNamoi Councils Water Working Group Meetings10 of 18 March 2012 Ordinary Business PaperPage 287 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aACTIONSMeeting Number 33.1 David Thompson (RDA-Nl) to forward to the Chair for circulation to the\ M/G a list of funding programs that could be available to the \Mlt/G in thegeneral area of increased water effìciency.3.2 Chair and Dan Terrill to organise a su¡table date for Deloittes Access toprovide the \AA¡VG with a presentation (including Q&A) on the socioeconomicmodelling being undertaken as part of the 'Sustaining BasinGommunities' Program Grant.3.3 Chair to correspond with the PeelValley Water Users Association noting the\AM/G's belief that the Association was represented on the \A /VG by NamoiWater.3.4 Namoi Water to present the Project Proposals for the Namoi lnfrastructure EO,and Efficiencies Program(s) - SEWPAC at the next \Mlt/G Meeting.3.5 Sally Benham to provide the Chair with an overview of AWE's CorporateProfile. Chair to subsequently circulate profìle to all!AM/G Members.ChairChairChairNamoiWaterChair* Gunnedah * Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi CMAMissionTo províde sfrong /ocol governmenl leodershþ, to wo¡k co-operot:ely for lhe sustoinobilify & ímoge of NomoiROC ond fhe Nomoi region, ond effectively odyocofe on ogreed regionol posilions ond priorilies.Delegates ReportsNamoi Councils Water Working Group Meetings11 of 18 March 2012 Ordinary Business PaperPage 288 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aNamoi CouncilsPO BOX 555TAMWORTH NSW 2340Telephone: (02) 6767 5267Email : namoicouncils@tamworth. nsw.gov.auABN: 35 540425772NAMOI COUNCILS WATER WORKING GROUP MEETING MINUTESMeerrruc No 4THURSDAY, 8 OeCeMeen 201 IBOARDROOM, LEVEL 1, I.¡AIVIOICMA OFFICES, 35-37 ABBOTT STREET, GUNNEDAHMeeting Opened 10:15amPRESENT:Tamworth Regional CouncilLiverpool Plains Shire CouncilNarrabriShire CouncilGrain Products Australia Pty LtdNamoi CMAVisitors (phone)Mr Bruce Logan, Director - Water EnterprisesMr Rod Batterham, Water Services ManagerClr John ClementsMr Henry Segerius, Operations ManagerMr Bruce Brown, General Manager (Chair, WWG)Dr Dan Terrill, Director - Deloitte Access Economics1. ApologiesMr Bernie George, General Manager - Auscott LimitedDr Jurgen Shaeffer, Technical Services Manager - Shenhua Watermark CoalMr Col Murray, Mayor - Tamworth Regional CouncilMs Jon-Maree Baker, Executive Officer - Namoi WaterMr Stephen Bartlett, Executive Offlcer - Namoi Councils2. Minutes of Previous Meet¡ng2.1 Approval of Previous MinutesResoluúion 4.1 - That the Minutes from Namoi Councils WWG Meeting 3(09/06/1 1) be accepted.Carried* Gunnedah " Líverpool Plains * Narrabri * Tamworth * Walcha *Namoi CMAMrssionTo provtde slrong loco/ governmenf leodership, to work co-operofive/y for lhe susloinobilily & ¡moge of NomoiROC ond fhe Nomoi regîon, ond eff ectively odvocoie on ogreed regionol posilions ond priorifies.Delegates ReportsNamoi Councils Water Working Group Meetings12 of 18 March 2012 Ordinary Business PaperPage 289 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.a2.2 Updated Actions. Action 2.1Chair noted that he and David Thompson (RDA-Nl) would meet to develop theconcept of a \AA/ÚG 'TechnicalWorking Group' in early C'12.. Action 2.3John Clements advised he had attended a meeting with the State Water Boardand Minister Hodgkinson on (12111111) lo discuss the NSW Metering Projectissues associated with the Northern Basin Business Case which had not beensigned off after a 4 year period. John Clements indicated that the Northernlrrigators would not accept the proposed business case in its current form. JohnClements stated that as a result of further discussions, Minister Hodgkinson hadagreed to withdraw the Northern Basin from the NSW Metering Project proposal.John Clements also indicated that Commonwealth funded water efficiencyprograms were available which could be accessed by the \^ ¡úG if appropriateproject proposals were developed. Chair noted that the matter would be furtherdiscussed under Agenda ltem 8.. Action 3.1Update to be provided under Agenda ltem 8.. Action 3.2Chair advised that Dan Terrill would be joining the \A/WG Meeting viateleconference to discuss the'Sustaining Basin Communities' Program Grantunder Agenda ltem 5.¡ Action 3.3Chair stated that correspondence had been forwarded to the PeelValley WaterUsers Association (12107111) notifying them that the \AM/G believed theAssociation was represented on the ! A|ÚG by Namoi Water.. Action 3.4Chair noted that Matt Norrie was due to attend the Meeting to present NamoiWater's Project Proposals for the 'Namoi lnfrastructure and Efficiencies Program(SEWPAC)' on behalf of Jon-Maree Baker.2.3 Foreshadowed General BuslnessChair foreshadowed the need for discussion on the Mining Resource Rental Tax(MRRT) allocation for bio-regional assessments ($200m).John Clements foreshadowed possible discussions regarding the custodianshipof the Namoi Water Study.* Gunnedah * Liverpool Plains * Narrabri * Tamworth 'Walcha *Namoi CMAMissionTo provîde sfrong locol government leodershþ, lo work co-operotwely for the susloinobilify & irnoge of NomoiROC ond fhe Nomoi regton, ond effectively odvocole on ogreed regîonolposiiions ond priorities.Delegates ReportsNamoi Councils Water Working Group Meetings13 of 18 March 2012 Ordinary Business PaperPage 290 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.a3. CorrespondenceChair noted correspondence forwarded to the Peel Valley Water UsersAssociation (12107111) and advised that no response had been received.4. MDBA Proposed Basin Plan - lmplications for the Northern Basin andNamoiChair stated that while there were no changes to groundwater SDL's in theNamoi Catchment and only a minor reduction in the surface water SDL (1OGLs),the allocation of the shared Northern Basin component (143GLs) was of greatimportance.Chair advised he had requested hardcopies to be delivered of the MDBA Planand would distribute copies to all IAA/I/G Members when received.John Clements noted that a meeting with MDBA technical staff was to take placeon 19/1 2111 in Narrabri to further explore the MDBA proposed plan.5. Progress on Namoi Gouncils DEWHA'Sustaining Basin Gommunities'Program Grant'($760k)Chair welcomed Dan Terrill to the \ /WG Meeting (via teleconference) and askedhim to provide the \MA/G with a brief update on the progress of the socioeconomicmodelling being undertaken by Deloittes Access.Dan noted that the three main modelling areas (Land Use and Water Use,General Equilibrium and Community/Regional lmpact) had been developed andwere currently undergoing testing. Dan also stated the modelling was onschedule.Chair enquired whether the SDL's outlined within the proposed MDBA Basin Plancould be entered into the GE Modelto determine impacts on the Namoi region.Dan advised that this could be done and the results would be provided to theNamoi\ M/G for inclusion in any submissions to the MDBA.John Clements noted he would provide Dan Terrill with an update of theoutcomes of the MDBA Technical Working Group Meeting on 19112111.Dan advised that the fìnal socio-economic modelling would be passed ontoNamoi CMA in an Excelformat and that training would be provided.Chair queried whether Dan could attend the next meeting to provide a fullpresentation to the \ /WG prior to the MDBA submission being developed.Action 4.1 - Chair to invite Dan Teril! (Deloittes Access/ ta attend the nextl/\/WG Meeting to give a formal presentation of the socio-economic modelling inFebruary 2012.* Gunnedah * Liverpool Plains ' Narrabri * Tamworth * Walcha *Namoi CMAMissionTo provtde strong locol government leodership. lo work co-operot:ely for fhe susfoinobilify & imoge of NomoiROC ond fhe Nomoi region, ond effect:ely odvocole on ogreed regionolposiiions ond priorifies.Delegates ReportsNamoi Councils Water Working Group Meetings14 of 18 March 2012 Ordinary Business PaperPage 291 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aJohn Clements noted that the presentation could also be given to NSWgovernment agencies and local government during the same week.Chair noted that the fourth project milestone was due to be submitted by31t12t11.Actíon 4.2 - Chair and Bruce Logan to co-ordinate the submrssion of the fourthproject milestone repoñ (Sustaining Basin Camntunities Project) prior toChristmas.Chair thanked Dan for providing the \ÄANG with an update.6. Project Proposals for Namoi lnfrastructure and Efficiencies Program(s) -SEWPACChair expressed disappointment at the absence of NamoiWater representativesat the last two \ A/t/G meetings, following advice that representatives would bepresent at both.Given the absence of Matt Norrie (Namoi Water) discussion on this subject wasdeferred to the next \AA/ÚG Meeting.7. Namoi GMA's Risk Management Methodology on Gumulative lmpacts ofMining plus bio-regional assessments under the MRRT LegislationChair noted the previously circulated Cumulative lmpacts Scoping Studyundertaken by EcologicalAustralia Pty Ltd and gave a presentation to the \AÂlúGoutlining the modelling methodology.Chair advised that additional groundwater data would be inserted into the modelwhen the NamoiWater Study was released in March 2012.John Clements noted the importance of the Cumulative lmpacts Study inassessing broader risks in relation to extractive industry activities.8. Regional Development Australia (North lnland NSW)Chair noted the paper to the ! /WG detailing RDA-Nl's project update from DavidThompson.Chair expressed disappointment at David Thompson's comment that followingdiscussions with NamoiWater and Namoi CMA staff, they had expressedreservations about obtaining funding for AG water efficiency programs. Chairstated he would discuss this matter further with David Thompson and relevantNamoi CMA staff.9. General BusinessJohn Clements flagged the \AANG's interest in researching and developingrelevant proposals to gain funding for water efficiency projects within the Namoi* Gunnedah * Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi CMATo providesfrong tocol governmentleodership, #Î"J?i."-"o erolîvetyfor fhe sustoin obilily &imoge of NomoiROC ond the Nomoi region, ond eff ectively odvocole on ogreed regionol posifions ond prioriües.Delegates ReportsNamoi Councils Water Working Group Meetings15 of 18 March 2012 Ordinary Business PaperPage 292 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.afollowing the release of the Namoi Water Study. John Clements noted that'Water for Rivers' was a public company established by the NSW, Victoria andCommonwealth Governments which could assist in developing such proposals.Actìon 4.3 - Chair and Jahn C/emenfs to hold d¡scusslons with 'Water for Rivers'regarding f/re possrb/e development of water efficiency projects within the Namoi.Update to be presented at the next l /WG Meeting.Action 4.4 - Chair and John Clements to speak to Namoi Water aboutdeveloping a possib/e list of funding programs that could be available for waterefficiency projects. Discussion s to include Mal Peters (Chair, RDA-N|).Meeting C/osed 12:00pm* Gunnedah ' Liverpool Plains * Narrabri " Tamworth * Walcha *Namoi CMAMasionTo provîde sfrong locol government leodershþ, fo work co-operolively for the susloinobilily & imoge of NomoiROC ond lhe Nomoi region, ond eff ectively odvocole on ogreed regiono/ posifions ond priorifies.Delegates ReportsNamoi Councils Water Working Group Meetings16 of 18 March 2012 Ordinary Business PaperPage 293 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aRESOLUTIONSMeeting Number 44.1 That the Minutes from Namoi Councils \ M/G Meeting 3 (09/06/11) be accepted.t Gunnedah * Livorpool Plains ' Narrabri * Tamworth * Walcha *Namoi GMAMissionIoprovidestronglocol governrnenf leodershþ, foworkco-operofivelyforthe susloinobility &tmoge of NomoìROC ond fhe Nomoiregion, ond effectívety odvocofe on ogreed regionol posrlions ond priorities.Delegates ReportsNamoi Councils Water Working Group Meetings17 of 18 March 2012 Ordinary Business PaperPage 294 of 555 of the March 2012 Ordinary Business Paper

Attachment 8.3.aACTIONSMeeting Number 44.1 Chair to invite Dan Terrill (Deloittes Access) to attend the next \AM/GMeeting to give a formal presentation of the soc¡o-economic modelling inFebruary 2012.4.2 Chair and Bruce Logan to co-ordinate the submiss¡on of the fourth projectmilestone report (Sustaining Basin Communities Project) prior to Christmas.4.3 Chair and John Clements to hold discussions with 'Water for Rivers'regarding the possible development of water efficiency projects within theNamoi. Update to be presented at the next \ /WG Meeting.4.4 Chair and John Clements to speak to Namoi Water about developing apossible list of funding programs that could be available for water effìciencyprojects. Discussions to include Mal Peters (Chair, RDA-NI).GhairChair/ BruceLoganChair/ JohnClementsChair/ JohnClements* Gunnedah * Liverpool Plains * Narrabri * Tamworth * Walcha *Namoi GMAMissionTo provide sfrong iocol government leodershþ, fo work co-operotive/y for lhe susloinobilily & imoge of NomoiROC ond the Nornoi regton, ond effectively odvocofe on ogreed regionolposifions ond priorities.Delegates ReportsNamoi Councils Water Working Group Meetings18 of 18 March 2012 Ordinary Business PaperPage 295 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 DELEGATES REPORTS8.4. NAMOI COUNCILS MEETING (LK:EL)RECOMMENDATION: That the Council receive and note Cr Kelly’s Delegates Reporton the Namoi Councils meeting held Thursday, 1 st March 2012.On Thursday, 9 th March 2012 I attended the Namoi Councils Meeting in Tamworth.The discussion was as per the Minutes.The Minutes from the Meeting are shown at Attachment 8.4.a for your information.Cr L KellyDELEGATEDELEGATES REPORTS PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THENARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH 2012.GENERAL MANAGERMAYORPage 296 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aMEETINGMINUTESheld atNAMOI CATCHMENT MANAGEMENT AUTHORITY OFFICES, TAMWORTHTHURSDAY 1 MARCH 2012 commencing at 10.30amPRESENT:Tamworth Regional CouncilCr Col Murray, Chairperson and Mr Paul Bennett, General ManagerNarrabri Shire CouncilCr Lester Kelly, Deputy MayorGunnedah Shire CouncilMr Robert Campbell, General ManagerLiverpool Plains Shire CouncilCr Ian Lobsey, Mayor and Mr Robert Hunt, General ManagerWalcha Shire CouncilCr Kevin Ferrier, Deputy Mayor and Mr Jack O’Hara, General ManagerNamoi Catchment Management AuthorityBrian Tomalin, Acting Chairperson and Mr Bruce Brown, General ManagerPage 1 of 11Delegates ReportsNamoi Council Meeting1 of 11 March 2012 Ordinary Business PaperChairpersonPage 297 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.a1 APOLOGIESApologies were announced as having been received from Cr Robyn Faber and Mr PhilMarshall, Narrabri Shire Council, Cr Adam Marshall, Gunnedah Shire Council and CrBill Heazlett, Walcha Council who were unable to attend the Meeting due to Councilbusiness commitments.MOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Kevin Ferrier, Walcha1/12 RESOLVEDThat the apologies be accepted and Councillors Faber, Marshall, Heazlett and Mr PhilMarshall be granted leave of absence from the Meeting.2 CONFIRMATION OF MINUTES OF PREVIOUS MEETINGMOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Col Murray, Tamworth2/12 RESOLVEDThat the Minutes of the Meeting of Namoi Councils held on 1 December 2011, copiesof which were circulated to all members, be taken as read and confirmed as a correctrecord of the proceedings of the Meeting.3 BUSINESS ARISING FROM THE MINUTESNil4 MEETING WITH MEMBER FOR TAMWORTH, KEVIN ANDERSON MPThe following is a summary of the issues discussed with the Member for Tamworth, KevinAnderson MP.New England North West Regional Strategic Land Use PlanThe draft New England North West Regional Strategic Land Use Plan will be released bythe NSW Department of Planning and Infrastructure within the next 2 weeks for publicconsultation. Forums are planned to be held with the Mayor, General Manager and seniorplanning staff of each Council within the Region to ensure direct consultation with and inputfrom each Council.Mining and Coal Seam Gas Extraction in the Namoi Catchment/GunnedahBasinNo new Coal Seam Gas exploration or extraction licenses have been approved by theNSW Government. The NSW Government has completed economic assessments toprovide equitable mining royalty payments to towns and communities to redress the impactof mining development on infrastructure and services.The Executive Officer was requested to prepare a submission in relation to the Royalties forRegions on behalf of Gunnedah, Narrabri and Liverpool Plains Shire Councils highlighting:Page 2 of 11Delegates ReportsNamoi Council Meeting2 of 11 March 2012 Ordinary Business PaperChairpersonPage 298 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.a Infrastructure/Service Demands Housing and Accommodation Ten to Twenty Year Time Frame Contributions under the Royalties to Regions Program be made upfront andby the Mining Companies directly to Councils Discussion be held with Tony Windsor for Federal Funding from MiningCompany Corporate Tax to fund Infrastructure Plans in urban areasimpacted by Mining DevelopmentMining Sector Training FacilityMining Sector Training Facility Business Plan preparation is on track for completion byMarch 2012.NSW Urban Water Sector ReformDiscussion was held concerning current State Government policy for microeconomic reformof Local Water Utilities and the proposal by Namoi Councils for the establishment of aNamoi Councils Water Utilities Binding Alliance.Namoi Water StudyCompletion of the Namoi Water Study commissioned by the Namoi CatchmentManagement Authority has been delayed and is now due for completion by the end of May2012.Tamworth Electorate Police ResourcesDiscussion was held in relation to the tabling and debate of the Petition submitted byTamworth Regional Council relating Police Resources and crime in Tamworth which isscheduled to be presented by the Member for Tamworth to the NSW Parliament on 10 May2012.Cr Ian Lobsey, Mayor, Liverpool Plains Shire Council advised that Quirindi Police resourcestotalled 5 officers, however, only 3 officers were available for full time duty and the WerrisCreek police officer was experiencing a very heavy workload. The Member for Tamworthadvised that ten additional police officers had already been allocated to the City ofTamworth and a further 8 police officers were proposed.Regional Health InfrastructureFunding agreements for the $210M redevelopment of Tamworth Base Hospital had beensigned and the new Cancer Facility was under construction. Car parking would beaddressed as part of the redevelopment program for the Hospital. Redevelopment of theHospital is scheduled to commence in 2013 with a completion date of 2016.Local Government Contributions to Rural Fire ServiceAll Council representatives expressed their strong concern at the excessive increase infinancial contributions to the NSW Rural Fire Service. Tamworth Regional Council’scontribution had increased 131%. Gunnedah Shire Council’s contribution had increased16%, however, the Council had agreed that it would only make a contribution increase thatmatched the annual rate pegging maximum.All Council representatives agreed that the contribution increases were neither affordablenor sustainable. All Emergency Services must be consolidated, duplication removed and anew organisation and service delivery structure developed to ensure a much moreoperationally effective and cost efficient organisation and service. It was agreed that theFire Service Levy is inequitable and that action is required to remedy the situation.Page 3 of 11Delegates ReportsNamoi Council Meeting3 of 11 March 2012 Ordinary Business PaperChairpersonPage 299 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aThe Executive Officer was requested to prepare a Namoi Councils Submission calling forreform, removal of duplication and inefficiencies, an equitable and affordable system forcontributions incorporating annual increases not exceeding annual rate peggingmaximums.Namoi Socio-Economic Study of the Impacts of the MDBA PlanThe General Manager of the Namoi CMA, Bruce Brown, provided a verbal report ofprogress to date for completion of the Namoi Socio-Economic Study of the impacts ofMDBA Plan.Regional ChildcareNarrabri Shire Cr Lester Kelly advised of the chronic shortage of childcare in Narrabri andthat Council had held discussion with Mining Companies about providing child carefacilities.Affordable Housing and AccommodationDiscussion ensued concerning the Accommodation shortage brought on by MiningDevelopment and the lack of vision and planning by the NSW Department of Housing to therequirements for public housing in mining development areas. Reference was made to aninnovative strategy by a Gunnedah Mining Company to provide housing for purchase andrental by company employees.The Executive Officer advised that it would be appropriate for this issue to be listed fordiscussion at the next meeting of the Minerals & Energy Working Group.Renal Patient TransportDiscussion ensued in relation to the requirements for renal patients to travel to Tamworthand Moree for dialysis and whether services could be provided in the towns closest towhere patients resided. The Member for Tamworth agreed to consult with the NSWMinister for Health in relation to this issue.MOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Kevin Ferrier, Walcha3/12 RESOLVEDThat the discussion with the Member for Tamworth, Mr Kevin Anderson MP, in relationto regional issues by noted and the following action be taken:(i)(ii)(iii)The Executive Officer was requested to prepare a submission in relation to theRoyalties for Regions on behalf of Gunnedah, Narrabri and Liverpool Plains ShireCouncils;The Executive Officer was requested to prepare a Namoi Councils Submissioncalling for reform, removal of duplication and inefficiencies, introduction of anequitable and affordable system for contributions incorporating annual increasesnot exceeding annual rate pegging maximums; andThe Executive Officer be requested to list the issue of Housing andAccommodation in Mining Development areas at the next meeting of the Minerals& Energy Working Group.Page 4 of 11Delegates ReportsNamoi Council Meeting4 of 11 March 2012 Ordinary Business PaperChairpersonPage 300 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.a5 OUTSTANDING ACTION LISTMOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains3/12 RESOLVEDThat the Namoi Councils Outstanding Action List be received and noted.6 FINANCIAL REPORTThe Executive Officer advised that the Namoi Councils Bank Account held a closingcredit balance of $76,742.66 as at 30 December 2011.7 INWARD CORRESPONDENCEITEM 7.1TONY WINDSOR MHR, FEDERAL MEMBER FOR NEW ENGLANDMOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains4/12 RESOLVEDITEM 7.2That the letter dated 15 December 2011 from Mr Tony Windsor MHR, Federal Memberfor New England in relation to thanking Namoi Councils for supporting his initiative tothe Federal Government to fund Bio-Regional Assessment of the cumulative impact ofcoal mining and coal seam gas exploration and extraction on water catchments bereceived and noted.MOTIONTHE HON DON PAGE MP NSW MINISTER FOR LOCAL GOVERNMENTMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains5/12 RESOLVED(i)(ii)That the letter dated 18 December 2012 from the NSW Minister for LocalGovernment, Hon Don Page MP, providing an explanation of the reasons it isconsidered appropriate that non-voter revenue from Local Government Electionsis forwarded to the State Consolidated Revenue Fund be received and noted;andThat the Namoi Councils Chairperson, Cr Col Murray, be requested to makerepresentations to the Minister for Local Government, the Hon Don Page MP,requesting that NSW Councils engaging the NSW Electoral Commission toconduct their 2012 Local Government Elections be provided with acomprehensive report transparently disclosing all election costs and that Councilsbe afforded the opportunity and responsibility of sending out failure to votepenalty notices and the retention of revenue recovered from penalty notices.Page 5 of 11Delegates ReportsNamoi Council Meeting5 of 11 March 2012 Ordinary Business PaperChairpersonPage 301 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aITEM 7.3URALLA SHIRE COUNCILMOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains6/12 RESOLVEDITEM 7.4That the application by Uralla Shire Council for membership of Namoi Councils beconsidered at the May 2012 Namoi Councils Board Meeting.MOTIONNSW ENVIRONMENTAL TRUSTMoved Cr Kevin Ferrier, Walcha/Cr Ian Lobsey, Liverpool Plains7/12 RESOLVEDThat the letter dated10 December 2011 from the NSW Environmental Trust providing aresponse to issues raised by Namoi Councils in relation to the Namoi – Towards aSustainable Future Project be received and noted.8 OUTWARD CORRESPONDENCEMOTIONMoved Cr Kevin Ferrier, Walcha/Cr Ian Lobsey, Liverpool Plains8/12 RESOLVED9 REPORTSThat Outward Correspondence Items 8.1 – Tony Windsor MHR, Federal Member forNew England, Item 8.2 – Sustaining Rural Communities, Item 8.3 – NSW LocalGovernment and Shires Associations, Item 8.4 – Australian Local GovernmentAssociation, Item 8.5 – Uralla Shire Council, Item 8.6 –Tamworth Regional Council,Item 8.7 – Gunnedah Shire Council, Item 8.8 – NSW Environmental Trust, Item 8.9 –NSW Environmental Trust and Item 8.10 – Peel Valley Water Users Association benoted.ITEM 9.1MINING SECTOR TRAINING FACILITY REFERENCE PANELMOTIONMoved Cr Kevin Ferrier, Walcha/Cr Ian Lobsey, Liverpool Plains9/12 RESOLVEDThat the Minutes of the Mining Sector Training Facility Reference Panel Meeting heldon 14 December 2011 be received and noted.Page 6 of 11Delegates ReportsNamoi Council Meeting6 of 11 March 2012 Ordinary Business PaperChairpersonPage 302 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aITEM 9.2 NAMOI COUNCILS STRATEGIC PLAN DESTINATION 2036MOTIONAMENDMENTSMoved Cr Kevin Ferrier, Walcha/Cr Ian Lobsey, Liverpool Plains10/12 RESOLVEDThat the Namoi Councils Strategic Plan be amended to include the Destination 2036Strategic Direction Initiatives 1a, 9c and 14b directly relating to regional organisationsof councils.10 NAMOI COUNCILS PROJECT REPORTSITEM 10.1 STRENGTHENING COMMUNITY BASINS PROJECT PROGRESSREPORTThe Namoi Catchment Management Authority General Manager, Bruce Brown, gave averbal report of progress achieved to date with the Strengthening Community BasinsProject.MOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains11/12 RESOLVEDThat the verbal report in respect of the Namoi Councils Strengthening CommunityBasins Project be received and noted.ITEM 10.2 NAMOI – TOWARDS A SUSTAINABLE FUTURE URBANSUSTAINABILITY PROJECT REPORTThe Namoi Councils’ Executive Officer gave verbal report of progress achieved to datewith the Namoi – Towards a Sustainable Future Urban Sustainability Project.MOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains12/12 RESOLVEDThat the verbal report in respect of the Namoi – Towards a Sustainable Future UrbanSustainability Project be received and noted.Page 7 of 11Delegates ReportsNamoi Council Meeting7 of 11 March 2012 Ordinary Business PaperChairpersonPage 303 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.a11 NAMOI COUNCILS COMMITTEE REPORTSITEM 11.1 WATER WORKING GROUP MEETING MINUTESMOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains13/12 RESOLVED(i) That the Minutes of the Namoi Water Working Group Meeting held on 8December 2011 be received and noted; and(ii)That Namoi Councils’ members be requested to contribute $7,000 to engageCalibre Water Management Consultants to prepare a Namoi Councils submissionto the NSW Office of Water and the Murray Darling Basin Authority on the DraftBasin Plan addressing the following tasks: Background and Literature Review Identification of key issues in the Draft Basin Plan for the Namoi Catchment Analysis of the options for improved efficiencies at Menindee Lakes Impact of Menindee Lakes improved efficiencies for Namoi Catchment Identification of Options and Recommendations for the Namoi CatchmentITEM 11.2 MINERALS & ENERGY WORKING GROUP MINUTESMOTIONMoved Cr Lester Kelly, Narrabri/Cr Ian Lobsey, Liverpool Plains14/12 RESOLVEDThat the Minutes of the Minerals & Energy Working Group Meeting held on 14December 2011 be received and noted.ITEM 11.3 GMAC MEETING REPORTITEM 11.3.1NAMOI COUNCILS WATER UTILITIES ALLIANCE PROPOSALThe Meeting considered a Report and Power Point Presentation from the ExecutiveOfficer in relation a proposal for the establishment of a Namoi Councils Regional WaterUtilities Alliance comprising of Namoi Councils members who manage and operate waterand sewerage services, works and facilities.MOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha15/12 RESOLVED(i)That the Board of Namoi Councils establish a Namoi Councils Water UtilitiesAlliance as from 1 July 2012 incorporating the Organisational Structure andaccompanying Governance Model outlined in the Power Point Presentation;Page 8 of 11Delegates ReportsNamoi Council Meeting8 of 11 March 2012 Ordinary Business PaperChairpersonPage 304 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.a(ii)(iii)That an Operating Budget for the first financial year of operation of the WaterUtilities Alliance be established at $100,000 and that membership contributionsbe based on the number of water connections of alliance members as aproportion of the first year Annual Operating Budget;That Alliance membership contributions for the 2012/2013 financial year be asfollows:ALLIANCE MEMBER WATER CONNECTIONS CONTRIBUTIONTamworth Regional Council 20,630 $62,045Gunnedah Shire Council 4,640 $13,955Narrabri Shire Council 4,380 $13,173Liverpool Plains Shire Council 2,690 $8,090Walcha Council 910 $2,737TOTAL 33,250 $100,000(iv)(v)That Contract of Employment of the Namoi Councils Executive Officer includeduties and functions relating to the management and coordination of the NamoiCouncils Water Utilities Alliance;That membership of Namoi Councils Water Utilities Alliance be restricted toNamoi Councils members who are Local Government Authorities and suchrestriction be included as a term of the Alliance Deed of Agreement.ITEM 11.3.2INTERNAL AUDITING SHARED APPROACHMOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha16/12 RESOLVEDThat the report from GMAC in relation to options for a shared approach to delivery ofan Internal Audit Function among Namoi Councils’ members be noted and no action betaken at this stage.Page 9 of 11Delegates ReportsNamoi Council Meeting9 of 11 March 2012 Ordinary Business PaperChairpersonPage 305 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aITEM 11.3.3 NAMOI CATCHMENT MANAGEMENT AUTHORITY –SPATIALLY INTERACTIVE CUMULATIVE RISK ASSESSMENTMOTIONTOOLMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha17/12 RESOLVEDThat the report in relation to progress to date with development of a cumulative impactand risk assessment tool for mining and coal seam gas resource development in theNamoi Catchment be received and noted.12 NAMOI COUNCILS MEDIA RELEASESMOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha18/12 RESOLVEDThat Namoi Councils Media Releases in relation to Coal Seam Gas Bio-RegionalAssessment and the Murray Darling Basin Plan be received and noted.13 REGIONAL MEDIA ISSUESMOTIONMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha19/12 RESOLVEDThat Namoi Councils Chairperson be requested to issue a Media Release in relation tothe Meeting with the Member for Tamworth, Kevin Anderson MP, and the issuesdiscussed.14 GENERAL BUSINESSITEM 14.1 NARRABRI SHIRE COUNCIL GENERAL MANAGER – MR PHILMOTIONMARSHALLMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha20/12 RESOLVEDThat Cr Col Murray be requested to extend the appreciation of Namoi Councils to MrPhil Marshall for the personal contribution made to the achievement of the objectives ofNamoi Councils and offer the Board’s best wishes on his new appointment in LocalGovernment.Page 10 of 11Delegates ReportsNamoi Council Meeting10 of 11 March 2012 Ordinary Business PaperChairpersonPage 306 of 555 of the March 2012 Ordinary Business Paper

Minutes Ordinary Meeting of Namoi Councils – 1 March 2012Attachment 8.4.aITEM 14.2 FORMER CHAIRPERSON, NAMOI CATCHMENT MANAGEMENTMOTIONAUTHORITY – MR JIM MCDONALDMoved Cr Ian Lobsey, Liverpool Plains/Cr Cr Kevin Ferrier, Walcha21/12 RESOLVEDThat the Cr Col Murray be requested to extend the appreciation of Namoi Councils toMr Jim McDonald, former Chairperson of the Namoi Catchment Management Authorityfor the valued personal contribution made to the achievement of the objectives ofNamoi Councils as a Board Member.15 DATE AND VENUE FOR NEXT BOARD MEETINGThursday 3 May 2012 at the Narrabri Shire Council Offices commencing at 10.30amClosure:There being no further business the Namoi Councils Meeting concluded at 1.30pm.Cr Col Murray, Namoi Councils, Chairperson1 March 2012- oOo -Page 11 of 11Delegates ReportsNamoi Council Meeting11 of 11 March 2012 Ordinary Business PaperChairpersonPage 307 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL9GENERAL MANAGER’SREPORT OF ITEMS TOBE CONSIDERED IN THECLOSED(PUBLIC EXCLUDED)MEETINGORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 308 of 555 of the March 2012 Ordinary Business Paper

Extract from Council’s Code of Meeting PracticeWhich parts of a meeting can be closed to the public?68. (1) A council, or a committee of the council of which all the members are councillors,may close to the public so much of its meeting herein after referred to as a “Closed(Public Excluded) Meeting”, as comprises:(a) the discussion of any matters listed in subclause (2), or(b) the receipt or discussion of any of the information so listed, or new issuesraised by Councillors which relate to matters and information listed insubclause (2).(2) The matters and information are the following:(a) personnel matters concerning particular individuals,(b) the personal hardship of any resident or ratepayer,(c) information that would, if disclosed, confer a commercial advantage on aperson with whom the council is conducting (or proposes to conduct)business,(d) commercial information of a confidential nature that would, if disclosed:(i) prejudice the commercial position of the person who supplied it, or(ii) confer a confidential advantage on a competitor of the council,(iii) reveal a trade secret,(e)(f)(g)information that would, if disclosed, prejudice the maintenance of the law,matters affecting the security of the council, councillors, council staff orcouncil property,advice concerning litigation, or advice that would otherwise be privilegedfrom production in legal proceedings on the ground of legal professionalprivilege.(3) A council, or a committee of the council of which all the members are councillors,may also close to the public so much of its meetings as comprises a motion to closeanother part of the meeting to the public.(4) A Council, or a Committee of a Council, may allow members of the public to makerepresentations to or at a meeting, before any part of the meeting is closed to thepublic, as to whether that part of the meeting should be closed.S10A(1)-(4)Page 309 of 555 of the March 2012 Ordinary Business Paper

GENERAL MANAGER’S REPORT OF ITEMS TO BENARRABRI SHIRE COUNCIL MARCH 2012 CONSIDERED IN THE CLOSED MEETING9 GENERAL MANAGER’S REPORT OFITEMS TO BE CONSIDERED IN THE CLOSED(PUBLIC EXCLUDED) MEETING9.1 ITEMS TO BE CONSIDERED IN THE CLOSED (PUBLIC EXCLUDED)MEETING OF COUNCIL (EL:EL) [GM]RECOMMENDATION: That the following matters be considered in the Closed (PublicExcluded) Meeting, the reason being that the matters and information are:Information that would, if disclosed, confer a commercial advantage on a person withwhom the council is conducting (or proposes to conduct) business;The commercial information of a confidential nature that would, if disclosed confer acommercial advantage on a competitor of the council.Thus in compliance with Section 10A(2)(c) and Section 10A(2)(d)(ii) of the Local GovernmentAct, 1993 Council is required to deal with this matter in Closed Committee because inaccordance with Section 10A(2)(c) and Section 10A(2)(d)(ii) the matters to be considered are :Sale of Council Owned Land;Voluntary Payment Agreements;Aeropelican.GENERAL MANAGER’S REPORT OF ITEMS TO BE CONSIDERED IN THE CLOSED (PUBLIC EXCLUDED) MEETINGOF COUNCIL PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD IN THE NARRABRISHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH 2012.GENERAL MANAGERMAYORPage 310 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL10OFFICER’S REPORTSORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 311 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10 OFFICER’S REPORTS10.1.1 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Resolution RegisterGeneral ManagerNilRECOMMENDATION: That the Council endorse and receive the Resolution Registerfor March 2012 and that the completed items marked ‘yellow’ be approved for deletion fromthe Resolution Register.IssuesProvide an updated Resolution Register to Council.Council will approve the deletion of items completed at each Council Meeting.BackgroundItems on the resolution register are resolutions that have been minuted at previous CouncilMeetings.Items remain on the resolution register until such time as the Council approves their deletion fromthe resolution register.Current SituationThe resolution register attached includes resolutions from the February 2012 Ordinary CouncilMeetingAttachmentsResolution Register – Attachment 10.1.1.a.Financial ImplicationsNilStatutory/Legal ImplicationsNilGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 312 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNilManagement Plan/Strategic PlanNilGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 313 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 2012133/2011 RESOLVED on the motion moved by Councillor Faber/Sevil that CouncilDATECOMPLETED15-Mar-11 133/20111. Determine the ownership of the Gwabegar Hall, whether the 355 Committee ofCouncil for its operation is appropriate, and assist the hall Committee to resolvetheir operational issues.2. Identify how the CWA facility, if restored on its current site, could provideadditional services and facilities to the community and meet objectives of theGwabegar Strategic Plan.GM DCS Onsite meeting of 2.2.2012 postponed due to floodingMeeting rescheduled for 9th March 2012 - subject to a reportback to the April 2012 meeting. CWA require (want) new roomsbut in reality the current community building is under utilised inevery way. Building of a skate park … is a key to the area. Useof school tennis courts needs to be negotiated.3. Council consider proposals, properly planned and costed for the alternatives toprovide the CWA with a facility, and make a decision, in time for inclusion in the2011/12 Management Plan.19-Apr-11 249/2011249/2011 RESOLVED on the motion moved by Councillor Lowder/Buckman that:1.The Council compulsorily acquire Lot 12 on an unregistered plan of subdivisionprepared by Ross Gleeson Surveying dated 20th October 2008 bearing theCouncil’s Subdivision Certificate dated 21st October 2008 number 16/09 and beingpart of the land comprised in Lot 1 DP 512890 and further to create easements setout hereunder affecting Lots 11 and 12 in the said unregistered plan for a toiletblock and community stall and further to make the necessary application to theMinister and/or the Governor for this purpose and that the land be classified ascommunity purposes.Number of item shown in the intention panel on the planIdentify of easement to be created and referred to in the plan Burdened lotBenefited lot1Easement to drain sewage 3 wide Easement for water supply 3 wide Easement forrepairs 0.70 wide and 1.00 wide Easement for overhang 0.70 wide and 1.00 wideLot 11 Lot 12 2. That any mines and minerals on the land associated with thecompulsory acquisition of Lot 12 on an unregistered plan of subdivision prepared byRoss Gleeson surveying dated 20 October 2008 bearing Council SubdivisionCertificate dated 21 October 2008 No. 16/09 and being part of the land comprisedin Lot 1 DP 512890 be reserved to the Crown.CORP DCS No change to previous advice. Compulsory acquisition underway.19-Jul-11 433/2011433/2011 RESOLVED on the motion moved by Councillor Redding/Buckman thatNarrabri Shire Council produce a 6-8 minute DVD showing a visual presentation ofschool and preschool facilities, Crossing Theatre, coffee shops, craft activities,boutique shops, modern shopping, sports activities, recreation, nightlife, housing,etc and types of jobs available for the partners of mine workers and that a referencegroup led by Cr Redding be set up to scope the project.CORP EDM Ill health of Narrator delaying progress Ill health of Narrator delaying progress, follow up occuring.19-Jul-11 434/2011434/2011 RESOLVED on the motion moved by Councillor Buckman/O’Regan thatCouncil engage Danieli Studios to produce a 6-8 minutes DVD and that Councilorder a 1000 copies to be distributed to for families of mine workers.CORP EDM Ill health of Narrator delaying progress Ill health of Narrator delaying progress16-Aug-11 522/2011522/2011 RESOLVED on the motion moved by Councillor O’Regan/Etheridge thata further report be presented to Council regarding the request to vary the existingSpecial Sale arrangement on a Monday or Friday to be held on a Thursday.ENGCFMStill awaiting some information from stakeholders.be prepared for April 2012 Council Meeting.Report toStill awaiting some information from stakeholders. Report to beprepared for April 2012 Council Meeting.16-Aug-11 523/201116-Aug-11 524/201120-Sep-11 559/201118-Oct-11 664/2011523/2011 RESOLVED on the motion moved by Councillor Redding/Kelly thatCouncil authorise the staff to report back with a 12 month financial overview of theSaleyards.524/2011 RESOLVED on the motion moved by Councillor Redding/Kelly thatCouncil prepare a Business Plan for the management of the Saleyards.559/2011 RESOLVED on the motion moved by Councillor Redding/Buckman thatthe Council develop a business plan for the Narrabri Aquatic Centre including theoverall management and maintenance of the centre to coincide with Councilreviewing Tenders received.664/2011 RESOLVED on the motion moved by Councillor Lowder/Sevil that theCouncil in accordance with Local Government Act Section 55 call for expression ofinterest for the Airport Services Contract.ENG CFM to be prepared for April 2012 Council Meeting.ENG CFM Quotes currently being sourced Quotes currently being sourcedENG CFM Continuation of business plan being preparedENG DES EOI mid February.DES engaged consultant in January 2012. Report to beprepared with tender report to Council.General Manager's ReportResolution RegisterLast Printed: 15/03/20121 of 10 March 2012 Ordinary Business PaperPage 314 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNO15-Nov-11 722/2011RESOLUTION DEPT OFFICER February 2012 March 2012722/2011 RESOLVED on the motion moved by Councillor Kelly/Lowder that theGeneral Manager prepare a Fleet Management policy for the February 2012committee meeting.CORP DCS Policy to April Council meeting.DATECOMPLETED15-Nov-11 744/2011744/2011 RESOLVED on the motion moved by Councillor Faber/Buckman thatCouncil staff be requested to prepare a case for the return of the NarrabriCommunity Health Building to the community for consideration in the New Year.CORP DCS In progress In progress15-Nov-11 757/2011757/2011 RESOLVED on the motion moved by Councillor Buckman/Bates thatCouncil include the following criteria in its Contributions & Donations Policy to assistin the preparation of a further report and an amended draft policy:• Earlier than April for advice of committees;• Determine operational validity;• Apply rates Annexures A and B to organisations receiving rates donation forconsistency;• Flat fee;• Identify categories – not for profit, charitable, sporting, religious, owner of land,etc.CORP DCS Review of Policy in progress Review of Policy in progress, Report to May Council meeting.769/2011 RESOLVED on the motion moved by Councillor Lowder/Buckman:1. That Council resolve to adopt the draft Use of Footpath Policy and place it onpublic exhibition for 28 days and invite comment from the general public.15-Nov-11 769/20112. That Council resolve to adopt the following fee schedule for use of footpathapplications:a. Footpath Dining - $120 administration fee plus $20 per chairb. Display of Goods - $95 administration fee plus $25 per linear metrec. Advertising Sign - $95 per signGM PDM Report being presented to February 2012 Council Meeting.Report being generated to April Council meeting. Council iswaiting on Chamber of Commerce comments on the Policy.3. That Council consult with the Chamber of Commerce during the exhibitionperiod to obtain their comments on the policy.15-Nov-11 773/201115-Nov-11 774/201115-Nov-11 775/20120-Dec-11 810/201120-Dec-11 829/201120-Dec-11 839/201120-Dec-11 840/201120-Dec-11 854/2011773/2011 RESOLVED on the motion moved by Councillor Bolton/Knox that Counciladvertise for public tenders for the kerbside collection and disposal of domesticwaste from 1st July 2012 for a period of five years with an option of a further fiveyears, and that Council submit a tender.774/2011 RESOLVED on the motion moved by Councillor Bolton/Knox that theCouncil advertise tenders for the kerbside collection of recyclable material from 1stJuly 2012 and that Council submit a tender.775/2011 RESOLVED on the motion moved by Councillor Clements/Bolton that theCouncil call tenders for processing of recyclable material within Narrabri Shire localgovernment area.810/2011 RESOLVED on the motion moved by Councillor Lowder/Redding that theNarrabri Shire Council receive Business Papers, Minutes and Agenda items for theNamoi Local Government Group.829/2011 RESOLVED on the motion moved by Councillor Kelly/Bates that theCouncil send the Draft Plan of Management and Draft Landscape Master Plan forcomment to the Section 355 Narrabri Lake Advisory Committee prior to beingsubmitted to Council for consideration.839/2011 RESOLVED on the motion moved by Councillor Lowder/Redding that theDepartment of Engineering Services bring back a report in relation to our protocolsthat are to be applied to flood affected roads on our main thoroughfares duringtimes of a flood event.840/2011 RESOLVED on the motion moved by Councillor Lowder/Redding that theDepartment of Engineering Services contact all the bus operators within theNarrabri Shire to establish the pickup/set down points on their routes currentlybeing used, and the Department of Engineering bring back a report on how we canaddress the safety issues at these points. The process to be undertaken during thefirst quarter of 2012.854/2011 RESOLVED on the motion moved by Councillor Faber/Kelly that Councilstaff review and prepare submissions to NSW 2021, the NSW Planning review andthe draft MDBA Plan.ENG DES Advertise by end of March 2012Tender documentation being prepared, report to Council April2012 to ensure continuing of service.ENG DES Advertise by end of March 2012 Tender documentation being preparedENG DES Advertise by end of March 2012 Tender documentation being preparedGM GM Letter sent 19.1.2012 Completed 13-Mar-12ENGCFMDraft Plan of Management and Draft Landscape Master Plan Comments from committee received by 2 March 2012.forwarded to Section 355 Committee. Meeting Thursday, 9th Committee meeting. Meeting to endorse changes scheduled 22February 2012March 2012.ENG RSM In progress. Consultation with RMS and other LGAsENG DES Send out letters mid February after school returns. Letter have not been sent. Draft is in progress.GM PDM Report to February Meeting Planning Submission sent 28.2.2012. 13-Mar-12General Manager's ReportResolution RegisterLast Printed: 15/03/20122 of 10 March 2012 Ordinary Business PaperPage 315 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 2012DATECOMPLETED20-Dec-11 884/2011884/2011 RESOLVED on the motion moved by Councillor Clements/Bolton thatCouncil approach the service clubs at Wee Waa to put together a quote onsupplying and fitting a roof to the gravesite of George Maddis on the KamilaroiHighway (Wee Waa Road) and to repair any current damage to the structureENGDESDiscussion scheduled with service clubs in Wee Waa.February 2012.Report to the April meeting of Council20-Dec-11 887/2011887/2011 RESOLVED on the motion moved by Councillor Clements/Lowder thatCouncil receive and note the report and endorse its content to be the basis of aformal project brief / terms of reference for the development of the Narrabri ShireMaster Plan to be reported to Council no later than the 20th March 2012 CouncilMeeting.891/2011 RESOLVED on the motion moved by Councillor Kelly/Buckman thatCouncil review the above procedures at the April 2012 Ordinary Meeting.897/2011 RESOLVED on the motion moved by Councillor Kelly/Redding that theCouncil pursue funding from NSW Royalties for Regions Program and the FederalRegional Infrastructure Fund if appropriate.907/2011 RESOLVED on the motion moved by Councillor Clements/Bolton thatCouncil upgrade 1.5km of the gravel section of SR 54 – Stoney Creek Road in2011/12 to the value of $75,000 with funding from the SR 28 – Binalong RoadRehabilitation project.916/2011 RESOLVED on the motion moved by Councillor Clements/Lowder thatCouncil refer a request for development of a policy framework for local 4WD accessat Glencoe Channel during times of flooding to the Local Traffic Committee forreport back to Council.GMEDMTerms of Reference being prepared - how the Narrabri ShireCouncil will become a regional growth centre20-Dec-11 891/201120-Dec-11 897/201120-Dec-11 907/201120-Dec-11 916/2011CORPDCSCORP GO In progressENG RSM Included in works program 11/12ENG DES Report to next Traffic Committee, March 2012NSW Royalties for Regions confirmed toSingleton/Mussellbrook, Regional Infrastructure Fund - NilIncluded in works program 11/12 - to be transferred to 12/13Management Plan.Report to Traffic Committee 6/3/12. Not a matter for TrafficCommittee. RSM investigating.13-Mar-1213-Mar-1220-Dec-11 918/2011918/2011 RESOLVED on the motion moved by Councillor Lowder/Knox that theCouncil endorse the expression of interest to lease the Wee Waa Swimming PoolKiosk by Mrs Helen Scaysbrook ($1.00 per week) for the 2011/12 season subject tothe receipt of completed documentation associated with the lease.ENG CFM Complete. 21.12.12919/2011 RESOLVED on the motion moved by Councillor Buckman/Clements:1. That Council note the community feedback received to date and authorise thepublic exhibition of the Draft Narrabri CBD Master Plan documentation, comprising:20-Dec-11 919/2011• Analysis Plan• Proposals Plan• Landscape and Palette of tree species, including planting sketches and a sketchconcept plan for Alfresco dining.• Sub-precinct Plan• This report to Council, which contains a useful summary of the Project History,Key Issues and Design Proposals to date for a period of six (6) weeks from 22December 2011 and that a report on the public exhibition outcomes concerning theCBD Master Plan proposals be provided to the 21st February 2012 CouncilMeeting.ENG CFM Public exhibition to be commenced in February 2012.Public exhibition ceases 8 March 2012. Report to be preparedfor April 2012 Council meeting.20-Dec-11 925/2011925/2011 RESOLVED on the motion moved by Councillor O’Regan/Bolton that infuture, all new and rehabilitated causeways incorporate a concrete slab design aswell as any pipe system necessary for drainage, and the only impediment to debrisbe a sight gauge denoting the depth of water.ENGRSMDetermining scope of work and include in 2012/13Management Plan.Design complete for Nundi Creek - SR720-Dec-11 927/2011927/2011 RESOLVED on the motion moved by Councillor Clements/Bolton thatCouncillors be provided with written advice and written policy on NSC’s competitiveneutrality policy and procedures in general and specifically relating to our resolutionto tender for mowing services. And that our legal requirements to have suchpolicies and procedures be detailed in writing to Councillors.ENG DES Report to April Council Meeting.20-Dec-11 928/2011928/2011 RESOLVED on the motion moved by Councillor Clements/O’Regan thatNarrabri Shire Council write to the NSW Premier through the Member for Barwon,with the assistance of Cr Clements, requesting a meeting with the Premier todiscuss payment by the NSW government of the legal costs of Mrs Ruth Downeyrelating to court actions taken initially by the RSPCA and then as appeals by RuthDowney. Further that Cr Clements work with the General Manager to prepare theletter.GM GM Letter sent.Premiers Dept, acknowledged the letter, awaiting futher advice,meeting was requested in letter.13-Mar-12General Manager's ReportResolution RegisterLast Printed: 15/03/20123 of 10 March 2012 Ordinary Business PaperPage 316 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 2012DATECOMPLETED21-Feb-12 003/20123/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that as amatter of urgent business, the Narrabri Shire Council request at the next generalmeeting the attendance of a representative of the EPA, Whitehaven Coal andBoggabri Coal to explain the water releases both uncontrolled and controlled ofwater outside the agreed conditions and that the EPA also explain their response tothis monitoring and their regulatory role.GMGMThis matter has been referred to the April Workshop. EPA notavailable in March.12.03.201221-Feb-12 004/201221-Feb-12 008/201221-Feb-12 009/201221-Feb-12 010/201221-Feb-12 012/201221-Feb-12 13/20124/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that theCouncil write to Namoi Councils to amend the Liverpool Plains and GunnedahBasin Minerals and Energy Working Group name to Namoi Councils Minerals andEnergy Working Group as originally posted.8/2012 RESOLVED on the motion moved by Cr Clements/Redding that Councilmake known publicly the available grants for flood affected small businesses andany non for profit organisations in the Shire and that the Council write to theMinister for Western NSW expressing disappointment that a Recovery Committeehas not been established in the Narrabri Shire.9/2012 RESOLVED on the motion moved by Councillor Faber/Redding that Councilstaff prepare a response to the Draft Plan for consideration by Council at the March2012 Council Meeting.10/2012 RESOLVED on the motion moved by Councillor Clements/Bates that theCouncil write to the chair of RDANI objecting that the Narrabri Airport Project wasnot referred to the next stage for funding in Round 2 and asking why there is nomember from the Western area on the board.12/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that theGeneral Manager prepare a plan on the NSW 2021 – A Plan to make NSW NumberOne be received and that the Council identify local and regional issues to be putforward to the DPC Regional Co-ordinators.13/2012 RESOLVED on the motion moved by Councillor / that the Council considerthe Draft Destination 2036 Action Plan and provide comment to the GeneralManager by the 7th February 2012 to meet the deadline for submissions by the15th February 2012.GM GM Letter to the MEWG 12.03.2012CORPGOInformation including website links placed on Council's website.Letter to Minister for Western NSW.21.02.2012GM GM No action on the MDRA 13-Mar-12GM GM Letter to RDANI 12.03.2012GM GM Letter to DPC Regional Co-ordinators 12.03.2012GM GM Letter dispatched. 13-Mar-12General Manager's ReportResolution RegisterLast Printed: 15/03/20124 of 10 March 2012 Ordinary Business PaperPage 317 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 201214/2012 RESOLVED on the motion moved by Councillor Knox/Etheridge thatNarrabri Shire Council (NSC) as detailed in Points 1 to 5 be forwarded to theDestination 2036 Implementation Steering Committee (ISC):1. What do you like about the Draft Action Plan?NSC supports all activities outlined in the Action Plan and will participate with coordinatingagencies to contribute to these actions. (FUNDED STRATEGIES)The following feedback is provided on the Key Activities:1a) NSC is a member of Namoi Councils and looks forward to 2036 utilising thecombined knowledge and expertise of the ROC.2a) NSC and Randwick Council have a sister city relationship for sharing ofresources.Formal relationship with Walgett Shire to provide Ranger services.DATECOMPLETED21-Feb-12 14/201221-Feb-12 16/201221-Feb-12 17/201221-Feb-12 018/20122b) NSC is willing to work with the co-ordinating agency to develop a program forpartnering and mentoring between Councils.2c) NSC is keen to develop flexible and responsive workforce through utilisation ofwork teams to increase flexibility in working arrangements.2. In what ways could the Action Plan be improved?Frequency and responsibility for providing progress reports on activities.Key Activities 10a and 14b, Local and Regional plans must be developed with dueregard to the Community Strategic Plans.3. Are there any other key activities you believe should be included under anyinitiatives?Nil.4. Do you have any suggestions regarding the proposed process for advancing theAction Plan?16/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that theMinister for Local Government give consideration to amending the LocalGovernment Act to allow formal meetings of Council to take place whereCouncillors cannot attend in disaster declared Shires to be conducted usingsuitable electronic media.17/2012 RESOLVED on the motion moved by Councillor O’Regan/Clements thatwe move at the “B” Division conference that the Shires Association call anemergency meeting when the Draft EP & A Act is finalised and that all Council’shave at least a three month scrutiny period before it is presented to the StateGovernor for approval.18/2012 RESOLVED on the motion moved by Councillor Sevil/Clements thatCouncil nominate the following Councillors to attend the 2012 “B” Division Meetingin Inverell along with the Mayor and General Manager:Cr SevilCr O’ReganCr ClementsAnd that Council delegates offer to host the 2013 B Division meeting in Narrabri.GM GM Letter to the Department of Local Government 13.03.2012GM GM Letter to the Department of Local Government 13.03.2012GM GM Letter to "B" Division 13.03.2012GM GM Letter to "B" Division 13.03.201221-Feb-12 20/201220/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that theCouncil allocate funds in the 2012/13 budget to cover the special levy for the ALGANational Advertising Campaign.CORP FSM Completed 12.03.2012General Manager's ReportResolution RegisterLast Printed: 15/03/20125 of 10 March 2012 Ordinary Business PaperPage 318 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 201222/2012 RESOLVED on the motion moved by Councillor Lowder/Etheridge:DATECOMPLETED21-Feb-12 22/20121. That Council approve development application 99/ 2012 in accordance withsection 80 of the Environmental Planning and Assessment Act 1979 subject toconditions of development consent.2. That the Council authorise the General Manager to apply conditions ofdevelopment consent to the notice of determination in accordance with section 80(1)(a) of the Environmental Planning and Assessment Act 1979.GM PDM Approved and Notice of Determination sent out 22.2.2012. 13-Mar-1221-Feb-12 25/201225/2012 RESOLVED on the motion moved by Councillor Clements/Lowder thatCouncil receive and note the report of the Code of Conduct committee and that theGeneral Manager arrange for Cr Bolton to meet with the appropriate people to runthrough the Code of Conduct, particularly the dealing with contractors.GMGM26/2012 RESOLVED on the motion moved by Councillor Bolton/Kelly that Counciladopt all draft policies as below and advertise as coming into effect in 14 days inconjunction with the Local Government Act, 1993:21-Feb-12 26/2012• Alcohol Free Public Spaces Policy• Asbestos Waste Disposal Policy• Backflow Prevention Policy• Building Over Council’s Underground Services Policy• Concrete Footpath Cost Recovery Commercial Premises Policy• Controlled Works On A Floodplain Policy• Laundry Stained By Rust In The Town Water Supply Policy• Maintenance Of Nature Strips In Urban Areas Policy• Narrabri Lawn Cemetery – Floral & Other Tributes Policy• Optic Fibre Installation On Council Land Policy• Public Space Tree Policy• Rural Property Access Policy• Saleyard Fees – Waiving Passed In Stock Fee• Sewer Junction Connection Policy• Undetected Water Leak Policy• Water Service Connection Policy• Water Meter Policy• Debt Recovery Policy• Financial And Medical Hardship Policy• Investment Policy• Pensioner Concession Policy• Property Addressing Policy• Purchasing Policy• Records Management Policy• Revenue – Water And Sewer Policy• Water Billing Policy• Domestic Animal Policy• Liquid Trade Waste Policy• Enforcement Policy• Township Amenity and Public Safety Policy• Local Approvals Policy• Provision of Rainwater Tanks Storage Policy• Waiving Application fees for Development Policy• New England North West Film Policy• Payment of Expenses and Provisions of Facilities to CouncillorsCORPDCSAdvertisements placed in local print media and on Councilwebsite.1.03.201227/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that theCouncil receive and note the report in relation to the NSW Local Government andShires Association Tourism Conference held in Gunnedah between 12th – 14thMarch 2012 and nominate the following Councillors to attend the Conference:21-Feb-12 27/2012Cr KnoxCr ReddingCr O’ReganCr Bates (Day1)GM GM Arrangements made for Delegates attendance 05.03.2012General Manager's ReportResolution RegisterLast Printed: 15/03/20126 of 10 March 2012 Ordinary Business PaperPage 319 of 555 of the March 2012 Ordinary Business Paper

DATE OFMEETINGRESOLUTIONNO21-Feb-12 28/201221-Feb-12 29/2012RESOLUTION REGISTERRESOLUTION DEPT OFFICER February 2012 March 201228/2012 RESOLVED on the motion moved by Councillor Bolton/Clements thatCouncil locate the Wee Waa Animal Temporary Holding Facility at the Wee WaaCouncil Depot.29/2012 RESOLVED on the motion moved by Councillor Bates/Bolton that underthe 2012/2013 Management Plan appropriate funds be allocated to the demolitionof the existing Wee Waa holding facility at the Wee Waa Sewerage TreatmentPlant (STP) including removal of asbestos waste.Attachment 10.1.1.aDATECOMPLETEDGM PDM Project underway. 13.03.2012CORP FSM completed 12.03.201221-Feb-12 30/201230/2012 RESOLVED on the motion moved by Councillor Bates/Lowder that Councilendorse the concept location being Lot 73 in DP 744475 known as 39 Finches LaneBoggabri subject to normal statutory development consent requirements.GM PDM Project commenced 21.2.201221-Feb-12 31/201231/2012 RESOLVED on the motion moved by Councillor Etheridge/Bates thatCouncil adopt the draft submission as proposed and forward to the Department ofPlanning for consideration under the New South Wales Planning System Review.GM PDM Submission completed 28.2.201221-Feb-12 32/201232/2012 RESOLVED on the motion moved by Councillor O’Regan/Bolton thatCouncil write to the Department seeking at least a three month scrutiny period inwhich to make comment before it is presented to the State Governor for approval.GM GM Letter sent 13.03.201221-Feb-12 33/201233/2012 RESOLVED on the motion moved by Councillor Bates/Lowder:1. That Council formally adopt the Policy (Sex Services and Restricted Premises)Development Control Plan following completion of the statutory advertisementperiod;2. That Council publically advertise the adoption of the policy in accordance withClause 21 of the Environmental Planning and Assessment Regulation 2000.GM PDM Policy advertised of its final adoption 22.2.2012 13.3.201221-Feb-12 34/201221-Feb-12 35/201234/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that Councilfollowing review of the submission from Mr Ryman, issue the final order undersection 121B of the Environmental Planning and Assessment Act 1979, thedemolition of the current main fire affected building due to amenity and safetyissues associated with the structure on Lot 11 DP. 758756, 28 Mooloobar Street,Narrabri.35/2012 RESOLVED on the motion moved by Councillor Lowder/Bolton that theCouncil endorse recommendations made as part of the review of the SwimmingPools Act 1992, and approve the submission to the Division of Local Government,as invited, in response to the Review discussion paper.GM PDMFinal order referred to LT Lawyers for advice. Final orderexpected to be issued 20.3.201213.3.2012GM PDM Swimming Pool Act Review Submission sent 22.2.2012 13.3.201221-Feb-12 36/201236/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that theCouncil resolve to forward the Planning Proposal (prepared by Mitchel HanlonConsulting Pty Ltd in relation to Lot 1 in Deposited Plan 915444 (29 Barwon Street,Narrabri) Lot 4 in Deposited Plan 918950 (2 Fitzroy Street Narrabri) and Lots 1Band 2B in Deposited Plan 338549 (25 and 27 Barwon Street Narrabri) to theMinister of Planning in accordance with Section 56 of the Environmental Planningand Assessment Act 1979 for a “Gateway Determination”.GMPDMPlanning proposal sent to the Department of Planning21.2.2012.13.3.201221-Feb-12 37/201221-Feb-12 39/201221-Feb-12 40/201221-Feb-12 45/201237/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly thatCouncil determine development application DA 179/2011 in accordance withSection 80(1) of the Environmental Planning and Assessment Act 1979 by way ofApproval – subject to the attached standard Conditions of Consent in schedule 1 ofthis report with the exception of Condition 18.39/2012 RESOLVED on the motion moved by Councillor Bolton/Redding thatCouncil not support the Cancer Council NSW current campaign that is calling onthe NSW Government to bring in smoke-free legislation covering particular publicoutdoor areas, including children’s playgrounds and outdoor dining areas.40/2012 RESOLVED on the motion moved by Councillor Etheridge/Clements thatCouncil participate in the 2012 Bush Bursary Scholarship Scheme.45/2012 RESOLVED on the motion moved by Councillor Etheridge/Bolton thatgiven the considerable contribution Council already makes to the event, Councilrequests that it be recognised as a Major Partner to Nosh on the Namoi.GM PDM Notice of Determination sent to applicant 21.2.2012 13.3.2012GM EDM completed 21.02.2012GM EDM To be included in Draft Budget 13.3.2012GM EDM Committee advised of Council's decision 13.03.2012General Manager's ReportResolution RegisterLast Printed: 15/03/20127 of 10 March 2012 Ordinary Business PaperPage 320 of 555 of the March 2012 Ordinary Business Paper

DATE OFMEETINGRESOLUTIONNO21-Feb-12 46/201221-Feb-12 47/2012RESOLUTION REGISTERRESOLUTION DEPT OFFICER February 2012 March 201246/2012 RESOLVED on the motion moved by Councillor Bolton/Bates that Councildeem the installation of new air conditioning units at 22 George Street, Wee Waarecently undertaken by the tenants, Narrabri & District Community Aid Services Inc,to be at the tenants’ expense.47/2012 RESOLVED on the motion moved by Councillor Etheridge/O’Regan thatthe paying out of Loans 143, 145, 148 and 150 be incorporated into the DecemberQuarterly Budget Review.DATECOMPLETEDCORP DCS completed 12.03.2012CORPAttachment 10.1.1.aFSMActioning of resolution held until Council Borrowing Strategyconfirmed.13-Mar-1221-Feb-12 49/201221-Feb-12 50/201221-Feb-12 51/201249/2012 RESOLVED on the motion moved by Councillor Bolton/Clements thatCouncil adopt an amended draft contract of sale, replacing d) “brick veneer” with“new building” and with the exception of i) and k); and the rewording of o) “no worksthat would affect the drainage of the lot and subdivision”.50/2012 RESOLVED on the motion moved by Councillor Bolton/ Etheridge thatCouncil authorise the Mayor and General Manager to sign and affix Council Seal, ifnecessary, to all documents pertaining to the sale of individual lots within Stage 1 ofthe Shannon Estate.51/2012 RESOLVED on the motion moved by Councillor Lowder/Sevil that theCouncil become a member of the Sustainable Choice Program by:• Accepting in writing the LGSAs invitation to join the program.• Integrating sustainable procurement principles into council’s current purchasingprocesses.GM GM Instrument amended 13.03.2012GM GM Subject to a report back to the Council 13.03.2012CORP DCS Completed 12.03.201221-Feb-12 52/201221-Feb-12 55/201252/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge thatthe Council support the Friends of The Crossing Theatre production of April Foolthrough promotion and advertising.55/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder thatCouncil note that Council’s Senior Finance Officer has advised that, followingstandard accounting procedures, losses on the following CDO’s have been broughtto account:ISN: AU300HCAP027 Scarborough $300,156.00ISN: AU300CSRJ039 Torquay $491,863.09ISN: AU300HCAP019 Esperance $45,402.69Total Losses $837,421.78CORP DCS completed 13.03.2012CORP FSM Completed 21.02.201221-Feb-12 59/201221-Feb-12 60/201221-Feb-12 61/201221-Feb-12 62/201259/2012 RESOLVED on the motion moved by Councillor Sevil/ Etheridge thatCouncil authorise the General Manager to sign the Rural Fire Fighting FundEstimates for the 2012/13 year.60/2012 RESOLVED on the motion moved by Councillor O’Regan/Clements thatthe General Manager together with the Director Corporate Services seek to meetwith Moree and Gwydir Councils to discuss funding for RFS and that this issue bereferred to the 2012 B Division Meeting.61/2012 RESOLVED on the motion moved by Councillor Sevil/Etheridge that theCouncil invite a representative of the Game Council of NSW to do a presentation atthe April Council meeting.62/2012 RESOLVED on the motion moved by Councillor Etheridge/Lowder thatCouncil approve the renaming of SR278 Eurimbla Lane to SR278 Camerons Lane,as well as renaming SR165 Panorama Lane to SR165 Wynella Road.CORP DCS Completed 09.03.2012CORPDCSLetter sent to Moree and Gwydir setting up meeting at BDivision13.03.2012GM GM Completed 13-Mar-12CORP GIS Formal consent/advertising process commenced.21-Feb-12 63/201221-Feb-12 65/201221-Feb-12 66/201263/2012 RESOLVED on the motion moved by Councillor Etheridge/ Lowder thatCouncil approve the proposal to assign names to six previously unnamed roads.65/2012 RESOLVED on the motion moved by Councillor Lowder/Redding thatCouncil endorse the literacy program “Filling the Cracks” which has receivedfunding from the Optus Regional Community Grants for 2011.66/2012 RESOLVED on the motion moved by Councillor Clements/Sevil:1. That the Grants Officer Report be received and noted2. That Council endorse applications to be madeCORP GIS Formal consent/advertising process commenced.CORP GO Completed 21.02.2012CORP GO Completed 21.02.201221-Feb-12 67/201267/2012 RESOLVED on the motion moved by Councillor Clements/Etheridge thatCouncil endorse applications to be submitted to the NSW Recreational FishingTrust and “Saluting Their Service”.CORP GO Completed 12.03.2012General Manager's ReportResolution RegisterLast Printed: 15/03/20128 of 10 March 2012 Ordinary Business PaperPage 321 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNORESOLUTION DEPT OFFICER February 2012 March 2012DATECOMPLETED21-Feb-12 68/201221-Feb-12 69/201221-Feb-12 70/201268/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox thatCouncil endorse the Wee Waa Lagoon Boat Ramp project and allocate matchingfunding of $15,500 in the 2012/2013 budget to complete the project.69/2012 RESOLVED on the motion moved by Councillor Etheridge/Knox thatCouncil endorse the application to be made to the NSW Recreational Fishing Trust,for a fully funded fishing platform at Wee Waa Lagoon.70/2012 RESOLVED on the motion moved by Councillor Sevil/Bolton that theCouncil rescind resolution 902/2011 which states:“902/2011 RESOLVED on the motion moved by Councillor Bolton/O’Regan thatCouncil authorise the General Manager to submit an Expression of Interest to hostthe 2014 ALGWA conference.”CORP GO Completed 21.2.2012CORP GO Completed 21.02.2012CORP EC Completed 13.03.201221-Feb-12 71/201271/2012 RESOLVED on the motion moved by Councillor Sevil/Knox that theCouncil adopt an unnamed (major) street in Shannon Estate as Queen Elizabeth IIAvenue.ENGDESNo unnamed major street in Shannon Estate. Only unnamedroad is cul-de-sac. Must be classified Court/Close.21-Feb-12 72/201272/2012 RESOLVED on the motion moved by Councillor Clements/Redding thatthe Council write to her Majesty Queen Elizabeth II advising that Council will benaming a prominent street in honour of her Diamond Jubilee and invite PrinceCharles to officially open the street during his visit in June 2012.GM GM Letter completed 02.03.201221-Feb-12 73/201273/2012 RESOLVED on the motion moved by Councillor Clements/Lowder thatCouncil receive and note the SR 11 – Harparary Road Upgrade report forinformation supporting the development of the 2012-2013 Management Plan.ENG RSM Completed 21.02.201221-Feb-12 74/201274/2012 RESOLVED on the motion moved by Councillor Bolton/Clements that theCouncil note the request from the Local Traffic Facilities Committee for a heavyvehicle parking area within the Industrial Subdivision off Yarrie Lake Road and thatCouncil staff investigate opportunities in the area for the establishment of.ENG DSM Report to be submitted to Council for April meeting.21-Feb-12 75/201221-Feb-12 76/201221-Feb-12 77/201275/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that theCouncil suspend the Alcohol Free Area between the Narrabri Creek and theCrossing Theatre, Narrabri, between the hours of 4:00PM Friday 30 March 2012 to12:00AM Sunday 1 April 2012 (Saturday midnight), for the ‘Nosh on the Namoi’ finefood and wine festival. The car park area will remain an Alcohol Free Zone.76/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that theCouncil waive the $100 lodgement fee of the ‘Request for Suspension of an AlcoholFree Area’ from ‘Nosh on the Namoi’ due to it being a non-profit event attractingtourism to Narrabri.77/2012 RESOLVED on the motion moved by Councillor O’Regan/Bolton that BDivision call on the Shires Ass. to circulate support for a public forum in Narrabriwithin 6 weeks of the meeting to allow time for landowners across NSW who areconcerned with the Coal Seam Gas industry, make brief documented statements,together with brief questions to be submitted to a panel of three including achairman, at least 7 days before the Forum date to answer concerns of land ownersof, their loss of freehold rights, the methods of coal seam gas extraction and theownership of the gas and of the coal, and that this motion and support be includedin the “B” Division’s business paper for distribution.ENG DSM Completed 01.03.2012ENG DSM Completed 01.03.2012GM GM Letter to B Division 13.03.201221-Feb-12 78/201278/2012 RESOLVED on the motion moved by Councillor Clements/Bolton thatNarrabri Shire Council write to the SES Controllers and congratulate the SESvolunteers and other services across the Shire for their efforts helping those inneed and protecting property during the flood and aiding in the clean up that followsthese events and that this letter be made public.ENGDES21-Feb-12 79/201279/2012 RESOLVED on the motion moved by Councillor Clements/Kelly that theNarrabri Local Disaster Plan be made available to the public and that NSC write tothe Peel District Emergency Management Committee and request that the NarrabriLocal Disaster Plan be reviewed immediately with significant input from theresidents of this shire; additionally, the Council to make it clear to the public that itwill hold a number of public forums with regard to recent flooding events and issuesarising from such.ENGDESGeneral Manager's ReportResolution RegisterLast Printed: 15/03/20129 of 10 March 2012 Ordinary Business PaperPage 322 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.1.aRESOLUTION REGISTERDATE OFMEETINGRESOLUTIONNO21-Feb-12 80/2012RESOLUTION DEPT OFFICER February 2012 March 201280/2012 RESOLVED on the motion moved by Councillor Clements/Kelly thatCouncil write to the Peel District Emergency Management Committee requestingthat they reassure the Council that the Narrabri Local Disaster Plan will not befinalized until the process detailed in the resolution has been completed and in theinterim and that a new trigger point has been determined for the imminent failure ofthe Wee Waa levee bank.ENGDESDATECOMPLETED21-Feb-12 81/201281/2012 RESOLVED on the motion moved by Councillor Clements/Lowder thatCouncil discuss with the Peel District Emergency Management Committee and theState Government establishment of Narrabri Shire Flood Recovery Committee.ENGDES21-Feb-12 82/201282/2012 RESOLVED on the motion moved by Councillor Clements/Bolton thatNarrabri Shire Council review the plans prepared by the late Mr Bob Christensenand Mr Jim Purcell in the light of the Stony Creek, Mulgate Creek, Horsearm Creekand Doctors Creek water that caused so much damage to business and privatepremises in the recent flood event particularly in the industrial area. And that weseek public input as part of that review.ENGDES21-Feb-12 83/201283/2012 RESOLVED on the motion moved by Councillor Clements/Bolton that theLate Professor Crawford Munro’s (and Sinclair Knights work) work for the NamoiValley Flood Investigation Trust be obtained and reviewed in the light of the StonyCreek, Mulgate Creek, Horsearm Creek and Doctors Creek water that caused somuch damage in the recent flood event particularly in the industrial area. And thatwe seek public input as part of that review.ENGDES21-Feb-12 84/201284/2012 RESOLVED on the motion moved by Councillor O’Regan/Bates that aclaim from a neighbour that water on Lot 6 Parish of Durrisdeer adjacent to ShireRd. 11 is being diverted by way of Headwall Banks on both sides of this public road,has resulted in a scouring of the gravel from the point where the Headwall meetsour SR 11 to a point some two or three kilometres West and South Westrespectively, be investigated by Council`s staff.ENG RSM RSM to investigate.21-Feb-12 87/201221-Feb-12 88/201221-Feb-12 89/201287/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly thatCouncil accept the offer on 9 Hillam Avenue Narrabri of Albaterra Super Fund.88/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly thatCouncil authorise the Mayor and General Manager to sign and seal all relevantdocumentation pertaining to the sale.89/2012 RESOLVED on the motion moved by Councillor Etheridge/Kelly that thenet proceeds of the sale to be placed in Council’s Staff Housing Reserve.CORP DCS Contracts exchanged. Settlement late March 2012 05.03.2012GM GM Contracts exchanged. Settlement late March 2012 05.03.2012CORP DCS Completed 05.03.201221-Feb-12 90/201290/2012 RESOLVED on the motion moved by Councillor Kelly/Lowder that theCouncil accept an ex-gratia payment of 50% of the road cost from IPS to satisfy therequirements of Development Application DA 82/1996 and DA 22/2009 for thebuilding of the road from Yarrie Lake Road to the railway crossing and that thefunds be allocated to the Community Infrastructure Reserve.ENGDESMeeting held with IPS. Awaiting proceeds of $350K to beplaced in Community Infrastructure Reserve.13.03.2012General Manager's ReportResolution RegisterLast Printed: 15/03/201210 of 10 March 2012 Ordinary Business PaperPage 323 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.2 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:“B” Division Meeting MotionsGeneral ManagerNil to this reportRECOMMENDATION: That the Council receive and note the update on the Council’s“B” Division Motions for inclusion on the “B” Division Meeting Agenda to be held in Inverellon Tuesday, 27 th March 2012.Issues Update Council on the Council’s “B” Division Motions for 2012.BackgroundAt the February 2012 Ordinary Council Meeting the Council resolved that motions be forwarded to“B” Division for inclusion on the Agenda for the 27 th March 2012 meeting.A copy of these motions and the supporting commentary is included as Attachment 10.1.2.a forthe information of Councillors.Current SituationThe motions have been forwarded to the Chair of “B” Division for inclusion on the Agenda at the27 th March 2012 meeting with the inclusion of supporting information.AttachmentsAttachment 10.1.2.a: Motions for 2012 “B” Division Meeting.Financial ImplicationsNil to this report.Statutory/Legal ImplicationsNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 324 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNil to this report.Management Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 325 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.2.a“B” Division motions1. “That the Minister for Local Government give consideration to amending the Local GovernmentAct to allow formal meetings of Council to take place where Councillors cannot attend in disasterdeclared Shires to be conducted using suitable electronic media.”SupportCouncil was unable to meet for 2 months due to floods preventing physical access for a quorum of Councillors.However, Council now utilizes iPads and could continue to conduct meetings in such situations where Councillorscould be identified via the camera facility on the iPad and can be connected via teleconference to conduct themeetings. This arrangement would only be enacted by the GM where an emergency has arisen impacting on regularmeetings and not designed to allow individual Councillors to abrogate their responsibility to attend regularmeetings.2. “That the Shires Association call an emergency meeting when the Draft EP & A Act is finalisedand that all Council’s have at least a three month scrutiny period in which to make commentbefore it is presented to the State Governor for approval.”SupportA new EP&A Act will have major ramifications for LG as the consent authority in most cases. Councils need morethan a token period to assess impacts of the new legislation and the Association should coordinate a whole of LGresponse based on consultation between the Association and its constituent members, being Councils. Threemonths would be a minimum time given that individual Councils need to assess and prepare their own responses tothe Association.3. “That B Division call on the Shires Ass. to circulate support for a public forum in Narrabri within 6weeks of this meeting to allow time for landowners across NSW who are concerned with the CoalSeam Gas industry, make brief documented statements, together with brief questions to be submittedto a panel of three including a chairman, at least 7 days before the Forum date to answer concernsof land owners of, their loss of freehold rights, the methods of coal seam gas extraction and theownership of the gas and of the coal, and that this motion and support be included in the “B”Division’s business paper for distribution.”SupportMuch of the public disquiet with CSG relates to the disparity over compensation for landholders impacted bydrilling as compared to landholders compensated for the impacts of mineral and coal mining. The concerns includeproperty rights, climate change regulation, native vegetation issues, water and food security and the underlyingconcern is what rights landholders have in relation to their land.A forum would enable the basic concerns to be addressed and a meeting memorandum produced to inform theAssociation of the views of ratepayers to underpin lobbying for change if required.“Points to Consider in the Forum`s Structure”(1) The “Forum” must be open to the public.General Manager's Report"B" Division Meeting Motions1 of 4 March 2012 Ordinary Business PaperPage 326 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.2.a(2) There be a “steering” committee to structure a “panel” similar to the state and federal Public Hearings heldin Narrabri.(3) That a “panel” be made up of at least three people.(4) That the panel make public their evaluations of the Forum to the media. (After close scrutiny of legalanswers)“A Guide To The Questions and Statements We Hope Will Prevail”Such as;(1) How can State Governments overrule the agricultural existing “use” rights on Rural 1a land and then,replace those agricultural rights with protective clauses to benefit multinational mining giants? (An LEPrequirement)(2) Can a government claim ownership of coal or coal seam gas if at the point of transfer from Crown Land toFreehold Land, those two commodities were not mentioned on the Deed Title as “reserved to the Crown?”(A constitutional requirement)(3) On what authority did the State Government use to overrule an owners right to refuse access onto his or herfreehold land. (A trespass requirement)These three questions are examples of what must be addressed. Water contamination, the Precautionary Principle,saline water re-injection back into aquifers are serious matters where the public have a right to be involved.We have no choice, we must all be custodians of the future.4. “That the Shires Association call on the Shires Association to request urgent review of theoperational systems used in flood emergencies, including the lack of natural disaster recovery planswith a view to more local input with disaster management.”SupportThe recent double flood situation in the northwest of the state and now in the southern areas has highlightedproblems associated with centralized management of flood event responses and decisions made hundreds of kmfrom the events which have left many locals shaking their heads. If the SES is to have sole control of responsesthen its systems must enable more local management and decision making. Whilst every town should have aNatural Disaster Recovery Plan, many either do not exist or are out of date. A full review should be conducted toensure that responses are adequate, comply with locally determined recovery plans and are properly resourced.5. “That the Shires Association express our strong concern for lack of consultation by the StateGovernment with Local Government regarding projects to be funded from the RegionalInfrastructure Fund directly as a result of their study of the economic assessment of mining affectedCouncils.”SupportThe State Government when in opposition promised to return a percentage of royalties from mining to those LGareas impacted by mining. Once elected they stated $160M would be returned over 4 years. There has been noconsultation with impacted Shires and no indication that grants under this promise would be solely made from theresults of a desk top study indicating Government income and spend on normal government services in these areas.The funding was always implied to be over and above normal funding. Whilst no one denies the need forinfrastructure funding in the Upper Hunter, the basis used to allocate funds this year would mean only those sameShires would ever receive funds because their contribution to royalty income far exceeds that from other LG areas.The whole process is flawed and LG needs to strongly protest its outcomes.General Manager's Report"B" Division Meeting Motions2 of 4 March 2012 Ordinary Business PaperPage 327 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.2.a6. “That the Shires Association call on the State Government to press the case for Federal Government“Betterment” funding under the Natural Disaster Recovery Program to upgrade continually floodaffected infrastructure to mitigate future flood damage in NSW.”SupportIn 2007 Natural Disaster Relief at Federal level was amended to include funding for 'betterment' (where additionalworks are done as part of flood damage repair to bring roads etc to a level where they will withstand futureflooding). Applications through the State Government for such funding must prove the case that the net cost vsperceived savings is net worth positive. No betterment funding has been approved since inception. Moree Plains,Gwydir and Narrabri Councils raised this matter with the Prime Minister in February, but it obviously rests with theNSW government to press the case. As a minimum there should be a case brought for all regional Shires in NSWfor causeway upgrades to culverts where such reconstruction will enable road access to continue for passage ofworkers, schoolchildren and produce in times of floods. Narrabri Shire has a number of locations where suchaccess is prevented for weeks at a time often due to quite small rises in creeks and run off areas. The funding isavailable, we need to press a case for it to be used in NSW.7. “That the Shires Association call on the Minister for Health, Jillian Skinner to progress the adoptionof a more user friendly system for reimbursement of travel costs for regional residents accessinghealth service in cities and major towns.”SupportAt the Country Mayors Assn meeting in November 2011 the Minister said she was investigating ways to make theprocess for isolated patients much simpler. presently for patients requiring regularly scheduled treatment in majorcentres, every visit requires all the paperwork, including signatures of referring and specialist doctors, to becompleted, even where it was all done for the previous visit. Surely one approval for a schedule of visits should beall that is needed with payments after the first visit subject only to proof of attendance. There is also no mechanismto reimburse costs where accommodation is not commercial, ie. if a friend allows you to rent a private flat for aweek at a cheap rent and the owner doesn't have an ABN then no reimbursement is made.The Association needs to call on the Minister for consultation on improving the system as a matter of urgency.8. “That the Shires Association call on the Health Minister to review funding availability for transport ofpatients for dialysis treatment or consider providing more regional capabilities with 100km of anypatient.”SupportAt Country Mayors Assn meeting in November 2011, the Minister said that the problem of costs to transportdialysis patients would be reviewed in her next round of planning for improvements in the NSW health system.Presently transport is not offered by ambulance, ambulance patient transport or HACC systems because of the costsand the long wait time. Options to increase locations offering supervised dialysis could reduce this need. InNarrabri, Walgett and Moree Plains Shires there Re waiting lists for treatment at Moree which is the only hospitalwithin 100km offering supervised dialysis. Many people have moved to live in Tamworth away from families toenable access to treatment. As the population ages the need for kidney treatments will only increase. On behalf ofour communities, LG needs to have discussions with the Minister about this issue.9. “That the Shires Association call on the Deputy Premier and Minister for Regional Development todevelop a strategy to provide more affordable housing, including community housing, in Shiresundergoing growth from resource developments.”SupportAt the Country Mayors Association meeting in November 2011 then acting Premier Andrew Stoner was questionedabout what his government is doing to address the issue of lack of affordable housing in regional areasexperiencing growth from government approved mining projects etc. His immediate response was the governmentlooked to the private sector to make investment. When advised that this gave no joy to the displaced and homelessbecause the private sector will invest in higher returning private housing for higher rents, he was. Of receptive buthis secretary did request further information.General Manager's Report"B" Division Meeting Motions3 of 4 March 2012 Ordinary Business PaperPage 328 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.2.aNamoi Councils and especially Narrabri and Gunnedah Shires have been working with providers of communityand affordable housing to assess the extent of the problem, and are in a position to provide supporting data to showthat government intervention is required. In Narrabri Shire all subsidies for community housing is fully expendedin Narrabri, homeless have moved to Wee Waa but there is no funding available for community housing in thattown. The problem is replicated right across NSW and needs urgent action.General Manager's Report"B" Division Meeting Motions4 of 4 March 2012 Ordinary Business PaperPage 329 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.3 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Narrabri Shire Section 94A Contribution PlanSchedule of Works (Allocation of Contributions)General ManagerNil to this reportRECOMMENDATION: That the Council confirm that Council resolution 779/2011 iscomplete as the matter was discussed at the 6 th March 2012 Workshop of the Council.Issues Council Resolution 779/2011:“779/2011 RESOLVED moved by Councillor Bates/Clements that Narrabri Shire Section94A Contributions Plan Schedule of Works be discussed to a committee meeting.”BackgroundThis resolution was addressed at the 6 th March Councillor Workshop with no changes to theSchedule of Works shown as Attachment 10.1.3.a.Current SituationThe Schedule of Works has been advised in the form shown in Appendix A and as the Council hasindicated no changes, then there is no reason to advertise further.To clarify a point for the Council, the funds received are held in a Reserve until the Councilchooses to put the funds towards a project under Council resolution.AttachmentsAttachment 10.1.3.a: Schedule of Works.Financial ImplicationsNil to this reportStatutory/Legal ImplicationsNil to this reportGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 330 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNil to this reportManagement Plan/Strategic PlanNil to this reportGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 331 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.3.aAttachment 27Appendix B; Capital Works SchedulerriorityLow fLlMedium (MlHieh (H)DescriptionCapital Works pr¡orit¡sed and expected to be needed f¡om7 - 10 yearsCapital Works prioritised and expected to be needed from 3 - 7 yearsCapital Works prioritised and expected to be needed from 1 - 3 yearsItem lnfrastructure Location Prioritv Estimate lSl57. Community Swimming Pool upgrades / Expansion H S3,ooo,oooFacilitiesUosrades58 CommunityFacilitiesUoeradesAirport Expansion / Renewal H 5i.,5oo,ooo1. Roads lntersection -Airport Road and Kaputar Road Nbri H $150,ooo2. Roads lntersection -Old Gunnedah Rd and Kaputar Rd Nbri H s200,0003. Roads lntersection - Old Gunnedah Road and Arnold St Nbri H s1s0,0oo6 Roads lntersection - Barwon and Dovle Street Nbri H S2oo,ooo7 Roads lntersection - Dansar St and Tibbereena Street Nbri H s600.000L2. Roads lntersection -Yarrie Lake Road and TSR (lPS, Canz) H Srso,ooo14. Roads lntersection - Old Turrawan Road and New England HS2oo,oooHighway15. Roads Old Turrawan Bridse Widenine and aooroach works H S2,ooo,oooH5242,s}o16. Footpaths Footpaths / Cycleway - Old Gunnedah Rd / Arnold toFitzrov St Nbri22 Footpaths Footpaths Dansar Tibereena to Gibbons St H Ss6,ooo35. Dangar street / Cooma Road Gibbons Street to Ugoa H s184,000Street Narrabri47. Cooma Road Mooloobar to Ueoa Street Narrabri H S28o,ooo42. CivicTibereena Street Dewhurst to Fitzroy Street Narrabri H S40o,ooolmorovements43 CivicTibereena Street Dewhurst to Killarney Narrabri H S4oo,ooolmprovements44. CivicMaitland Street Killarney to Dewhurst Street Narrabri H S6oo,ooolmprovements45 CiviclmprovementsMaitland Street Dewhurst to Fitzroy Street Narrabri H Sooo,ooo54 EnvironmentallmprovementsRoundabout Cooma Road, Kelvin Vickery Avenue andNewell Highway lntersection West NarrabriH s90,00059 Roads lntersection Wee Waa Street and Boston Road Bbri H S2oo,ooo60 Roads Railway Crossing approach Boston Street Rail crossing HS15o,oooBbri6T Footpaths Footpath and Cycleway - Boston Street / CarloolaHSEoo,oooRoad from Wee Waa Street to Boggabri quarry onCarloola Road Bbri56 CommunityFacÌlitiesNarrabri Lake Recreational Area M Szso,oooGeneral Manager's Report 1 of 3 November 201 I Business PaperNarrabri Shire Section 944 Contributions Plan Schedule of Works(Allocation of contributions)General Manager's ReportNarrabri Shire Section 94A Contributions Plan1 of 3 March 2012 Business PaperPage 332 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.3.aAttachment 27Uoerades5 Roads lntersection - Maitland St and Denison Street Nbri M s2oo,ooo8 Roads lntersection - Gibbons Street and Dangar Street Nbri M s600,00010 Roads lntersection - Mooloobar St Baranbar St Narrabri M $1so,oooLr Roads lntersection - Baranbar and Goobar St Narrabri M $150,oooL7 Footpaths Footpaths Fitzroy Maitland to Saunders Narrabri M $96,ooo18 Footpaths Footpaths Nandewar Fitzrov to Killarney M S28o,ooo19 Footpaths Footpaths Killarnev Nandewar to Tibereena M Sss,ooo2t Footoaths Footpaths Tibereena Killarney to Fitzroy St Nbri M S28o,ooo23. Footpaths Footpaths Gibbons Dangar to Elizabeth Nbri M S24o,ooo24 Footpaths Footpaths Elizabeth Gibbons to Narrabri Creek M S1o2,ooo25. Footpaths Footoaths Narrabri Creek Elizabeth St to Dansar St M S36o,ooo26 Footoaths Footpaths Wangi Place Gibbons to Narrabri Creek M sgo,ooo30 Footpaths Footpaths Guest Street Violet Street to Riverside M$25o,oooDrive Narrabri34 Footpaths Footpaths Gibbons Street Grace Street to DangarStreet NarrabriMS22o,oo036 Footpaths Usoa Street Danqar Street to Walowa St Narrabri M S232,ooo3t. Footpaths Walowa Street. Usoa to Mooloobar Street Narrabri s180,00038 Footpaths Usoa Street Walowa Street to Baranbar Street Nbri M sSo,ooo40. Footpaths Mooloobar Street Baranbar to Cooma Road Nbri M s240,ooo46. Civiclmprovements47. Civiclmorovements48. Civiclmorovements49 CiviclmprovementsLloyd Tibereena to Barwon Street Narrabri M 5250,000Doyle Tibereena to Barwon Street Narrabri M Szso,oooDewhurst Street Tibereena to Barwon M s250,000Bowen Street Tibereena to Barwan M s250,00050 Denison Street Tibereena to Barwan M Sloo,ooo51 Car oarkine Upgrades to Car parking Barwan Street M s35o,ooo52 Environmental Planting of trees - Cooma Road Mooloobar Street to MS175,ooolmþrovements Ueoa Street53. Environmental Planting ofTrees - Dangar Street Gibbons toMs15o,ooolmprovements Tibereena55 Environmental Roundabout Cooma Road and Mooloobar Street MSTo,ooolmprovements Narrabri62 Roads Road width extensions Carloola Road Bosgabri M S¡ee,ooo63 Footoaths Wee Waa Street Grantham Street to Boston Street Bbr M S260,ooo64 Footpaths Grantham, Wee Waa to Laidlaw Street Boggabri M sss,0006s. Footpaths Laidlaw Street Grantham to Boston Street Boggabri M s260,00066. Footoaths Boston Street Laidlaw to Wee Waa Street M S55,ooo67 CivicMerton Street Brent to Dalton Street M $1oo,ooolmprovements68 Footpaths Mitchell / Boolcarrol Road from Maitland Street toWarrior Street Wee WaaMS28o,ooo69 Footpaths Warrior Street Boolcarrol to Rose Street Wee Waa M ss2,00070 Footoaths Cowper Street from GeorgeStreet to Maitland Street M S27o,ooo7t. Footpaths Maitland Street from Rose Street to Mitchell Street M Sss,oooGeneral Manager's Report 2 of 3 November 201 1 Business PaperNarrabri Shire Section 94A Contributions Plan Schedule of Works(Allocation of contributions)General Manager's ReportNarrabri Shire Section 94A Contributions Plan2 of 3 March 2012 Business PaperPage 333 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.3.aAttachment 274. Roads lntersection - Maitland St and Fitzroy Street Nbri L s200,0009 Roads lntersection - Usoa and Cooma Roads Narrabri L s300,00013. Roads lntersection -Yarrie Lake Road and Rail Crossing L s200,ooo20. Footpaths Footpaths Barwan Killarney to Wee Waa RoadLs145,ooolntersection27. Footpaths Foot Bridge Western Narrabri Creek to Eastern Side of Ls35o,oooNarrabri Creek North East of Wangi Place.28. Footpaths Footpaths Narrabri Creek Dangar Street to VioletLs128,oooStreet Narrabri29 Footpaths Footpaths Narrabri Creek Violet Street to NarrabriL s292,000Creek near Arnold Street31 Footpaths Footpaths Riverside Drive Guest Street to McKenzie LSSo,oooStreet32. Footpaths Footpaths McKenzie Street Riverside Drive to Grace L$74,oooStreet Narrabri33. Footpaths Footpaths Grace Street Mckenzie Street to Gibbons L s70,000Street Narrabri39 Footpaths Baranbah Street, Ugoa Street to Mooloobar Street Nbr L s1s3,000General Manager's Report 3 of 3 November 201'1 Business PaperNarrabri Shire Section 94A Contributions Plan Schedule of Works(Allocation of contributions)General Manager's ReportNarrabri Shire Section 94A Contributions Plan3 of 3 March 2012 Business PaperPage 334 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.4 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:2012 National General Assembly of Local Government (NGA) – Callfor MotionsGeneral ManagerNil to this reportRECOMMENDATION:That the Council approve for the Mayor as a delegate to attend the National GeneralAssembly (NGA) on 17-20 June 2012 in Canberra.That the Council consider putting any motions to the National General Assembly(NGA) to be held 17 - 20 June 2012 using the Discussion Paper Criteria.IssuesAdvise Council of the upcoming 2012 NGA in Canberra.Gain Council’s approval for the Mayor to attend the NGA in Canberra.Seek Councillor motions for 2012 NGA. Council preparation of motions if required for NGA 2012.BackgroundThe 2012 NGA of Local Government will be held at the National Convention Centre in Canberrafrom between 17 – 20 June 2012.The National General Assembly of Local Government is convened by the Australian LocalGovernment Association (ALGA) for Local Councils across Australia to develop and express aunited voice on the core issues affecting Local Government and their communities.The Mayor has attended NGA on a yearly basis since 2009.Current SituationThis year’s discussions and debate at the Assembly will focus around the theme of “NationalVoice, Local Choice – Infrastructure, Planning, Services”.Councils are invited to submit motions for consideration at the Assembly with the release of thediscussion paper which is attached for the information of Councillors at Attachment 10.1.4.a.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 335 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTMotions must be submitted via the online form on the NGA website and received electronically by5pm on Friday, 27 th April 2012.The National General Assembly Committee will review all motions submitted as well as State andTerritory Local Government Associations to determine their eligibility for inclusion in NGABusiness Papers. When reviewing motions, the committee considers the importance and relevanceof the issue to local government. Motions should not be prescriptive in directing how the mattershould be pursued and any motion the committee deems to be primarily concerned with local orstate issues will be referred to the relevant local government association and will not be included inthe NGA Business Papers.To be eligible for inclusion in the National General Assembly Business Papers motions must:1. Fall under one of the three themes – Infrastructure, Planning, Services;2. Be relevant to the work of Local Government nationally; and3. Complement or build on the policy objectives of state or territory association.Motions covering similar matters will be grouped together in the NGA business Papers and thematter will be debated once with the lead or strategic motion being the motion that is debated.Motions that are carried by the National General Assembly become Resolutions which are thenconsidered by the ALGA Board when setting National Local Government Policy and will also feedinto the Australian Council of Local government processes.AttachmentsAttachment 10.1.4.a:2012 National General Assembly of Local Government Discussion PaperNational General Assembly of Local Government ProgramFinancial ImplicationsCosts to Council would be for the attendance of the Mayor at the Conference, travelling andaccommodation and would be taken out of Training Mayor/Councillor and TravellingMayor/Councillor budgets.The estimated costs are as follows:Airfares:$1250 (Narrabri to Sydney, Sydney to Canberra return)Accommodation: $1190Incidentals/meals etc: $ 150Total: $2590Statutory/Legal ImplicationsNil to this reportGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 336 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNil to this reportManagement Plan/Strategic PlanNil to this reportGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 337 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNGA2012National Uoice, Loeal ChoiceINFRASTRUCTURE . PLANNING . SERVICES7.7-2O tUNE 2O7.2NATIONAL CONVENTION CENTRE . CANBERRAôAUSTRALIAN LOCALGOVERNM ENT ASSOCIATIONGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for MotionsREGISTER ONLINE1 of 16 March 2012 Ordinary Business PaperPage 338 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNGA2012President's WelcomeThe National General Assembly of Local Government(NGA) is the premier local government event bringingtogether more than 700 mayors, councillors and senioroffi.cers from councils across Australia to develop localgovernment policy ideas, meet with key federalpoliticians and hear from renowned experts on the keyissues affecting local government in Australia.The theme for this year's NGA is Naúional Voíce, LocalChoice-Infrastructure, Planning, Services, and it isaimed at stimulating ideas about improving the way inwhich local government serves its communities and theway in which it works with other levels of government.The three elements of the theme allow for an explorationof the key priorities and challenges facing governmentsand local communities:. Infrastrucfure allows delegates to focus on the localand community infrastructure provided by localgovernment and seeks to develop innovative ideas forthe provision of this infrastructure now as well asinto the future;. Planning recognises the important role localgovernment plays in planning for local communities.It asks delegates to consider how best to provide thiscritical role and the impact it has on shaping thefuture of communities in Australia; and. Services refers to the wide range of services providedby local government and the need to ensure thedelivery of these services caters to the needs andopportunities in Australia's diverse communities.This year's program includes keynote speakersaddressing the three themes prior to distinct debatesessions on each theme.I have invited leading federal politicians including thePrime Minister, the Leader of the Opposition, theMinister for Regional Australia, Regional Developmentand Local Government, the Minister for Health, theShadow Minister for Regional Development, LocalGovernment and Water and the Leader of the Greens toaddress the NGA and look forward to hearing their viewson current policy and the future direction of our nation.Local government is involved in two major campaignsand the NGA will provide national updates on each. Thecampaign for constitutional reform continues to be astrategic priority for local government and we will hearabout the progress of the technical and political aspectsof the case for reform. We will also hear about thecampaign to renew the Roads to Recovery Program andthe next steps for local government in this campaign.The NGA is your opportunity to make sure that yourcouncil's view is reflected in the national prioritiesidentified for local government. I invite you to be part ofthis important event by joining your colleagues inCanberra from 17 -20 ltsne 2012.I look forward to seeing you in Canberra.PRESIDENT . ALGA{}|æ¡aÊæEe¿*æ23President's WelcomeProgramKey DatesTheme Ove¡view6ISpeaker ProñIesMotions for DebateVoting ProceduresRegional Cooperation andDevelopment Foruml011I2Associated Events-BreaKasts:ALGWA, ICLEINGA Regisrration DetailsSocial FunctionsPartners Programl3I4r5AccommodationCoach TlansfersCar ParkingRegistration FormGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for Motions2 of 16 March 2012 Ordinary Business PaperPage 339 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aProvisional Program20L217-2O IUNE 20r2SUNDAY t7 JUNETUESDAY I9 JUNE5.00-7.00 pm wELcoME DRTNKsMONDAY l8 JUNE9.00 am Opening Ceremony9.25 am AIGA President's Address9.45 am Prime Minister, the Hon fulia Gillard MP(invited)10.30am MoRNrNc rEA11.00 am Keynote Speaker (tbc)11.30 am National Local Government CampaignInsights72noon rHEME r ADDRESS: Infrastructure12.30 ptn LUNcH1.30 pm Infrastructure: Debate on Motions3.00 pm AFTERNooN rEA3.30 pm Commissioner for Taxation,Michael D'Ascenzo4.00 pm National Awards for Local Government5.00 pm Close7.00 pm DINNER8.30 am9.00 am9.30 qm10.30 am11.00 am11.30 am12.30 pm1.30 pm3.00 pm3.30 pm4.30 pm5.00 pm7.00 pmMinister for Regional Australia, RegionalDevelopment and Local Government,the Hon Simon Crean MPTHEME 2 ADDRESS: PIANNïNgPlønníng: Debate on MotionsMORNING TEALeader of the Greens, Senator Bob Brovyn(invited)Planníng: Debate on MotionsLUNCHConcurrent SessionsAFTERNOON TEANational Awards for Local GovernmentMinister for Health,the Hon Tanya Plibersek MP (invited)CloseD IN NERWEDNESDAY 20 JUNE9.00 am9.30 am10.30 am11.00 am11.30 am72 noon12.30 pm1.00 pmTHEME 3 ADDRESS: SCTViCCSServices: Debate on MotionsMORNING TEAShadow Minister for Local Government,Senator Barnaby foyceNational Campaigns Road MapLeader of Opposition,the Hon Tony Abbott MP (invited)President's Closing AddressCloseSubmßsionforMotions for DebateFRIDAY 27 APRIL 2OI2Early Bird Registrationon or beþreFRIDAY 27 APF'IL 2OI2Standard Registratíonon or beþreFRIDAY T JUNE 2OI2Late RegistrationafterFRTDAY I IUNE 2Or2General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions3 of 16 March 2012 Ordinary Business PaperPage 340 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNGA2012THEME OVERVIEWNational Uoíce, Local ChoíceINFRASTRUCTURE . PLANNING " SERVICESLocal government plays a significant role in the Australianeconomy. It is estimated that local government employs up tof 80,000 people across the nation; has more than $245 billionof physical assets (including 650,000 kilometres of local roadsworth more than $80 billion); and has a total nationalexpenditure of up to $28 billion per annum (or around 2 per centof Gross Domestic Product).Local government is a richly diverse level of government.Because of its unique position at the heart of Australia's localand regional communities, it is also a highly responsive,accountable and dynamic level of government.Some of local government's recent national achievements include:. developing and advocating a clear set of principles forconstitutional reform;. successful delivery of over 4000 community infrastructureprojects worth more than $ 1 billion on time and withinbudget âs part of the Australian Government's response to theGlobal Financial Crisis (GFC) to create jobs and economicstimulus throughout the nation;. campaign launch for the renewal and permanent adoption ofthe Roads to Recovery program (R2R); andAt the national level there is currently broad debate about theinternational economy and the likely impacts on our owneconomy. While the debate is focused mostly at the national andstate government level, local government faces similar questionsabout how to address disparity between councils and how tomeet the expectations from local communities that allAustralians should receive a similar and reasonable level ofinfrastructure and services. There is a strongly held view thatplanning at the local level should reflect local concerns but beintegrated with state and national planning to achieve the bestoutcome for local communities. People want to see the threeleveìs of government working together effectively and they wantto see the services and infrastructure they need planned for anddelivered at the local level.This year's NGA builds on previous assemblies and existingnational iocal government policy, by exploring the themeNational Voice, Local Choice-Infrastructure, Planning,Services.TNFA.ASTR[ICTT.JREWhat we as a nation choose to invest in, how we invest andwhere we invest will have profound impacts on localcommunities across Australia and will influence the lives ofAustralians for many years to come. Good quaiity infrastructurethat is well managed and well maintained is essential to ournational productivity including the social, cultural,environmental and economic life of every local community.Al1 infrastructure providers are faced with significant challengesto meet expectations within constrained budgets and anunderstandable unwillingness of communities to pay additionaltaxes and charges. Local government has proven itseifto bepractical and reliable in deiivering infrastructure projects for localcommunities. In recent times the Australian Government hasacknowledged this by providing grant programs such as theCommunity Infrastructure funding in the Economic StimulusPackage, and the highly successfut Roads to Recovery (R2R) programSome of the key elements of the Infrastructure theme examinedby the NGA will be local roads, the COAG Road Reform Plan, theNational Road Safety Strategy and how to manâge the impacts ofclimate change.hli,ÂNNãngüLocal government plays an important role in land use planning anddevelopment approvals systems in all state jurisdictions in AustraliaCouncils develop strategic plans for the future development of theirmunicipalities, coordinate and provide a range of physical andcommunity infrastructure, guide the application of land use anddevelopment zones through a planning instrument and administerthe local planning instrument on a day to day basis.. Actively pursuing internal reforms to improve the efficiency Constitutionally, planning is a state responsibility and as such thereand effectiveness of local government through improved asset is no single national planning and development system. Instead,management and structural reform, including amalgamations there exiits a .o-poiit" of state and territory systems and thuswhere appropriate'the 'experience' of the planning system by national developersor developers operating in more than one state varies from stateto state.As the'primary gateway'for those wishing to develop land,including the vast majority of occasional one-off builders ordevelopers, local government provides an essential service to thecommunity. The downside is that councils are held responsible forthe performance of all parts of the system, some of which are not intheir control, such as the responsiveness and requirements of stateplanning departments and referral agencies.The Federal Government has traditionally played a relatively passiverole in the area of land use and development planning. However,this has changed over the past few years as senior policy makershave increasingly identifled planning as a means of achieving anambitious agenda including housing affordability, competitionpolicy and economic stimulus. Whilst planning continues togenerate considerable interest at the local level, the community atlarge is passionate about the rights of the community to retain anactive role and involvement in the planning process. TheCommonwealth and many sections of industry and small businessremain committed to 'fast tracking' approval systems usually at thecost of limiting community and elected officials'involvement in theplanning process.Some of the key elements of the Planning theme examined by theNGA will be popuiation, regional development, natural disastersand emergency management.4General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions4 of 16 March 2012 Ordinary Business PaperPage 341 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.a*qHE{,VEÜHSLocal government is providing an increasing number ofservices to local communities. Councils have always providedroads, footpaths, drains, street trees, parks and gardens, locallibraries, and public swimming pools. In recent times howeverthey have responded to increasing community demands byproviding considerably more services and facilities. Localgovernment is now also a provider of early childhood services,kindergartens, immunization services, aged care, museums, artgalleries, community transport, animal management,communlty education, family counselling and communityhealth and food inspections. It is the authority thatpredominately determines the look, the feel and development ofour neighbourhoods and is usually the instigator of regionaleconomic development and tourism strategies.This explosion in the growth of services provided by localgovernment can be attributed to many reasons including:increasing community expectations, changing social norms,transfers of responsibiiity by other levels of government andimpacts of new technologies. However, the point remains thatregardless of how and why local government is now providingthis increasing range of services, councils are not adequatelyfunded or resourced to do this on a sustainable basis.Given these circumstances, councils need to consider a range ofstrategies to increase the efficiency and effectiveness of servicedeÌivery and develop more innovative means to finance thesediverse services.Some of the key elements of the Services theme examined bythe NGA will be broadband, cultural and multiculturaldevelopment and community services such as aged care.MAIORCAMPANATIONATIGNSCONSTITUTIONAL RECOGNITIONIn less than five years, considerable progress has been madetoward a referendum on the recognition of local government.ALGA and state and territory associations have developed acomprehensive constitutional reform campaign to be conductedover the coming years and have secured an undertaking fromthe Australian Government to hold a referendum by 201 3 onlocai government recognition in the Australian Constitution.The core of the ALGA campaign is that although theCommonwealth Government has provided direct funding tolocal government for many years, a recent High Court decisionhas highlighted its lack of power to do so. The 2009 High Courtcase of Pape v Commissioner of Taxation has found that theCommonwealth does not have power to directþ fund areassuch as local government. It can only spend money where ithas a specific power under the Constitution.Without constitutional recognition, direct Commonwealthfunding of local government, through programs such as Roadsto Recovery, may be technically invalid. Local governmentneeds certainty and security of funding in order to provide therange and level of services expected by the community.The Australian Government recently set up an Expert Panel toprovide advice on if, how and when the Government shouldproceed on a referendum on the constitutional recognition oflocal government. The Panel presented its report late last yearand favoured the option for financial recognition proposed byALGA. The Government is yet to respond to the report.A full report of progress on the campaign will be providedat the NGA.General Manager's Report2012 National General Assembly of Local GovernmentCall for MotionsR2R RENEWAL CAMPAIGNCouncils have an obligation to manage their local roads effectivelyand to continue to improve their asset management. However,improved asset management alone cannot meet the backlog infunding to address the issue. A study released by ALGA ln 2010into local road funding found expenditure on local roads has beenless than the life cycle cost for the past five years and that theshortfall in funding to simply maintain, rather than improveAustralia's local roads in the period from 20I0 to 2025, isestimated to be around $ 1.2 billion annually.Since 2000, the Federal Government has recognised that the needsof local roads are beyond the flnancial capacity of localgovernment and has provided supplementary funding undel theRoads to Recovery (R2R) program. Local governmentacknowledges and is grateful for the significant contribution thatthe R2R funding has made to improving local roads and theeconomic, social and community benefits the program hasachieved to date. It is difficult to imagine what the state of localroads would now be without the $3.5 billion provided so far.The R2R program is â true partnership between federal and localgovernment. Under the terms of the R2R program, localgovernment has complete management responsibility for thedelivery of the program without federal intervention.Councils have been passing a resolution calling for thecontinuation and lncrease of the R2R program and have beenwriting to the Prime Minister, Minister for Transport andInfrastructure and their local member about this.At the 2011 National Local Roads and Transport Congress, theLeader of the Nationals, the Hon Warren Truss, announced that aCoalition Government would extend and enhance the R2Rprogram beyond 2014.A full report on the progress of the constitutional recognition and5 of 16R2R renewal campaigns March will 2012 be Ordinary provided Business at the NGA. PaperPage 342 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aÅ]eå es å}s'q¡ [*sThe Hon fulia Gillard nrpPRIME MINISTERfulia Gillard was sworn in as the 27th Prime Minister ofAustralia on24lune 2010 and re-sworn in as Prime Ministeron 14 September 2010 following the 2010 Federal Election.From 1996 to 1998 Ms Gillard served as Chief-of-Staff to thethen Opposition Leader of the State of Victoria, |ohn Brumby.fulia Gillard first contested the Federal seat of Lalor for theAustralian Labor Party in 1998 and was elected that year.From 1998 to 2001 Ms Gillard served on the House ofRepresentatives Standing Committee on Employment,Education and Workplace Relations. In 2001 Ms Gillard wasappointed Shadow Minister for Population and Immigrationand subsequently took on responsibilities for Reconciliation andIndigenous Affairs in 2003.From 2003 to 2006 Ms Gillard served as Shadow Minister forHealth. On 4 December 2006 Ms Gillard was appointed DeputyLeader of the Australian Labor Party and served as ShadowMinister for Employment and Industrial Relations and SocialInclusion.Following the Australian Labor Party's victory at the 2007Federal Election, Ms Gillard was sworn in as Deputy PrimeMinister and Minister for Education, Employment andWorþlace Reiations and Social Inclusion.The Hon Tony Abbott upLEADER OF THE OPPOSITIONTony Abbott was elected Member for Warringah at aby-election in March 1994.On the election of the Howard Government in 1996 he wasappointed Parliamentary Secretary to the Minister forEmployment, Education, Training and Youth Affairs. In thisrole, he was responsible for the establishment of the successfulGreencorps program for young people.Following the 1998 election he was appointed to the newportfolio of Minister for Employment Services. As Minister,he oversaw the development of the ]ob Network and a majorexpansion of Work for the Dole.In fanuary 2001, Tony was promoted to Cabinet as Ministerfor Employment, Workplace Relations and Small Business.Following the 2001 election he was appointed Minister forEmployment and Workplace Relations, Leader of the House andMinister Assisting the Prime Minister for the Public Service.Tony was appointed Minister for Health and Ageing on7 October 2003.After the election in 2OO7 Tony became Shadow Minister forFamilies, Community Services, Indigenous Affairs and theVoluntary Sector, followed by Shadow Minister for Families,Housing, Community Services and Indigenous Affairs.Tony became Leader of the Opposition on I December 2009.The Hon Simon Crean n¡pMINISTER FOR REGIONAL AUSTRALIA,REGIONAL DEVELOPMENT AND LOCALGOVERNMENT, MINISTER FOR THE ARTSSimon Crean was elected Member for Hotham in 1990. He isthe only member of the Government who has served in fourCabinets-in the Governments of Bob Hawke, Paul Keating,Kevin Rudd and |ulia Gillard.Simon was born in Melbourne in 1949. He was educated atMelbourne High School and Monash University, and obtaineddegrees in Economics and Law.Prior to entering Parliament, Simon was President of theAustralian Council of Trade Unions (ACTU) from 1985 to 1 990,and a full-time trade union official with the Federated Storemenand Packers Union ofAustralia from 1970 to 1985.Simon has held a number of ministerial roles, including Ministerfor Science and Technology, Minister assisting the Treasurer,Minister for Primary Industries and Energy and Minister forEmployment, Education and Training.He was Leader of the Opposition between 2001 and 2003,Shadow Treasurer for the periods 1 998 to 200 t and 2003 to 2004,and Deputy Leader of the Opposition from I 998 untii 200 1 .Simon is the Minister for Regional Australia, RegionalDevelopment and Local Government as well as Ministerfor the Arts in the Giliard Labor Government.General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions6 of 16 March 2012 Ordinary Business PaperPage 343 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aThe Hon Thnya Plibersek upMINISTER FOR HEALTHTanya was elected to the Australian Parliament as the FederalMember for Sydney at the 1998 federal election.In her first speech to House of Representatives, Tanya spoke ofher strong interest in social justice and her conviction thatordinary people working together can achieve positive change.Tanya became a Shadow Minister after the 2004 federalelection and for the next three years was responsible for a rangeof portfolios including childcare, work and family, women,youth, human services and housing.Following the election of the Rudd Government in 2007, Tanyawas appointed Minister for Housing and Minister for the Statusof Women.As Minister for Housing, Tanya delivered a wide ranging reformagenda, including significant new investments in affordablerental housing.Tanya was also responsible for a Homelessness White Paperthat set out a comprehensive national strategy to tacklehomelessness in Australia.As Minister for the Status of .Women, Tanya was responsible fordevelopment of the National Plan to Reduce Violence AgainstWomen and their Children.Following the 2010 federal election Tanya was appointedMinister for Human Services and Minister for Social Inclusion.On l4 December 201 1 , Tanya was appointed to Ministerfor Health.Senator Barnaby foyceLEADER OF THE NATIONALS IN THE SENATE,SHADOW MINISTER FOR REGIONALDEVELOPMENT, LOCAL GOVERNMENTAND WATERBarnaby foyce is a champion for rural communities and smallbusiness and believes that representing the people is a privilege.As a rural banker and accountant he understands thechallenges of small business.Barnaby has strong belief in a duty to your nation andcommunity. He was a member of the Army Reserve anda long term member of St Vincent De Paul. He was awardeda Paul Harris Fellow by Rotary.In 1998, Barnaby became the Leader of the Nationals in theSenate. In late 2009 he became the Shadow Minister for Financeand Debt Reduction and in earþ 2010 became the ShadowMinister for Regional Development, Infrastructure and Water.Senator Bob BrownLEADER OF THE AUSTRALIAN GREENS,SENATOR FOR TASMANIASenator Brown was born and educated in rural NSW andworked as a doctor before becoming the face of the campaign tosave the Franklin River in 1982. He was elected to theTasmanian state parliament in 1982 and over his ten yeartenure notably achieved gun law reform, gay law reform andthe expansion of the Tasmanian World Heritage area. In 1996,Bob was elected to the Senate, where he has led the nationaldebate over the past 14 years on climate change, water,preventative healthcare, conservation, and human rights. Hiscurrent term expires in2014. He is a published author andacclaimed photographer.General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions7 of 16 March 2012 Ordinary Business PaperPage 344 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aMotíons fon ÐebateThe NGA is your opportunity to contribute to thedevelopment of national local government policy.The ALGA Board is calling for motions for the 2012NGA under the theme National Voice, LocalChoic e-Infr astructure, Planning, S erttices.To assist Councils in preparing motions, a DiscussionPaper has been prepared and is available atwvwv.alga.asn.auTo be elígible for inclusion in the NGA Business Papersmotions must follow the principles:1 FalI under one of the themes-lnfrastructure,Planning, Services;2 Be relevant to the work of local governmentnationally; and3 Complement or build on the policy obiectives of stateand territory asso ciations.Motions should be submitted electronicallyvia the online form on the websitewww.alga.asn.au and should be received byALGA no later then27 April2Ol2Motions submitted wilt be reviewed by a committee ofthe ALGA Board as well as by State and Territory LocalGovernment Associations to determine their eligibilityfor inclusion in the NGA Business Papers. Whenreviewing motions, the Committee considers theimportance and relevance of the issue to localgovernment. Please note that motions should not beprescriptive in directing how the matter should bepursued. Any motion deemed to be primarily concernedwith local or state issues will be referred to the relevantstate/territory local government association, and will notbe included in the Business Papers.To assist in facilitating efficient and effective debate,motions that cover similar matters will appear groupedtogether in the Business Papers and the matter will bedebated only once with the lead or strategic motion beingthat which is debated and passed.Motions that are agreed to at the National GeneralAssembly become Resolutions. These Resolutions arethen considered by the ALGA Board when settingnational local government policy and when the Board ismaking representations to the Federal Government atMinisterial Councils, during meetings and in ALGApublications. The ALGA Board is not bound by anyresolutions passed at the NGA.in the debating session. Councils willívill Ue. Voting cards can be collected at theof the name of the voting delegate priorGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for Motions8 of 16 March 2012 Ordinary Business PaperPage 345 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aREGIflNAT DEVËtflPMENT:AI}I}RËSSI I{ G I} IVËRSË C}IALtËNG ËSflR PLACE.BASËI} APPRflACHËSSUNDAY t7 JUNE 2Ot2NATIONAL CONVENTION CENTRE CANBERRAIncludes the launch of the 2012-13State of the Regíons P'r,PortA'patchwork economy', tightening fiscal budgets, darkclouds in the United States of America and Europe, andongoing climate change concerns. These are just some ofthe current challenges facing Australia's diverse regionaleconomies. What are the projected impacts going tomean for specific regions? What role can local councilsplay in addressing the subsequent challenges andopportunities that may arise? Could Governmentsaddress regional disparity through place based policies?The Giltard Government continues to recognise the valueof Australia's regions. Regional development policycontinues to enjoy a greeter emphasis and prominence inthe national political agenda. The Forum will allow thesharing of ideas and opportunities through both a mix ofacademic and practitioner insights, as well as hearing thelatest positions from relevant Commonwealth politiciansand senior officials.The Regional Cooperation and Development Forum willcontinue to build on examining the regional developmentopportunities and challenges in Australia through theIens of regional typologies-core metro, dispersed metro,producer, resource, rural and lifestyle.Prwisíonal ProgramSUNDAY T? JUNE 20IT . NATIONAL CONVENTION CENTRE, CANBERRA9.30 am Welcome: ALGA President,Cr Genia McCaffery9.35 am Minister for Regional Development,the Hon Simon Crean MP (invited)10.05 am Regional Development: Place basedapproaches10.35am MoRNINc rEA11.00 pm State of the Regions Launch: AddressingDiverse Challenges72 noon Regional Development AustraliaRepresentative12.30 pm LUNcH1.30 pm IANEL Dlscus sIoN Regional Performance:Tþologies under the SPot Light3:00pm AFTERNooN TEA3:30 pm Opposition sPokesPerson4.00 pm Questions and wraP-uP4:30pm cLosERegional Forum Registration is $395 (INCL GSr)or $195 when you also register to attend theNational General AssemblY.For more information or to register for theRegional Cooperation and Development Forum,go to wvuwalga.asn.auGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for Motions9 of 16 March 2012 Ordinary Business PaperPage 346 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aAssociated EventsBneqkfastsmpargnAustralian Local GovernmentWomen's Association IncMONDAY r8 JUNE .7.3O-8.30 AMN atíonal Conv ention Centre, Canb erraFollowing the overwhelming success of theALGWA 60th anniversary celebrations in 2011,the ALGWA National President Darriea TÌrley,invites you to breakfast this year as part of theNational General Assembly.Members, friends and colleges will be warmlywelcomed. Seating is limited, so please book early.Register your interest at www.algwa.net.duICLEI Oceania Briefing BreakfastTaking up the sustainability challengeMONDAY r8 JUNE . 7.15-8.30 AMNatíonal Corwention Centre, CanberraICTEI- Local Governments for Sustainability has playedan integral role in supporting and advocating the role oflocal government in addressing sustainability.The Ttiennial ICLEI World Congress opens in BeloHorizonte, Brazil on 18 ]une prior to the UN Conferenceon Sustainable Development (Rio+20) in Rio de |anerio.Cross live to BeIo Horizonte and experience some of theatmosphere and hear from delegates attending the WorldCongress as they share their stories for a moresustainable future.The ICLEI Oceania Briefing Breakfast offers delegatesthe opportunity to be informed on the work of ICLEIover the past 12 months and plans for the future.The breakfast is at 7.15-8.30 am on 18 ]une andwill be in the Swan/Torrens Room at the NationalConvention Centre.For updates or more information please check ourwebsite at: www.icleí.org/índex.php?íd =o ceanía- ert entsor email events-oceania@iclei.org or phoneMartin Brennan at ICLEI Oceania on 03 9639 8688General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions10 of 16 March 2012 Ordinary Business PaperPage 347 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNational General Assembly Registration DetailsGENERAL ASSEMBLY REGISTRATION FEES ACCOMPANYING PARTNERSREGISTRATION FEESREGISTRATION FEES - EARLY BIRD $88O.OOPayment received by Friday 27 April 2012REGISTRATION FEES - STANDARDPayment received on or beþre Friday 1 lune 2012REGISTRATION FEES - LATEPaymentreceived after Friday 1 lune 2012General Assembly Regístratíon Includes. Attendance at all General Assembly sessions. Morning tea, lunch and afternoon tea as per theGeneral Assembly program. One ticket to the Welcome Drinks, Sunday. General Assembly satchel and materialsDAY REGISTRATION FEESMOND.AY l8 JUNE 2012TUESDAY 19 JUNE 2012WEDNESDAY 20 JUNE 20r2$99O.OO$1,I5O.OOD ay Re gistr atí on In clu d e s. Attendance at all General Assembly sessions on theday of registration. Morning tea, lunch and afternoon tea as per theGeneral Assembly program on that day. General Assembly satchel and materialsREGIONAL DEVELOPMENT FORUMSUNDAY r7 JUNE 2Ot2FORUM ONLYNGA DELEGATE$470.00$470.00$ 25 5.00$ 395.00$ 195.OOGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for MotionsPARTNERS REGISTRATION FEE $ 255.00Accomp anying Partners Regístration Includes. I ticket to the Welcome Reception, Sunday 17 |une. DAy roun The Parliamentary Triangle Attractions,Monday 18 ]une. D Ay r o u n The Delights of the Canberra DistrictVillages and Wineries, Tuesday 19 |une. Lunch with General Assembly Delegates onWednesday 20 iunePayment ProceduresPâyment can be made by:. Credit card: MasterCard, Visa and American Express. Cheque made payable to ALGA. Electronic Funds Transfer: BANK Commonwealth, rneNcr Curtinsss No 062905, AccouNr uo 1 0097760. Note: If paying via EFTyou must quote your transaction reference number on theregistration form.Completed registration forms should returned to:Conference Co-ordinators Pty Ltd, PO Box 139, Calwell ACT 2905Facsimile (02) 6292 9002 Phone (02) 6292 9OOOEmail conference@confco.com. auCancellaticn PolicyAll alterations or cancellations to your registration must be made inwriting and will be acknowledged by post, facsimile or email.Notiflcation should be sent to:Conference Co-ordinators Pty Ltd, PO Box 139, Calwell ACT 2905Facsimile (02) 6292 9002 Email conference@confco.com.auAn administration charge of $110.00 will be made to anyparticipant cancelling before Friday 27 Aprrl 2012. Cancellationsreceived after Friday 27 ApriI2072 will be required to pay fullregistration fees. However, if you are unable to attend, substitutesare welcome at no additional cost.By submitting your registration you âgree to the terms of thecancellation policy.Privacy DisclosureALGA collects your personal contact information in its role as apeak body for local government. ALGA may disclose your personalcontact information to the sponsors of the event for the purposesof commercial business opportunities. If you consent to ALGAusing and disclosing your personal contact information in this way,please tick the appropriate box on the registration form.Importantly, your name may also be included in the GeneralAssembly List of Participants. You must tick the appropriate box onthe registration form if you wish your name to appear in this list.11 of 16 March 2012 Ordinary Business PaperPage 348 of 555 of the March 2012 Ordinary Business Paper1t

Attachment 10.1.4.aNGA2012Social FunctionsWELCOMË RECEPTIONAND EXHIBITION OPENINGSunday L7 lrne 2OI2National Convention CentrerrME 5:00-7:00 pmcosr $44.00 per person for day delegates and guests.No charge for full registered delegates.No charge for registered accompanying partnersDRESS Smart casualBUFFET DINNERMonday 18 |une 2012The Ballroom, National Convention CentrerrME 7:00-11:00 pmcosr $95.00 per personDRESS Smart casualCoaches will depart Assembly hotels (Except CrownePIaza) at approximately 6:45 pm with return shuttlescommencing from 10:15 pm.GENERAL ASSEMBLY DINNERTuesday l9ll.ne20l2The Great Hall, Parliament HouserrME 7:00-11:00 pmcosr $125 per personD R E s s Lounge suit/collar and tie for men andcocktail style for womenTickets to the prestigious General Assembly AnnualDinner at Parliament House are always highly soughtafter. Due to the size of the Great Hall places are limitedand therefore booking earþ is highly recommended toensure your place.Coaches will depart all Assembly hotels at approximately6:45 pm with return shuttles commencing from 10:30 pm.Note: Bookings are accepted in order of receipt.AccompanyingPartners ProgramlVlonday l8 |une ?ALzTHE PARLIAMENTARY TRIANGLEATTRACTIONSDepart from the front of the Crowne Plaza Hotelat 10.00 am.Today we will visit two of the Parliamentary Triangle'siconic national institutions both of which haveimpressive new displays and exhibitions. Starting at theNational Library of Australia's new 'Treasures'permanent exhibition that features some of Australia'smost historic documents and artifacts; Captain Cook'sEndeavour's journal, pages from botanist foseph Banks,Patrick White's glasses to name a few of the remarkableitems on display.Following lunch we will discover the newest galleryat the National Museum of Australia featuring someof the most historic pieces of Australian history. ViewSir Robert Menzies' Bentley, Phar Lap's heart and muchmore before returning to the Crowne Plaza at 3.30 pm.Tuesday 19 |une zOLzTHE DELIGHTS OF THE CANBERRADISTRICT VILLAGES AND WINERIESCoaches leave the front of the Crowne Plaza Hotelat I0.00 am.The first stop will be Cockington Green. This miniatureEnglish village now features a large display ofinternational buildings, many built and donated byEmbassies represented in the National Capital. Strollaround the beautifully manicured gardens and marvel atthe craftsmanship of this quaint little village set amongstan array of magnificent trees and flower beds.We will then travel to Murrumbateman, the heart of theCanberra District Wine industry where we will enjoy arelaxing lunch and visit to one of the region's wineries.We will then take a leisurely coach ride back to CrownePlaza hotel, passing many of Canberra's burgeoning newsuburbs to the north of the National Capital.t2General Manager's Report2012 National General Assembly of Local GovernmentCall for Motions12 of 16 March 2012 Ordinary Business PaperPage 349 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aì- cANBERRA\üEATHERIN JUNEWinter days in Canberra are characterised by clearsunny skies but the days are cool at around 12-i5'Cand temperatures do drop to I " C on average in theevenings, so be sure to bring a warm jacket. Morningscan be foggy so keep this in mind when booking flights.It is best to avoid earþ arrivals or departures in case ofdelays due to fog.VENUE AND ÐRESS CODEEXHIBITION OPENINGAND WELCOME RECEPTIONv E N u E National Convention Centre, Constitution Ave,Canberra CityDRESS Smart casualGENERAL ASSEMBLYBUSINESS SESSIONSvENUE National Convention Centre, Constitution Ave,Canberra CityAll plenary sessions will be held in the RoyalTheatre at the National Convention CentreDRESS Smart casualExhibítion:vENUE National Convention Centre, Constitution Ave,Canberra CityThe exhibition is being held in the ExhibitionHall of the National Convention Centre.DRESS Smart casualBUFFET DINNERvENUE The dinner is being held in the Ballroom at theNational Convention Centre.DRESS Smart casualGENERAL ASSEMBLY DINNERvENUE Parliament HouseThe General Assembly Dinner is being held inthe Great Hall.D R E s s Lounge suit/collar and tie for men and cocktailstyle for womenAccommodationTo book your accommodation at the rates listed belowcomplete the appropriate section of the registration form.Bookings are subject to availabilìty and should be madepríor to Friday 75 lune 2012.All cancellations or amendments must be made inwriting to Conference Co-ordinators and will beacknowledged by facsimile.Please note your credit card details are required toguarantee your room. Neither Conference Co-ordinatorsnor the hotel will make any charges against your creditcard unless you fail to give 2l days notice in writing ofyour cancellation. Full payment of your account will berequired at the time of your departure.CROWNE PLAZA7 Binara Street, CanberraRenovated in 2007 the Crowne Plaza is adjacent to the ConventionCentre and only a short walk from restaurants, bars and the mainshopping district. Featuring a contemporary design, the CrownePlaza provides guests with an outdoor pool, sauna, health/fitnesscentre, 24-hour reception, Concierge, undercover parking andonsite dining at the RedSalt Restaurant. All rooms are non-smokingand include iron/ironing board, tealcoffee making facilities,hairdryer and Room Service is available.Superior King Room: $290 per night single/twin/doubleDeluxe KingRoom: $340 per night single/twin/doubleCLIFTON SUITES700 Northbourne AvenueQuality Clifton Suites is approximately a 30 minute walk from theConvention Centre and is located on Northbourne Avenue. Theproperty and has an onsite pool, gymnasium and restaurant. Allthe rooms have reverse cycle heating and air conditioning, fullyequipped kitchen, movies on demand, washing machine, dryer anda private balcony.7 bedroom apartment $240 per night single/twin/doubleDIAMANT15 Edinburgh Place, CanberraOpened in ]une 2008 this boutique B0 room hotel is located at theintersection of Marcus Clarke and Edinburgh Ave, 15-20 minutewalk from the Convention Centre. The Diamant Hotel features24-hour reception, a restaurant and a bar. The rooms have a minibar, tealcoffee making facilities, plasma TVs CD and DVD players,broadband (for a fee), and in-room safe.Standard Room: $255 per night single/twin/doubleHOTEL REALM78 Natíonal Circuit, BartonCanberra's newest S-star hotel and is located walking distance fromthe popular shopping and restaurant villages of Kingston andManuka. The Hotel Realm has two restaurants and a bar, and a DaySpa, Hairdresser and Health CIub are located on-site. The rooms aremodern and have king sized bed, high speed internet (for a fee)LCD TV, pay movie channel, Foxtel and 24-}lout room service.Standard Room: $255 per night single/twin/doubleGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for Motions13 of 16 March 2012 Ordinary Business PaperPage 350 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNGA20r2MANTRA ON NORTHBOURNE84 Northbourne Avenue, CanberraMantra on Northbourne (formerþ the Saville) offers stylishaccommodation centrally located approximately a ten minute walkfrom the National Convention Centre. The hotel features a heatedindoor pool, sauna, fully-equipped gymnasium and the Zipprestaurânt bar onsite. All rooms offer voice mail, individuallycontrolled air-conditioning, pay per view movies, mini bar,mplimentary toiletries.a separâte lounge andndry with washingCoach TransfersWELCOME RECEPTION AND EXHIBITIONoPENTNG SUNDAY l7 JUNE 2Ot2Coaches will collect delegates from all General Assemblyhotels (except Crowne Plaza Canberra) at approximately4:45 pm. The return coâches will depart at 7:00 pm.Hotel Room: $209 per night single/twin/doubleI bedroom apartmenti $249 per night single/twin/doubleMEDTNA EXECUTTVE IAMES COURT74 Northbourne Avenue, CanberraThe Medina Executive fames Court is approximately a sevenminute walk from the National Convention Centre and is close tocafes, restaurants, gyms and shopping. The hotel offers reception,undercover parking, outdoor heated swimming pool, sauna,gymnasium and a restaurant delivery service. All rooms featureprivate balconies, climate controlled air conditioning, separatelounge/dining areas, broadband access (for a fee), spa bath, minibar, fully equipped kitchen facilities and an in-room safe.Note: Reception operâtes between the horus of 6.30 am ald I I.30 pm.1 bedroom apartmenti $ 190 per night single/twin/double2 bedroom dpartment: $240 per night single/twin/doubleNOVOTEL65 Northbourne Ayenue, CanberraLocated on Northbourne Avenue, one of Canberra's mainthoroughfares, the Novotel is a 10- I 5 minute walk from theNational Convention Centre. The hotel offers 24-hovr reception androom service, an onsite restaurant and bar, gymnasium andundercover parking (charges apply per night). In-room facilitiesinclude mini bar, tealcoffee making facilities, broadband (for a fee),Fox Sports and News, pay per view movies, climate controlair-conditioning, hairdryer, iron and ironing board.Standard Room: $280 per night single/twin/doubleRYDGES LAKESIDEI London Circuit, CanberraOver the last two yearss Lakeside hasundergone major chang, apartments,bars and restaurants op15-20 minutewalk to the National Convention Centre. This property has 24-hourreception, room service and two onsite restaurants. All rooms havebalconies and offer high speed internet (for a fee), pay per viewmovies, mini bar, hairdryer, iron and ironing board.Note: This hotel has an absolute no-smoking policy.Standard Room: $239 per night single/twin/doubleWALD ORF2 Akuna Street, CanbetaLocated in the heart of Canberra's CBD, the Waldorf is only a fourminute walk from the National Convention Centre. This hotel has24-hotr reception and provides guests with a gymnasium, indoorheated lap pool and onsite dining at the Waldorf LondonRestaurant. All rooms have kitchen and laundry facilities, in roomsafe, dining table and chairs, complimentâry cable TV, pay per viewmovies, high speed internet service (for a fee) and Room Service isavailable. One bedroom apârtments also offer a separatelounge/dining area.Studio Room: $200 per night singleStudío Room: $215 per night twin/double1 Bedroom apartment: $220 per night single1 Bedroom apartment: $235 per night twin/doublet4General Manager's Report2012 National General Assembly of Local GovernmentCall for MotionsDAILY SHUTTLES TO AND FROM THENATIONAL CONVENTION CENTREA shuttle service between all General Assembly hotels(except Crowne Plaza Canberra) and the NationalConvention Centre will operate between 8:00 am and8:45 am. Return shuttles will depart the NationalConvention Centre at 5:30 pm.BUFFET DINNER: NATIONAL CONVENTIONcENTRE MONDAY r8 JUNE 2Ot2Coaches will collect delegates from all General Assemblyhotels (except Crowne Plaza Canberra) at approximately6:45 pm. A return shuttle service will commence atl0:15 pm.GENERAL ASSEMBLY ANNUAL DINNER:PARLIAMENT HOUSE TUESDAY r9 JUNE 2012Coaches will collect delegates from all General Assemblyhotels (íncluding CrownePlaza Canberra) atapproximately 6:45 pm. A return shuttle service willoperate between 10:30 pm and I t:45 pm.Car ParkingParking for delegates is available underneath the NationalConvention Centre for a cost of approximately $12.00per day. Alternatively, voucher public parking is availableacross the road at a cost of approximately $7.00 per day.The voucher machines are coin operated.14 of 16 March 2012 Ordinary Business PaperPage 351 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aI.*lational General Assemblyof Local GovernmentRegistration FormPERSONAL DETAILSNATIONAL CONVENTION CENTRE, 17 20 IUNE 201'2AUSTRALIAN LOCAL GOVERNMENT ASSOCIATION ABN 3]Regísten Online008 613 876Multiple delegâtes > photocopy lormRegister online \vw.olga nsn.oüot ilownloo¿l PDF or reilîil thisJorn to:Conference Co ordi nâtoßPO Box 139 CALMLL ACT 2905Phone (02) 6292 9000rax (02) 6292 9oo2Emâìl conference@conlco coil auBy subilitting yùur registrrliorl )ou¡pree ¡o the terns and conditions oftñe cÐcellâtion poLicyTITLE NAME SURNAMEP05tTl0NCOUNCIL/ORGANIsATIONADDRESSSUBURBSTATEPOSTCODEPHONEMOBILEFAXEl'4AlLNAME FOR BADGEHow DrD you FrND our ABour rHE GENERAL AssEMBLy? n oroo E sr¡re/rEnntroRy AssoctATtoN n aor*a,, n ottt*'DlscLosuRE n I Do consent toALGAdisctosing mypersonalcontact informationasouttlned in the privacydisctosure on page 11REGISTRATION FEESGENERAL AssEMBLY REGISTRATION FEESp L E A S E N O T E regrstratio n does N7T include attendance at the Regional Cooperation and Development ForumEARLY BIRD Registration Fees Ipayment received on or before 27 April2012)STANDARD Registration Fees Ipayment recelved on or before 1 June2012)LATE Registration Fees lpayment received after 1 June 20121DAy Registration Fees Monday 1 B June $470 00 I Tuesday I 9 June $470 00 IREGIONAL CO-OPERATION AND DEVELOPMENT FORUM REGISTRATION FEESREGIONAL DEVELOPMENT FORUM 0NLY Registralìon FeecENERAL AssEMBLY DELEGATE Registration FeesrATE oF THE REGloNs REPoRT 2012-13 lSìngte licence]sTATE oF THE REGloNs REPoRT 2012-13 [OrganisationaL Licence]pLEASE NOTE Á hardcopyofthe20l2-l3Report[excluding regionatprofiles]isincludedinthereg¡strat¡onfeeACCOMPANYING PARTNERS REGISTRATION FEESREGISTERED ACCOMPANYING PARTNER'S name for Lapel badge$BBO OO E$ee0 00 E$1 1s0 00 EWednesday 20 June $255 00 I$3e5 00 E$1e5 00 I$250 00 E$700 00 I$25s 00 ESOCIAL FUNCTIONS INCLUDED IN FEES}ne ticket to each of the foLtowing functíons is included in the full General Assembly reg¡stratíon and/or accompany¡ng partners registration f ee Please confirm if you wiLl beattend¡ng by placing a t¡ck ¡n the appropriate boxes To purchase additional tickets to any of the following functions please indicate the number required and complete thetotal amount PaYableREGISTERED DELEGATEs AND PARTNERSwELcoME REcEPTIoN AND EXHIBITIoN oPENING lsunday 17 -)une2012lI/we wiLl. artend: LteLegate I Partner f_l Number of additionaL ti.k"t, f--l ß $44 00 eachREGISTERED PARTNERSPARLIAMENTARY TRIANGLEI wiLL attend:DELIGHTS OFlwittattend:ATTRAcTIoNs IMonday'18 June 2012]partner fl Nrmne, of addirionaL ti.k.t, l--l ß g100 00 eachTHE cANBERRA olsTRlcT VILLAGEs AND wINERIES [Tuesday 19 June 2012ìparrner fl Number of addiliona[ ,,.k.,. l--_l ß $100 00 eachro.uL$Fro.uL$FGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for MotionsRegßtratnn form conttnues over the page15 of 16 March 2012 Ordinary Business PaperPage 352 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.4.aNGA2012REGISTRATION FORM CoNTINUEDOPTIONAL SOCIAL FUNCTIONsTickets to these functions are not incIuded in the GeneraL Assembly registratlon fee or accompanying partners registration fee To purchasetickets to any of the foILowing functions please indicate the number required and the totaL amount payabteBUFFET DINNER IMonday 1B June 2012JGENERAL ASSEMBLY DINNER, GREATSPECIAL REQUIREMENTSNumber of tickets f-_-] a $95 00 each ,0,., $FHALL, PARLTAMENT HousE (Tuesday 19 June 20121 +*NUMBERs sTRtcTLy LtMtTED**Number of tickets f-_l a 9125 00 eachro..L $f-------lTIE.G. DIETARY]REGISTRATION AND SOCIAL FUNCTION PAYMENT DETAILSI J Enctosed is my cheque made payable to ALGA Conference AccountL--l I m faxing my requirements, payment follows by mailI I I have paid via an Electronic Funds Transfer to the 'ALGA Conference Account' Transaction TeleTence numberALGA Account: Bank: CommonweaLth Branch: Curtin BSB No: 0ó2 5 Account No: 100977ó0__-..¡À| | Ptease charge my credit card I I Mastercard I lVisa --l mexCRED T CARD NUMBER TTTT TTTT TTTT TTTT GRAND TOTAL gN 0 T E This is an aecount specificaltyY lor conference payments oirtyCARD HOLDER'S NAMEEXPIRY DATESIGNATURErs rHrs A coRPoRATE.o*0, ,., f-l *o IACCOMMODATION DETAILSP L E A S E indicate your preference f rom 1 to 5CROWNE PLAZASUPERIOR KING ROOMDELUXE KING ROOM$2so nr,rur¡ nr*,r.l$340 !r,*ur. Er*,¡¡ntr DOUBLEDOUBLEACCOMMODATION GUARANTEEP L E A S E N 0 T E your credit card details are requ¡red to guarantee yourroom Neither Conference Co-ordinators nor the hotel wîlL make any chargesaga¡nst your credit card unless you faìl to give a minimum of twenty-one 12l )days notice in wñting of your cancel[ation. All cancellations will beacknowledged in writing by Conference Co-ordinators. Fuil payment of youraccount will be requ¡red at the time of your departure The rates quoted areper room per night.CLIFTON SUITES1 BEDROOM APARTMENT g21o nrnul-¡ nr*,r.l noorr.,DIAMANTSTANDARD ROOMg25s nsn¡nl-e nr*,* noorrreDATE OF ARRIVALDATE OF DEPARTUREHOTEL REALMSTANDARD ROON4MANTRA ON NORTHBOURNEHOTEL ROOM1 BEDROOM APARTMENTMEDINA EXECUTIVE JAMES COURTSHARING WITH$255 nr,ror. Er*,¡l noourr.ESTIMAIED TI¡,.lE OF ARRIVAL$209$219n5IN G LESINGLETWIN n oorr,-.n TW|N n oorr..I BEDROOM APARTMENT $I90 sTNGLE nr*,* noour*2 BEDROOM APARTMENT $2/-O!trNU¡4BER SHARINGtrrI understand my credit card details are given as a guarantee of my arrivaland to ensure my room wilL be held until my nominated arrival time Nocharge for accommodation wilL be made aga¡nst th¡s card unless I fail to givea minimum of twenty-one [21) days notice of cancellation in writing toC onference Co-ord inato rsPLease use the credit card details províded above to guarantee myaccommodation bookingN OVOTELSTANDARD ROON4RYDGES LAKESIDESTANDARD ROO¡4WALDORFSTUDIO ROOMI BEDR00l'4 APARTMENTg28o nr,rn,, nrw,* noourl-Egz3e nr,ro., nr*,,u noorr*$200 StNGLEn $220 StNGLEn¡$21 5 TWIN/DOUBLE$235 TWIN/DOUBLEf-l Mastercard I u,r. f-l 4,n.,TTTTTTTTTTTTTTTTcREDIT CARD NUt\4BERCARD HOLDER'S NAMESIGNATUREEXPI RY DATE15 THIs A CORPORATE CARD? YES E'O T(Ð * t T U R N to Conference Co-ordinators, P0 Box 139 CALWELL ACT 2905 or Fax f02l 62929OOzGeneral Manager's Report2012 National General Assembly of Local GovernmentCall for Motions16 of 16 March 2012 Ordinary Business PaperPage 353 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.5 GENERAL MANAGER’S REPORTSubject: Australian Water Congress and Expo 2012Author:Conflict of Interest:General ManagerNil to this reportRECOMMENDATION: That the Council nominate Cr Clements, as Council’s delegatefor the Namoi Water and Namoi Councils Water Working Group to attend the AustralianWater Congress and Expo 2012 to be held in Sydney on the 18-19 April 2012 as arepresentative of Narrabri Shire Council.Issues Advise Council of the Australian Water Congress and Expo 2012; Nominate delegates to attend the Australian Water Congress and Expo 2012.BackgroundThis event brings together all the stakeholders in Australia's $90 Billion water industry and focuseson the effective management and regulation of this essential resource. It will provide the perfectplatform for industry specialists to discuss government policy and new industry initiatives.Current SituationPresentations will provide insight and solutions to the core challenges currently facing Australia'swater industry including infrastructure development; demand management; drought planning;pricing; funding and regulation.Topics will focus on the key issues driving Australia's water business including:Managing 21st century water challengesFederal and state government policiesImproving operational performance and business efficiencyPricing and industry regulationInfrastructure developmentDemand managementProtecting assets and managing market risksAttracting capital for major projects, infrastructure upgrades, and capital worksGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 354 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTRaising the bar on business performance for utilitiesEnsuring security of supply across major cities, towns & regional areasQuantifying the benefits of water trading for irrigators & farmersAdapting to climate change as volatile weather patterns:Delivering on the next round of reforms — federal, state & localManaging the interests of stakeholders, including:• water utilities• domestic & industrial users• farmers & irrigators• investment partners & consortiumsClarifying pricing and access arrangementsProject managementFast-tracking investments in reuse, recycling, wastewater management & desalinationprojectsAttachmentsAttachment 10.1.5.a: Water Congress Brochure.Financial ImplicationsApproximate costs per delegate are as follows:Accommodation(2 nights): = $ 433.50Conference Registration: = $ 1,204.50Total Cost Approximate (per delegate) = $ 1,638.00Statutory/Legal ImplicationsNil to this reportEnvironmental ImplicationsNil to this report.Management Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 355 of 555 of the March 2012 Ordinary Business Paper

ianAttachment 10.1.5.ahuffitral aterCsngress &.frxpo %tLzlTtfa &,"âgth Apra{.Grace Hotet, SydneyOrganised byÂcT?vË Bt sr'Esr fl tlltco$áMuNltÀTlor-¡sWAT,ÍßParticipating Organisationsffiallcuuex w*-*æ¡,,lk#i *.,-,***'t *-'l¡U,,ø,¡tÀr.sÈr,.1..i'.,¡!S¡rrr.l¡F14¡ ar l ¡ñúñ¡krRegister online now for just $995 +GST. Register 3 delegates and a 4th attends freewww.abcevents.net.au/water or Call 02 9008 1101General Manager's ReportAustralian Water Congress and Expo 20121 of 5 March 2012 Ordinary Business PaperPage 356 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.5.alf you attend one water industryevent in 2O12then this is it!With a theme of lnnovation in watermanagement and regulation, thistwo day event is an unprecedentedcoming together of the keystakeholders in Australia's waterindustry. Following years of drought,and the recent announcement of theMurray Darling Basin Plan, water isvery much on everyone's agenda.On the program is the wholefuture of Australia's water industryincluding: key issues going fonruardfor management and sustainable useof water; development of the MurrayDarling Basin Plan; governmentpolicy; water pricing; trading andregulation.It will provide the perfect platformfor industry specialists to discussgovernment policy and new industryinitiatives. Presentations willprovide insight and solutions to thecore challenges currently facingAustralia's water industry includinginfrastructure development; demandmanagement; drought planning;pricing; funding; regulation; andmore!Senior level speakers representfederal, state and local governmentdepartments and agencies; watercompanies and utilities; and watercatch ment authorities.It is a meeting of minds at thehighest level.Australian Water Congress & Expo2011 is a great opportunity to raiseyour organisation's profile andpromote your products and servicesto Australia's water industry. Bysponsoring or exhibiting at this eventyou will have the oppportunity to:. Generate new sales leads. Raise your profile in the waterindustry. Gain direct access to new andexisting customers. Have an unrivalled opportunity tonetwork and do businessAustralian Water Gongress & Expo 2012Senator SimonIChlo€ MunroChairNational WaterBirm¡nghamShadowParliamentary CommissionSecretary for theMurray-DarlingBasinDavid Maw€rNelleyManaging D¡rector HeüteringtonGippsland Water Strategico¡reclionsManagerSydney WaterDr Ron Ben-David Robert O,Ne¡llChair D¡rector, Water Policy 6'Essent¡al Services PlanningCommission, Vic NSWOffice of Water18th & 1gth AprilAndrow FoleyChief Exewtive OffærAllconnex WaterMíchael MaloufManaging DireciorBanron WaterJohn R¡nghamChief ExeciltiveSAWãterFor further information and todiscuss your participation contactAnthony Sprange on:Phone:02 9008 1101Email: anthony@abcevents. net.auCr Genia McGaffery Karen WaldmanPresidenl Ch¡ef Executive OffcerALGAeueensland WaterCommissionLes Gordon George WameCha¡r of the \ /ater Chief Exeðl¡ve Off cerCommittee Northern VictoriaNational Farmer's lrriqation RenewalFederation - projectGeneral Manager's ReportAustralian Water Congress and Expo 20122 of 5 March 2012 Ordinary Business PaperPage 357 of 555 of the March 2012 Ordinary Business Paper

lr vou Árrnrup oNE wATER EVENT w 2A72, mrem rr-tts ls n!Day One: Wednesday 18th April8.30 Welcome tea and coffee & documentationcollection9.00 Opening remarks from the ChairWeren ållenxers9.10 Strengthening Australia's growing water markets. Ensuring that scarce water resources are allocatedefficiently. Strategies for developing market fundamentals in existingand new markets. Prioritising reform in the groundwater trading market. Building on water market reform with strong leadership andCOAG support. Role of government, stakeholders and privatesector partnerships. Building market confidence with transparencyand timely transaction reporting. Priorities lor 2O12Ghloe Munro, Ghair, National WaterCommission9.40 Polices and strategies for an effective Murray- RoLe 0F LocAL Goven¡*¡¡r¡trDarling Basin implementation process1.55 Role of Local Government in water resource. Requirement for clarity, direction and certaintymanagementfor the Basin. Securing water supply in urban and regional areas.ldentiffing key government policies for an. Potential of substituting potable with recycled watereffective MDB Plan.lmplementing the national water initiative at the. Balancing the needs of all stakeholderslocal level. What impact if any, has rainfall had on the. Delivering water supply to remote areasstrategies needed?. Developing water sensitive urban design. How to meet the environmental challenges. Strategies for working with all levels ofSenator Simon Birmingham, Shadow Parliamentary government for positive outcomesSecretary for the Murray-Darling Basin. Meeting the environmental challengesGr Genia McCaffery President, ALGA10.10 Delivering and implementing the Murray DarlingBasin Plan. Creating and delivering the draft Basin Plan. Critical role of the States & TerritoryGovernments' in implementing the plan. Ensuring the plan seeks balance, respectscommunities and allows for changes over time. Strategies for "Getting the best out of everydrop"'Creating clear and efficient rules that govern water. Optimising environmental outcomes for the Basin. What are the opportunities and challenges going forward?Dr Rhondda Dickson, Ghief Executive, Murray-DarlingBasin Authority10.40 Morning tea and coffee break11.10 Water regulation and privatisation inthe UKRegina Finn, Ghief Executive, OFWAT11.40 Presentation TBAMuen¡v-DnRLE*c B¿$NKev¡¡ore I rularuçarpæar- Aoo*cssAttachment 10.1.5.aI 2.1 0 lntegrated catchment managementfor water quality and quantity. Water management strategies post drought. Working with other catchment authorities andagencies. Ensuring quality as well as quantity. Meeting the demands of all stakeholders. The economics of catchment managementMichael Bullen, GEO, Sydney GatchmentAuthority1 2.35 Sustainable water management strategies. ldentifo ing sustainable programs.ls a more centralised coordinated policy required?. Communicating sustainability message to all stakeholdersGhloe Munro, Ghair, National Water GommissionDr Rhondda Dickson, Chief Executive, Murray-DarlingBasin AuthorityMichael Bullen, Ghief Executive Officer, SydneyCatchment AuthorityRegina Finn, Ghief Executive, OFWAT12.55 LunchWerra Ce¡crcuenrP¡Nel SesspNTñleren Senvces rN RURAL & Recrcxrl AREAs2.25 Challenges in supplying water services to ruraland regional areas. What are the unique issues for rural and regional operators?. Are regulated water price rises balancingincreased infrastructure delivery costs?. What are alternative sources of water supply?. lmpact of the 'Water for the Future Plan" atservice and supply level. Future challenges and opportunitiesKim Wood, Managing Director, HunterWater GorporationW¡ræn 8i älln¡rua Fteeuler¡cs2.50 Regulating water related areas of mining in NSW. Defining aquifer interference activities by mining and coalseam gas extractionRobert O'Neill, Director, Water Policy &Planning, NSW Office of Water3.15 Afternoon tea & coffee breakReClSfen OruU¡lE www. a b cevents. n et.a u /wate rGeneral Manager's ReportAustralian Water Congress and Expo 20123 of 5 March 2012 Ordinary Business PaperPage 358 of 555 of the March 2012 Ordinary Business Paper

3.45 Balancing agricultural and environmentalrequirements. How the farming industry is working forsustainable water use.Assessing the Murray Darling Basin Plan. Understanding social, economic, andenvironmental implications. Challenges for major water usersLes Gordon, Ghair of the Water Gommittee, . .National Farmers' FederationÄsonferxAr PEoptr's Pgngpee¡rw4.10 Recognition of Aboriginal peoples' needs, rights,interests and contributions in rivers and fresh waters. How Australian governments have committedto improving the situation. Role of the FPWEC. Commitment to building Aboriginal engagementin water planning and allocation. Aboriginal access to the consumptive waterpool for economic purposes. Exploring broader issues of Aboriginal spiritualand cultural values in rivers. Understanding key concepts of cultural flows, economicwater allocation and capacity buildingPhil Duncan, Chair, First Peoples Water EngagementCouncil, National Water Gommission and EnvironmentWaren Plexæpvo4.35 Securing our water future - Setting future plansand objectives. Update on recent developments including:AngelseaBorefield, Northern Water Plant, Melbourne to GeelongPipeline, Armstrong Creek Recycled Water Project, AquiferStorage and Recovery Research, Black RockRecycled Water Plan. Role of infrastructure investment and fundingstrategies.What can the water industry learn from recentdrought and flooding?Michael Malouf, Managing Director,Banron WaterP¿na Sess¡oâ{5.00 Balancing the needs of all stakeholders.ls it theoretically possible to meet all needs andrequirements?. How to get the balance right. Strategies for engaging with all stakeholdersKim Wood, Managing Director, Hunter WaterGorporationLes Gordon, Ghair of the Water Committee, NationalFarmels' FederationRobert O'Neill, Director, Water Policy & Planning, NSWOffice of WaterMichael Malouf, Managing Director, Barwon WaterPhil Duncan, Chair, First Peoples Water EngagementGouncil, National Water CommissionGr Genia Mccaffery President, ALGA5.20 Closing remarks from the Chair5.30 Close of day one followed by networking drinksreceptionV_. Relax ive rtay¿\Z oi ¡treftuniiy¿ fo nefAttachment 10.1.5.aDay two: Thursday 19th April8.30 Welcome tea and coffee and documentationcollection9.00 Opening remarks from the GhairHfl¡cn Re¡'snø9.10 lnnovation in water reform. How water reform is evolving?. Policy management and implementation. Balancing the needs of all stakeholders. Working with states; water companies andother stakeholdersTony Slatyer, First Assistant Secretary,Department of Sustainability, Environment,Population & Gommunities9.40 Ensuring secure; susta¡nable and affordablewater for South Australia. Update on recent developments including: AdelaideDesalination Project, North South lnterconnection SystemProject, Christies Beach Wastewater Treatment PlantUpgrade, Southern Urban Reuse Project. Assessing water pricing models. Strategies for ensuring security of supply. Meeting the needs of all stakeholders. Water management strategies in a time ofplenty. Future challenges and opportunitiesJohn Ringham, Ghief Executive, SA WaterSusrs¡neLc URSAN Wersn Suppl-v10.05 Building a susta¡nable future for theindustry. Understanding population growth and climatechange as key drivers. Planning for sustainable urban communities. Providing value for money from water services. lmplications of the carbon tax. Urban water industry reform strategies andgovernanceJohn Wilkinson, Managing Director, Western Water10.30 Morning tea & coffee breakWeren M*i¡AgeñreÈ.¡r11.00 Ensuring secure; susta¡nable and affordablewater for Gentral Gippsland. Update on recent developments including: Loch SportSewerage Scheme, Coongulla GlenmaggieSewerage Scheme, Gippsland Water Factory. Assessing water pricing models. Strategies for ensuring security of supply. Meeting the needs of all stakeholders. Water management strategies in a time ofplenty. Future challenges and opportunitiesDavid Mawer, Managing Director, Gippsland WaterlUaren Qt¡¡rrrv11.25 Managing water quality and quantity in keycatchment areas. How Victoria is managing water post droughtfor times of scarcity. Strategies for ensuring quality as well asquantity of supply. Managing environmental concerns. How Victoria is working with other states forsecurity and sustainabilityDr Jane Doolan, Deputy Secretary, WaterGroup, Department of Sustainability andEnvironment, VictoriaÅGeneral Manager's ReportAustralian Water Congress and Expo 20124 of 5 March 2012 Ordinary Business PaperPage 359 of 555 of the March 2012 Ordinary Business Paper

8¡wsr¡.ÌN ste' & Areaxafue,\I*Eer'¡ WÁren11.50 Ensuring secure; sustainable and affordablewater for Urban Queensland (Gold Coast, Logan andRedland City Gouncils). Update on recent projects including:Coombabah Wastewater Treatment PlantStage 5, Logan WaterAlliance, PimpamaCoomera Waterfuture (PCWF) Alliance,Chlorine Disinfection Strategy. Assessing water pricing models and strategies. Strategies for ensuring future security of supply. Flood management strategiesAndrew Foley, Ghief Executíve Officer, Allconnex Water12.15 Ensuring secure; sustainable and affordablewater for Sydney. Update on recent developments. Assessing water pricing models. Strategies for ensuring security of supply. Meeting the needs of all stakeholders. Water management strategies in a time ofplenty. Future challenges and opportunitiesNefley Hetherington, Strategic Directions Manager,Sydney Water12.40 LunchScsr¡K*eLE URtsAH WArER $uppl-vW¡ren PRrc¡No & Reeuumon1,30 Water pricing, regulation, governance and reform. lmportance of an independent pricing body. Assessing water pricing models - is there roomfor change?. Scarcity pricing strategies. Defining and separating roles andresponsibilities of participants. Role of governance in water managementJames Cox, Ghief Executive Officer,lndependent Pricing and Regulatory Tribunal of NSW1.55 Water reform, regulation and governance. Assessing current water reform policies. Comparing state with national agendas. How is governance evolving to meet reform?. \Mat does this mean for the industry, thecustomer and environment?Dr Ron Ben-David, Chair, Essential ServicesGommission, Victoria2.2OThe Queensland Water Commission's role instrategies for coal seam gas extraction to protectgroundwater resources. lmplementation of the Commission's CoalSeam Gas water management functions inthe last 12 months.The Surat Underground V\hter lmpact Report. Establishing individual responsibilities forintegrated management of Coal SeamGas impacts. How the Commission is working with other departments andagenclesKaren Waldman, Chief Executive Officer, QueenslandWater Commission2.45 Afternoon tea & coffee breakAttachment 10.1.5.a3.15 Reform and Economic Regulation of Urban Waterin Tasmania - lt's not always about a shortage of water. Review of the Tasmanian urban water sector- what was wrong?. Reform of the sector - what was the policyresponse?. Role of economic regulation - pricing,effìciency and achieving compliance. Managing the reform transition - balanceand compromise. Where are things at - is it working?Dean Burgess, Acting Director, Office of the TasmanianEconomic RegulatorSn¿anr Ytl*rea Smsar Cff¡es3.40 Strategies for water smart cities. Defining a water smart city. What is happening overseas?. Role of research. Future of intelligent water networks. lnvestment and fundingGhristine Gussen, Ghief Executive Officer,Smart Water FundDeve¡-op¡Nc JRRrcATС¡ NetwûRxs4.05 Value for money - Northern Victoria has the bestproject going - it meets the triple bottom line criteriafor all\Â/lry the irrigation renewal project will provide thebest value for money outcomes for:. Commonwealth Government,. State Government and. Northern Victorian irrigators and. Murray Darling Basin's SDL planGeorge Warne, Ghief Executive Officer,Northern Victoria lrrigation Renewal Project4.30 Glosing remarks from the chairEARLY BIRÐS RESISTER NOWfor $995 + GST - REGISTER '-3 DELEGATES and a 4ïhATTENDS FREE!General Manager's ReportAustralian Water Congress and Expo 20125 of 5 March 2012 Ordinary Business PaperPage 360 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.6 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Narrabri Shire Local Flood PlanA Sub-Plan of the Narrabri Shire Local Disaster Plan (Displan)ReviewGeneral ManagerNil to this reportRECOMMENDATION 1: That the State Emergency Service (SES) be tasked withreviewing the Displan as a matter of emergency.RECOMMENDATION 2: That the Council meet with the SES on 3 rd April 2012 todiscuss the February 2012 flood event and with looking at a debrief and how the Councilalong with the SES can look at mitigating flood events in the future.RECOMMENDATION 3; That the Council set the following dates for communityworkshops to discuss the content of the Flood Displan:5pm, 17 th April 2012, Narrabri;5pm, 18 th April 2012, Boggabri;5pm, 19 th April 2012, Wee Waa.RECOMMENDATION 4: That the Council allocate funds to engage a consultant to carryout causeway gauge investigations and installation in the 2012/13 budget and seek assistancefrom Emergency Management Australia (EMA) in this regard.IssuesUrgent review of Narrabri Shire Local Flood Plan including debrief and mitigation forfuture flood events;Confirm arrangements for Community Workshops to discuss Flood Displan contents;BackgroundThe Draft Narrabri Shire Local Flood Plan dated November 2010 is shown at Attachment10.1.6.a. The document will form part of the Council’s discussions with the SES on 3 rd April 2012.Current SituationThe Flood Plan is currently in draft form and is required to be reviewed by the “legislated combatagency for floods and responsible body for the control of flood operations” as stated point 3.1.1.The SES is listed as the responsible and legislated agency for such.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 361 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTThe document will forms part of discussions/debrief with the SES which will take place on 3 rdApril 2012.A noteworthy issue arising from the last flood event within the Shire in February 2012 is that thereare a number of causeways on Shire Roads that don’t have gauges. The Council should considerallocating funds to engage a consultant to carry out these works in the next budget and seekassistance from EMA to assist in this regard.AttachmentsAttachment 10.1.6.a:Draft Narrabri Shire Local Flood PlanFinancial ImplicationsNil to this report.Statutory/Legal ImplicationsAs stated in the Draft Narrabri Shire Local Flood Plan at point 1.2:“1.2 Authority1.2.1 This plan is issued under the authority of the State Emergency andRescue Management Act 1989 and the State Emergency Service Act1989.”Environmental ImplicationsUpdated information is essential on the Draft Narrabri Shire Local Flood Plan in order to mitigatefuture flooding events and their affects in the Narrabri Shire.Management Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 362 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aNARRABRI SHIRE LOCAL FLOOD PLANA SUB-PLAN OF THENARRABRI SHIRE LOCAL DISASTER PLAN(DISPLAN)Chair, Local EmergencyManagement CommitteeSES Local ControllerNOVEMBER 2010 EDITIONTO BE REVIEWED NO LATER THAN NOVEMBER 2015General Manager's ReportNarrabri Shire Local Flood Plan - Displan Review1 of 89 March 2012 Ordinary Business PaperPage 363 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aCONTENTSDISTRIBUTION LIST ......................................................................................................................... ivAMENDMENT LIST ............................................................................................................................. vLIST OF ABBREVIATIONS ............................................................................................................... viGLOSSARY .......................................................................................................................................... viiPART 1 - INTRODUCTION ................................................................................................................. 11.1 Purpose ..................................................................................................................................... 11.2 Authority ................................................................................................................................... 11.3 Area Covered By The Plan ....................................................................................................... 11.4 Description Of Flooding And Its Effects .................................................................................. 11.5 Responsibilities ......................................................................................................................... 11.6 Cross-Border Assistance Arrangements .................................. Error! Bookmark not defined.PART 2 - PREPAREDNESS ............................................................................................................... 132.1 Maintenance Of This Plan ...................................................................................................... 132.2 Floodplain Management ......................................................................................................... 132.3 Development of Flood Intelligence ........................................................................................ 132.4 Development of Warning Systems ......................................................................................... 142.5 Public Education ..................................................................................................................... 142.6 Training .................................................................................................................................. 142.7 Resources ................................................................................................................................ 15PART 3 - RESPONSE .......................................................................................................................... 163.1 Control .................................................................................................................................... 163.2 Operations Centres ................................................................................................................. 163.3 Operational Management ........................................................................................................ 163.4 Liaison .................................................................................................................................... 173.5 Communications ..................................................................................................................... 173.6 Start of Response Operations .................................................................................................. 173.7 Flood Intelligence ................................................................................................................... 183.8 Preliminary Deployments ....................................................................................................... 193.9 Warnings ................................................................................................................................. 193.10 Information ............................................................................................................................. 223.11 Road Control........................................................................................................................... 233.12 Traffic Control. ....................................................................................................................... 233.13 Flood Rescue .......................................................................................................................... 233.14 Evacuations ............................................................................................................................. 243.15 Registration ............................................................................................................................. 253.16 Management Of Evacuees’ Pets ............................................................................................. 263.17 Essential Services ................................................................................................................... 263.18 Logistics ................................................................................................................................. 263.19 Aircraft Management .............................................................................................................. 263.20 Resupply of Isolated Towns and Villages .............................................................................. 273.21 Resupply of Isolated Properties .............................................................................................. 283.22 Assistance for Animals ........................................................................................................... 283.23 Stranded Travellers ................................................................................................................. 283.24 All Clear ................................................................................................................................. 29PART 4 - RECOVERY ........................................................................................................................ 304.1 Welfare .................................................................................... Error! Bookmark not defined.4.2 Recovery Coordination ........................................................................................................... 314.3 Arrangements for Debriefs / After Action Reviews ............................................................... 31Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report2 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 364 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX A - THE FLOOD THREAT ............................................................................................... A-1Landforms and River System(s) ....................................................................................................... A-1Storage Dams.................................................................................................................................... A-5Weather Systems and Flooding ........................................................................................................ A-6Characteristics of Flooding ............................................................................................................... A-6Flood History .................................................................................................................................... A-7Flood Mitigation Systems ................................................................................................................. A-7Extreme Flooding ............................................................................................................................. A-9ANNEX B - EFFECTS OF FLOODING ON THE COMMUNITY ............................................ B-10Community Profile ......................................................................................................................... B-10Specific Risk Areas ........................................................................................................................ B-11ANNEX C - GAUGES MONITORED BY THE SES LOCAL HEADQUARTERS .................... C-1ANNEX D - DISSEMINATION OF SES FLOOD BULLETINS ................................................... D-1ANNEX E - TEMPLATE EVACUATION WARNING MESSAGE FOR NARRABRI SHIRE E-1ANNEX F - EVACUATION ARRANGEMENTS FOR THE NARRABRI SHIRE AREA ....... F-1Background....................................................................................................................................... F-1Arrangements ................................................................................................................................... F-1Phase 1 – Decision to Evacuate ........................................................... Error! Bookmark not defined.Phase 2 – Warning ............................................................................................................................ F-7Phase 3 – Withdrawal ....................................................................................................................... F-8Phase 4 – Shelter ............................................................................................................................ F-12Phase 5 – Return ............................................................................................................................. F-13ANNEX G - ARRANGEMENTS FOR THE EVACUATION OF CARAVAN PARKS AND THERELOCATION OF CARAVANS ..................................................................................................... G-1General ............................................................................................................................................. G-1Advising Procedures ......................................................................................................................... G-1Evacuation of Occupants and Relocation of Vans ............................................................................ G-2Return of Occupants and Vans ......................................................................................................... G-3ANNEX H - RESUPPLY REQUIREMENTS AND OPERATIONS ............................................. H-1ANNEX I - DETAILS OF THE DAM-FAILURE WARNING AND EVACUATION SYSTEMFOR KEEPIT AND SPLIT ROCK DAMS ....................................................................................... I-1Purpose of System ............................................................................... Error! Bookmark not defined.Operation and Procedures .................................................................................................................. I-1Prior Advice to People Potentially at Threat ..................................................................................... I-2MAP 1 - RIVER BASIN ......................................................................................................................... IMAP 2 - COUNCIL AREA ................................................................................................................... IIMAP 3 - TOWN/VILLAGE/SUBURB AREA .................................................................................. IIINarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report3 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 365 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aDISTRIBUTION LISTNarrabri Shire Council SES Local Controller ........................................................... 1Narrabri SES Unit ...................................................................................................... 1Wee Waa SES Unit Controller .................................................................................. 1Wee Waa SES Unit .................................................................................................... 1Pilliga SES Unit Controller ........................................................................................ 1Pilliga Unit ................................................................................................................. 1Boggabri SES Unit Controller ................................................................................... 1Boggabri SES Unit ..................................................................................................... 1Namoi Region SES Region Headquarters ................................................................. 1NSW SES State Headquarters ................................................................................... 1Narrabri Shire Council, Local Emergency Operations Controller ............................. 1NSW Police Force, Barwon Local Area Command .................................................. 1Narrabri Shire Council Local Emergency Management Committee Members ......... 4Local Emergency Management Officer ..................................................................... 1Narrabri Shire Council Local Emergency Operations Centre ................................... 1Narrabri Shire Council Mayor ................................................................................... 1Narrabri Shire Council General Manager .................................................................. 1Narrabri Shire Council Technical Services Department ............................................ 1NSW Fire Brigades, Narrabri .................................................................................... 1NSW Fire Brigades, Boggabri ................................................................................... 1NSW Fire Brigades, Wee Waa .................................................................................. 1Rural Fire Service, Namoi Gwydir Zone ................................................................... 1Ambulance Service of NSW, Narrabri ...................................................................... 1Ambulance Service of NSW, Boggabri ..................................................................... 1Ambulance Service of NSW, Wee Waa .................................................................... 1Volunteer Rescue Association, Narrabri Rescue Squad ............................................ 1Country Energy ......................................................................................................... 1Telstra ........................................................................................................................ 1Department of Environment and Climate Change ..................................................... 1Industry & Investment NSW, Narrabri ...................................................................... 1NSW Community Services, Narrabri ........................................................................ 1Roads and Traffic Authority, Narrabri ....................................................................... 1Evacuation Centres .................................................................................................... 1Hospitals .................................................................................................................... 1Schools ............................................................................................................. 1 eachCouncil Libraries ............................................................................................. 1 eachCaravan Parks .................................................................................................. 1 eachSpare .......................................................................................................................... 1Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report4 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 366 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aAMENDMENT LISTSuggestions for amendments to this plan should be forwarded to:The Region ControllerNSW State Emergency ServiceNamoi RegionPO Box 465Gunnedah NSW 2380Amendments promulgated in the amendments list below have been entered in thisplan.Amendment ListNumberDateAmendmentEntered ByDateNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report5 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 367 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aLIST OF ABBREVIATIONSThe following abbreviations have been used in this plan:AEPAHDARIALERTAWRCBoMCBDDCFDECCDSCDISPLANDoCSDSEPDVRDWEGISGRNHFIFFPMFPMRPMPPSTNRTASESSEWSUHFVHFVRAWICENAnnual Exceedance ProbabilityAustralian Height DatumAverage Recurrence Interval (Years)Automated Local Evaluation in Real TimeAustralian Water Resources CouncilAustralian Government Bureau of MeteorologyCentral Business DistrictDam Crest FloodDepartment of Environment and Climate ChangeDams Safety CommitteeDisaster PlanDepartment of Community ServicesDam Safety Emergency PlanDisaster Victim RegistrationDepartment of Water and EnergyGeographic Information SystemGovernment Radio NetworkHigh FrequencyImminent Failure FloodProbable Maximum FloodPrivate Mobile RadioProbable Maximum PrecipitationsPublic Switched Telephone NetworkRoads and Traffic AuthorityState Emergency ServiceStandard Emergency Warning SignalUltra High FrequencyVery High FrequencyVolunteer Rescue AssociationWireless Institute Civil Emergency NetworkNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report6 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 368 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aGLOSSARYAnnual Exceedance Probability (AEP). The chance of a flood of a given or largersize occurring in any one year, usually expressed as a percentage. For example, if apeak flood level (height) has an AEP of 5%, there is a 5% chance (that is, a one-in-20chance) of such a level or higher occurring in any one year (see also AverageRecurrence Interval).Assistance Animal. A guide dog, a hearing assistance dog or any other animaltrained to assist a person to alleviate the effect of a disability (Refer to Section 9 of theDisability Discrimination Act 1992).Australian Height Datum (AHD). A common national surface level datumapproximately corresponding to mean sea level.Average Recurrence Interval (ARI). The long-term average number of yearsbetween the occurrence of a flood as big as, or larger than, the selected event. Forexample, floods reaching a height as great as, or greater than, the 20 year ARI floodevent will occur on average once every 20 years.Catchment (river basin). The land area draining through the main stream, as well astributary streams, to a particular site. It always relates to an area above a specificlocation.Dam Safety Emergency Plan (DSEP). A DSEP outlines the required actions ofowners and their personnel at dams in response to a range of possible emergencysituations. The NSW Dam Safety Committee requires a quality controlled DSEP, withassociated dambreak warning procedures to be prepared for prescribed dams wherepersons may be at risk downstream, if the dam failed.Design flood (or flood standard). A flood of specified magnitude that is adopted forplanning purposes. Selections should be based on an understanding of floodbehaviour and the associated flood risk, and take account of social, economic andenvironmental considerations. There may be several design floods for an individualarea.Essential services. Those services, often provided by local government authorities,that are considered essential to the life of organised communities. Such servicesinclude power, lighting, water, gas, sewerage and sanitation clearance.Evacuation. The temporary movement (relocation) of people from a dangerous orpotentially dangerous place to a safe location, and their eventual return. It is a safetystrategy which uses distance to separate people from the danger created by the hazard.Evacuation Order. Notification to the community, authorised by the SES, when theintent of an Operations Controller is to instruct a community to immediately evacuatein response to an imminent threat.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report7 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 369 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aEvacuation Warning. Notification to the community, authorised by the SES, whenthe intent of an Operations Controller is to warn a community of the need to preparefor a possible evacuationFlash flooding. Flooding which is sudden and often unexpected because it is causedby sudden local or nearby heavy rainfall. It is sometimes defined as flooding whichoccurs within six hours of the rain that causes it.Flood. Relatively high water level which overtops the natural or artificial banks inany part of a stream, river, estuary, lake or dam, and/or local overland floodingassociated with drainage before entering a watercourse, and/or coastal inundationresulting from super-elevated sea levels and/or waves overtopping coastline defences.Flood classifications. Locally defined flood levels used in flood warnings to give anindication of the severity of flooding (minor, moderate or major) expected. Theselevels are used by the State Emergency Service and the Australian GovernmentBureau of Meteorology in flood bulletins and flood warnings.Flood intelligence. The product of collecting, collating, analysing and interpretingflood-related data to produce meaningful information (intelligence) to allow for thetimely preparation, planning and warning for and response to a flood.Flood liable land. Land susceptible to flooding by the Probable Maximum Flood.(PMF) event. This term also describes the maximum extent of a floodplain which isan area of a river valley, adjacent to the river channel, which is subject to inundationin floods up to this event.Flood of record. Maximum observed historical flood.Flood Plan. A plan that deals specifically with flooding and is a sub-plan of aDisaster Plan. Flood plans describe agreed roles, responsibilities, functions, actionsand management arrangements for the conduct of flood operations and for preparingfor them.Floodplain Management Plan. A plan developed in accordance with the principlesand guidelines in the New South Wales Floodplain Development Manual. Such a planusually includes both written and diagrammatic information describing how particularareas of flood prone land can be used and managed to achieve defined objectives.Floodway. An area where a significant volume of water flows during floods. Suchareas are often aligned with obvious naturally-defined channels and are areas that, ifpartially blocked, would cause a significant redistribution of flood flow which may inturn adversely affect other areas. They are often, but not necessarily, the areas ofdeeper flow or the areas where higher velocities occur.Flood Watch. A Flood Watch is a notification of the potential for a flood to occur asa result of a developing weather situation and consists of short generalised statementsabout the developing weather including forecast rainfall totals, description ofcatchment conditions and indicates streams at risk. The BoM will also attempt toestimate the magnitude of likely flooding in terms of the adopted flood classifications.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report8 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 370 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aFlood Watches are normally issued 24 to 36 hours in advance of likely flooding.Flood watches are issued on a catchment wide basis.Flood Warning. A Flood Warning is a gauge specific forecast of actual or imminentflooding. Flood Warnings specify the river valley, the locations expected to beflooded, the likely severity of flooding and when it will occur.Geographic Information System (GIS). A computerised database for the capture,storage, analysis and display of locationally defined information. commonly, a GISportrays a portion of the earth’s surface in the form of a map on which thisinformation is overlaid.Isolation. Properties and/or communities where flooding cuts access to essentialservices or means of supply. Isolation is one of the three primary sources of risk in thecontext of flooding (the other two are inundation and indirect effects).Local overland flooding. Inundation by local runoff rather than overbank dischargefrom a stream, river, estuary, lake or dam.Major flooding. Flooding which causes inundation of extensive rural areas, withproperties, villages and towns isolated and/or appreciable urban areas flooded.Minor flooding. Flooding which inconvenience such as closing of minor roads andthe submergence of low-level bridges. The lower limit of this class of flooding, onthe reference gauge, is the initial flood level at which landholders and/or townspeoplebegin to be affected in a significant manner that necessitates the issuing of a publicflood warning by the Australian Government Bureau of Meteorology.Moderate flooding. Flooding which inundates low-lying areas, requiring removal ofstock and/or evacuation of some houses. Main traffic routes may be covered.Peak height. The highest level reached, at a nominated gauging station, during aparticular flood event.Prescribed Dam. "Prescribed" dams are those listed in Schedule 1 of the DamsSafety Act 1978. The NSW Dam Safety Committee will prescribe those dams withthe potential for a failure which could have a significant adverse effect on communityinterests.Probable Maximum Flood (PMF). The largest flood that could conceivably beexpected to occur at a particular location, usually estimated from probable maximumprecipitation. The PMF defines the maximum extent of flood prone land, that is, thefloodplain. It is difficult to define a meaningful Annual Exceedance Probability forthe PMF, but it is commonly assumed to be of the order of 10 4 to 10 7 (once in 10,000to 10,000,000 years).Runoff. The amount of rainfall which ends up as streamflow, also known as ‘rainfallexcess’ since it is the amount remaining after accounting for other processes such asevaporation and infiltration.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report9 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 371 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aStage height. A level reached, at a nominated gauging station, during thedevelopment of a particular flood event.Stream gauging station. A place on a river or stream at which the stage height isroutinely measured, either daily or continuously, and where the discharge is measuredfrom time to time so as to develop a relationship between stage and discharge orrating curve.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report10 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 372 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.1 PurposePART 1 - INTRODUCTION1.1.1 This plan covers preparedness measures, the conduct of response operationsand the coordination of immediate recovery measures from flooding within theNarrabri Shire Council area. It covers operations for all levels of floodingwithin the council area.1.2 Authority1.2.1 This plan is issued under the authority of the State Emergency and RescueManagement Act 1989 and the State Emergency Service Act 1989. It hasbeen accepted by the Namoi SES Region Controller and the Narrabri ShireCouncil Local Emergency Management Committee.1.3 Area Covered By The Plan1.3.1 The area covered by the plan is the Narrabri Shire Council area which includesthe townships and villages of Narrabri, Boggabri, Wee Waa, Pilliga, Gwbegarand the surrounding rural areas.1.3.2 The council area and its principal rivers and creeks are shown in Map 1.1.3.3 The council area is in the Namoi SES Region and for emergency managementpurposes is part of the Peel Emergency Management District.1.4 Description Of Flooding And Its Effects1.4.1 The nature of flooding in the Narrabri Shire is described in Annex A.1.4.2 The effects of flooding on the community are detailed in Annex B.1.5 ResponsibilitiesThe general responsibilities of emergency service organisations andsupporting services (functional areas) are listed in the Local Disaster Plan(DISPLAN). Some specific responsibilities are expanded upon in thefollowing paragraphs. The extent of their implementation will depend on theseverity of the flooding.1.5.1 Narrabri SES Local Controller. The Narrabri SES Local Controller isresponsible for dealing with floods as detailed in the State Flood Plan, andwill:a. Control flood operations; This includes:• Directing the activities of the SES units operating within thecouncil area.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report11 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 373 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a• Coordinating the activities of supporting agencies andorganisations and ensuring that liaison is established with them.b. Maintain a Local Headquarters at Narrabri in accordance with the SESControllers’ Handbook and the SES Operations Manual.c. Ensure that SES members are trained to undertake operations inaccordance with current policy as laid down in the SES Controllers’Handbook and the SES Operations Manual.d. Develop and operate a flood intelligence system.e. Coordinate the development and operation of a flood warning servicefor the community.f. Participate in floodplain risk management initiatives organised by theNarrabri Shire Councilg. Coordinate a public education programh. Ensure that the currency of this plan is maintained.i. Identify and monitor people and/or communities at risk of floodingj. Direct the conduct of flood rescue operations.k. Direct the evacuation of people and/or communities.l. Provide immediate welfare support for evacuated people.m. Coordinate the provision of emergency food and medical supplies toisolated people and/or communities.n. Provide an information service in relation to:• Flood heights and flood behaviour.• Road conditions and closures.• Advice on methods of limiting property damage.• Confirmation of evacuation warnings.o. Coordinate operations to protect property, for example by:• Arranging resources for sandbagging operations.• Lifting or moving household furniture.• Lifting or moving commercial stock and equipment.• Moving farm animals.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report12 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 374 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ap. Assist the Narrabri Shire Council to organise temporary repairs orimprovements to levees.q. Arrange for support (for example, accommodation and meals) foremergency service organisation members and volunteers assisting them.r. If SES resources are available, assist with emergency fodder supplyoperations conducted by Industry & Investment NSW.s. If SES resources are available, assist the NSW Police Force, RTA andCouncil with road closure and traffic control operations.t. Exercise financial delegations relating to the use of emergency orders aslaid down in the SES Controllers’ Handbook.u. Coordinate the collection of flood intelligence.v. Submit Situation Reports to the Namoi SES Region Headquarters andagencies assisting within the council area. These will containinformation on:• Road conditions and closures.• Current flood behaviour.• Current operational activities.• Likely future flood behaviour.• Likely future operational activities.• Probable resource needs.w. Keep the Local Emergency Operations Controller advised of the floodsituation and the operational response.x. Issue the ‘All Clear’ when flood operations have been completed.y. Ensure that appropriate After Action Reviews are held after floods.z. Assist in the establishment and deliberations of the RecoveryCoordinating Committee.1.5.2 Boggabri, Wee Waa & Pilliga Unit Controllers:a. Conduct flood operations within the Narrabri Shire Council area asdirected by the Narrabri SES Local Controller.b. Submit Situation Reports to the Narrabri SES Local Headquarters, theNamoi SES Region Headquarters and agencies assisting within the localarea.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report13 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 375 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ac. Assist the Narrabri SES Local Controller with flood preparednessactivities, including:• Flood planning.• Training of unit members.• The development of flood intelligence.• The development of warning services.• Floodplain risk management initiatives.• Public education.1.5.3 Narrabri, Boggabri, Wee Waa & Pilliga SES Unit Members:a. Carry out flood response tasks. These may include:• The management of the Narrabri, Boggabri, Wee Waa & PilligaSES Local and Unit Headquarters Operations Centres.• Gathering flood intelligence.• Flood rescue.• Evacuation.• Providing immediate welfare for evacuated people.• Delivery of warnings and information.• Resupply.• Levee monitoring.• Sandbagging.• Lifting and/or moving household furniture and commercialstock.• Moving farm animals.• Assisting in repairing or improving levees.• Assisting with road closure and traffic control operations.• Assisting with emergency fodder supply operations.b. Assist with preparedness activities.c. Undertake training in flood operationsNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report14 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 376 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.4 Ambulance Service of NSW, Narrabri, Boggabri & Wee Waaa. Assist with the evacuation of elderly and/or infirm people.b. Deploy ambulance resources to as required if access is expected to belost.1.5.5 Australian Government Bureau of Meteorology (BoM):a. Provide Flood Watches for the Namoi River Basin.b. Provide Flood Warnings, incorporating height-time predictions, for;• Narrabri Creek (AWRC No 419003);• Wee Waa (Glencoe) – (AWRC No 419900);• Goangra (AWRC No 419026); and• Bugilbone (AWRC No 419021).c. Provide severe weather warnings when flash flooding is likely to occur.1.5.6 Australian Rail Track Corporation:a. Close and re-open railway lines as necessary and advise the NarrabriSES Local Controller.b. Arrange trains for evacuations and/or commuting purposes.1.5.7 Caravan Park Proprietor(s), Big Sky Caravan Park (Narrabri), NarrabriMotel Caravan Park, Highway Tourist Village ( Narrabri ) ( Refer also todetailed comments at Annex G ) :a. Prepare a Flood Management Plan for the Caravan Park.b. Ensure that owners and occupiers of caravans are aware that the caravanpark is flood liable and what they must do to facilitate evacuation andvan relocation when flooding occurs.c. Ensure that occupiers are informed of flood warnings and floodwatches.d. Coordinate the evacuation of people and the relocation of moveablevans when floods are rising and their return when flood waters havesubsided.e. Inform the SES of the progress of evacuation and/or van relocationoperations and of any need for assistance in the conduct of these tasks.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report15 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 377 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.8 Child Care Centres and Preschools:a. Child care centres as listed in Annex J will be contacted by the SES inthe event of possible flooding.b. When notified the child care centres should:• Liaise with the SES and arrange for the early release of childrenwhose travel arrangements are likely to be disrupted by floodingand/or road closures.• Assist with coordinating the evacuation of preschools and childcare centres1.5.9 Citizens’ Radio Emergency Service Teams (CREST) / Wireless InstituteCivil Emergency Network (WICEN):a. Provide communications assistance.1.5.10 Country Energy;a. Provide advice to the Narrabri SES Local Controller of any need todisconnect power supplies or of any timetable for reconnection.b. Clear or make safe any hazard caused by power lines or electricalreticulation equipment.c. Assess the necessity for and implement the disconnection of customers’electrical installations where these may present a hazard.d. Advise the public with regard to electrical hazards during flooding andto the availability or otherwise of the electricity supply.e. Inspect, test and reconnect customers’ electrical installations asconditions allow.f. Assist the SES to identify infrastructure at risk of flooding forincorporation into planning and intelligence.1.5.11 NSW Community Services (formerly DoCS) ;a. Manage the evacuation centres.b. Provide clothing, accommodation, food and welfare services for floodaffected people, including stranded travellers.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report16 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 378 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.12 Department of Environment, Climate Change & Watera. Provide specialist policy, engineering and scientific advice to councilsand the SES on flood related matters including assistance with:• The identification of flood problems• The preparation of Floodplain Risk Management Plans andassociated studies• The implementation of floodplain risk management plans. Thisinvolves floodplain management projects which include floodmitigation works, flood warning, strategic land use planningand upgrade of evacuation routes• The exercising of Flood Sub Plansb. Provide specialist advice flood related matters as follows:• Provide the SES with access to relevant studies regardingflooding, including Flood Studies and Floodplain RiskManagement Studies• Coordinate the collection of post event flood data, inconsultation with the SES.• Provide advice to the SES in relation to the operation of theHunter Valley Flood Mitigation Scheme• Provide advice to the SES about conditions which may leadto coastal flooding or retarded river drainage near the coast• Collect and maintain flood data relating to flood heights,velocities and discharges in coastal areas of NSW (through acontract with MHL as discussed separately)• Provide data to the Bureau of Meteorology and SES realtimeor near real-time access to river height gauges andheight data for the development of official flood warnings(through a contract with MHL as described in the Responsesection of this plan)c. National Parks & Wildlife Service• Close and evacuate at risk camping grounds in NationalParks managed areas.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report17 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 379 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.13 NSW Fire Brigades, Narrabri, Boggabri & Wee Waaa. Assist with the delivery of evacuation warnings.b. Assist with the conduct of evacuations.c. Provide equipment for pumping flood water out of buildings and fromlow-lying areas.d. Assist with cleanup operations, including the hosing out of floodaffected properties.e. Consider deployment of fire resources within Narrabri if accessbetween West Narrabri & Narrabri is expected to be lost.1.5.14 Industry & Investment NSW;a. Coordinate the supply and delivery of emergency fodder.b. Provide advice on dealing with all animals including dead and injuredfarm animals.c. Provide financial, welfare and damage assessment assistance to floodaffected farm people.d. Coordinate the operation of animal shelter compound, facilitate for thedomestic pets and companion animals of evacuees.Forests NSWe. Close & evacuate at risk camping grounds in Forests NSW managedareas.1.5.15 NSW Police Force, Barwon Local Area Command (LAC):a. Assist with the delivery of evacuation warnings.b. Assist with the conduct of evacuation operations.c. Conduct road and traffic control operations in conjunction with counciland/or RTA.d. Coordinate the registration of all evacuees.e. Secure evacuated areas.f. Secure any vehicle storage area established at the Narrabri Airport.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report18 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 380 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.16 Narrabri Shire Local Emergency Operations Controller (LEOCON):a. Monitor flood operations.b. Coordinate support to the Narrabri SES Local Controller if requested todo so.1.5.17 Narrabri Shire Council Local Emergency Management Officer (LEMO):a. Provide executive support to the Local Emergency OperationsController in accordance with the Narrabri Shire Local Disaster Plan.b. At the request of the Narrabri SES Local Controller, advise appropriateagencies and officers of the activation of this plan.1.5.18 Narrabri Shire Council:a. Maintain a plant and equipment resource list for the council area.b. Contribute to the development and implementation of a publiceducation program.c. At the request of the Local SES Controller, deploy personnel andresources for flood related activities.d. Close and reopen council roads (and other roads nominated byagreement with the RTA) and advise the Narrabri SES Local Controller,the Police and people who telephone the council for road information.e. Provide filled sandbags to urban and village areas in which flooding isexpected.f. Assist with the removal of caravans from caravan parks.g. Provide back-up radio communications.h. In the event of evacuations, assist with making facilities available forthe domestic pets and companion animals of evacuees.i. Provide for the management of health hazards associated with flooding.This includes maintaining water supply and sewerage systems andremoving debris and waste.j. Ensure premises are fit and safe for reoccupation and assess any needfor demolition.k. Establish and maintain floodplain risk management committees andensure that key agencies are represented on such committees.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report19 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 381 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.al. Provide flood studies and floodplain risk management studies to theSES.1.5.19 Rail Corporation New South Wales (Countrylink)a. Arrange trains for evacuations, commuting and/or resupply purposes.1.5.20 Roads and Traffic Authority (RTA):a. Close and reopen the Newell and Kamillaroi Highways when affectedby flood waters and advise the Narrabri SES Local Controller.b. Facilitate the safe reliable access of emergency resources on RTAmanaged roads.c. Assist the SES with identification of road infrastructure at risk offlooding.d. Manage Traffic.e. Assist the SES with the communication of warnings and informationprovision to the public through variable message signs.1.5.21 Rural Fire Service (Namoi Gywdir Team):a. Provide personnel in rural areas and villages to:• inform the Narrabri SES Local Controller about floodconditions and response needs in their own communities, and• disseminate flood information.b. Provide personnel and high-clearance vehicles for flood relatedactivities.c. Assist with the delivery of evacuation warnings.d. Assist with the conduct of evacuations.e. Provide equipment for pumping flood water out of buildings and fromlow-lying areas.f. Assist with the removal of caravans.g. Provide back-up radio communications.h. Assist with cleanup operations, including the hosing of flood affectedproperties.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report20 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 382 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.22 School Administration Offices (including Catholic EducationOffice Armidale, Department of Education & Training Moree andTamworth Regional Offices and Private Schools):a. Liaise with the SES and arrange for the early release of students whosetravel arrangements are likely to be disrupted by flooding and/or roadclosures (or where required, for students to be moved to a suitablelocation until normal school closing time).b. Pass information to school bus drivers/companies and/or other schoolprincipals on expected or actual impacts of flooding.c. Provide space in schools for evacuation centres where necessary.d. Provide to the SES a list of all schools within the Narrabri Shire. Referto Annex K.1.5.23 Telstra:a. Maintain telephone services.b. Repair and restore telephone facilities damaged by flooding.c. Provide additional telecommunications support for the Narrabri SESLocal and/or Unit Headquarters as required.d. Assist the SES to identify infrastructure at risk of flooding forincorporation into planning and intelligence.1.5.24 Transport Services Coordinator:a. Arrange transport facilities for evacuations and/or commuting purposes.1.5.25 Volunteer Rescue Association (VRA), Narrabri:a. Assist the Narrabri SES Local Controller with flood operations, whereequipment and training are suitable.1.5.26 Keepit Dam (State Water) Refer also to Annex I:a. Maintain and operate the Dam Failure Warning System for Keepit Dam.b. Contribute to the development and implementation of a publiceducation program on flooding within the council area.c. Maintain a Dam Safety Emergency Plan and provide copies to the SES.d. Provide information on the consequences of dam failure to the SES forincorporation into planning and flood intelligence.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report21 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 383 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a1.5.27 Split Rock Dam ( State Water ) Refer also to Annex Ia. Maintain and operate the Dam Failure Warning System for Split RockDam.b. Contribute to the development and implementation of a publiceducation program on flooding within the council area.c. Maintain a Dam Safety Emergency Plan and provide copies to the SES.d. Provide information on the consequences of dam failure to the SES forincorporation into planning and flood intelligence.1.5.28 Kamilaroi and Wee Waa Land Council:a. Act as the point of contact between the SES and the Aboriginalcommunity.b. Inform the Narrabri SES Local Controller about flood conditions andresponse needs.c. Disseminate flood information, including flood and evacuationwarningsNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report22 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 384 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aPART 2 - PREPAREDNESS2.1 Maintenance Of This Plan2.1.1 The Narrabri SES Local Controller will maintain the currency of this plan by:a. Ensuring that all agencies, organisations and officers mentioned in it areaware of their roles and responsibilities.b. Conducting exercises to test arrangements.c. Reviewing the contents of the plan:• After each flood operation.• When significant changes in land-use or communitycharacteristics occur.• When new information from flood studies become available.• When flood control or mitigation works are implemented oraltered.• When there are changes that alter agreed plan arrangements.2.1.2 In any event, the plan is to be reviewed no less frequently than every fiveyears.2.2 Floodplain Management2.2.1 The Narrabri SES Local Controller will ensure that the SES:a. Participates in floodplain management committee activities when thosecommittees are formed.b. Consults with the flood prone community about the nature of the floodproblem and its management.c. Informs the Namoi SES Region Headquarters of involvement infloodplain risk management activities.2.3 Development of Flood Intelligence2.3.1 Flood intelligence describes flood behaviour and its effects on the community.2.3.2 The SES will develop and maintain a flood intelligence system.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report23 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 385 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a2.4 Development of Warning Systems2.4.1 The SES will establish and/or maintain a flood warning system for areasaffected by flooding. This requires:a. An identification of the potential clients of flood warning information atdifferent levels of flooding (ie.who would be affected in floods ofdiffering severities),b. Available information about the estimated impacts of flooding atdifferent heights,c. Identification of required actions and the amounts of time needed tocarry them out,d. Appropriate means of disseminating warnings to different clients atdifferent flood levels.2.5 Public Educationa. The Narrabri SES Local Controller, with the assistance of the NarrabriShire Council the Namoi SES Region Headquarters and SES StateHeadquarters, is responsible for ensuring that the residents of thecouncil area are aware of the flood threat in their vicinity and how toprotect themselves from it.2.5.2 Specific strategies to be employed include:a. Dissemination of flood-related brochures and booklets in flood liableareas.b. Talks and displays orientated to community organisations and schools.c. Publicity given to this plan and to flood-orientated SES activitiesthrough local media outlets, including articles in local newspapers aboutthe flood threat and appropriate responses.2.6 Training2.6.1 Throughout this document there are references to functions that must becarried out by the members of the Narrabri, Boggabri, Wee Waa & Pillga SES.The Narrabri SES Local Controller is responsible for ensuring that themembers are:a. Familiar with the contents of this plan.b. Trained in the skills necessary to carry out the tasks allocated to theSES.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report24 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 386 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a2.7 Resources2.7.1 The Narrabri SES Local Controller and the Unit Controllers of the Boggabri,Wee Waa & Pilliga Units are responsible for maintaining the condition andstate of readiness of SES equipment and their respective Local and UnitHeadquarters.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report25 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 387 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aPART 3 - RESPONSE3.1 Control3.1.1 The SES is the legislated Combat Agency for floods and is responsible for thecontrol of flood operations. This includes the coordination of other agenciesand organisations for flood management tasks.3.2 Operations Centres3.2.1 The Narrabri SES maintains an Operations Centre at Reid St Narrabri.3.2.2 Other SES Unit Headquarters and Operations Centres maintained in theNarrabri Shire are as follows;• Wee Waa, Rose St• Boggabri, Brent St• Pilliga, Dangar St3.2.3 The Narrabri Shire Council Emergency Operations Centre is located at thecouncil depot ( facility is shared with the Rural Fire Service) on the NewellHighway West Narrabri.3.3 Operational Management3.3.1 For the purpose of managing flood response operations and evacuations duringmajor floods, the Narrabri Shire will be divided into four operational sectorsbased on SES unit boundaries as follows:a. Narrabri Sector. The Narrabri Sector is controlled by the NarrabriSES Unit and covers Narrabri town and the area bounded by the shireboundary at Bellata, Myall Vale, Culgoora, to the southern shireboundary on the Coonabarabran road, Baan Baa to the Maules Creekarea.b. Boggabri Sector. The Boggabri Sector is controlled by the BoggabriSES and covers Boggabri and the area bounded by Baan Baa, MaulesCreek and south west of Boggabri to the shire boundary.c. Pilliga Sector. The Pilliga Sector is controlled by the Pilliga SES andcovers the village of Pilliga and the area bounded by Gwabegar,Cuttabri, west of Pilliga to the shire boundary and the shire boundary onthe Burren Junction road.d. Wee Waa Sector. The Wee Waa Sector is controlled by the Wee WaaSES and covers the town of Wee Waa and the area bounded by MyallVale, Culgoora, the shire boundary on the western end of the KamilaroiHighway and the north western corner of the shire.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report26 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 388 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.3.2 A map depicting the operational sectors is shown as Map 3.3.4 Liaison3.4.1 At the request of the Narrabri SES Local Controller, each agency withresponsibilities identified in this plan will provide liaison (including a liaisonofficer where necessary) to the Narrabri SES Operations Centre.3.4.2 Liaison officers are to:a. have the authority to deploy the resources of their parent organisationsat the request of the Narrabri SES Local Controller,b. advise the Narrabri SES Local Controller on resource availability fortheir service, andc. be able to provide communications to their own organisations.3.5 Communications3.5.1 The primary means of office-to-office communications is by telephone,facsimile and E mail.3.5.2 The primary means of communication to and between deployed SES resourcesis by SES PMR.3.5.3 All other organisations will provide communications as necessary to theirdeployed field teams.3.5.4 Back-up communications are provided as follows:a. The RFS operates a UHF network that provides coverage of the entirecouncil area.b. The Narrabri Shire Council operates a UHF network to all centreswithin the council area through a base to vehicle system.c. Narrabri VRA – Operates a VHF network across the shire.3.6 Start of Response Operations3.6.1 This plan is always active to ensure that preparedness actions detailed in thisplan are completed.3.6.2 Response operation will begin:a. On receipt of a Bureau of Meteorology Preliminary Flood Warning,Flood Warning, Flood Watch or a Severe Weather Warning.b. On receipt of a dam failure alert for Split Rock or Keepit Dams.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report27 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 389 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ac. When other evidence leads to an expectation of flooding within thecouncil area.3.6.3 Contact with the Bureau of Meteorology to discuss the development of floodwarnings will normally be through the Namoi SES Region Headquarters.3.6.4 The following persons and organisations will be advised of the start ofresponse operations regardless of the location and severity of the floodinganticipated:a. Narrabri SES Local Controllerb. Boggabri, Pilliga and Wee Waa SES Unit Controllersc. Narrabri Shire Local Emergency Operations Controller (fortransmission to the NSW Police Force Local Area CommandHeadquarters).d. Namoi SES Region Headquarters.e. Narrabri Shire Council Local Emergency Management Officer (fortransmission to appropriate council officers and departments).f. Narrabri Shire Council Mayor.3.6.5 Other agencies listed in this plan will be advised by the LEMO on the requestof the Narrabri SES Local Controller and as appropriate to the location andnature of the threat.3.7 Flood Intelligence3.7.1 Sources of flood intelligence during times of flooding include:a. Bureau of Meteorology. ( www.bom.gov.au) The Bureau provides:• Flood Watches, which give an early appreciation of developingmeteorological situations that could lead to flooding. These arenormally provided on a whole-catchment basis for the NamoiRiver.• Flood Warnings, which include river height readings andheight-time predictions. The gauges for which predictions areprovided for are listed in Annex C.• Weather Forecasts warning of potential storm activity includingSevere Weather Warnings and Severe Thunderstorm Warnings.b. Namoi SES Region Headquarters. The Region Headquartersprovides information on flooding and its consequences, including thosein nearby council areas.c. Narrabri Shire Council road closure bulletins.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report28 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 390 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ad. Keepit Dam-Failure Warning System. This system providesinformation on Keepit Dam.e. Split Rock Dam-Failure Warning System. This system providesinformation on Keepit Dam.f. NSW Office of Water. This office advises flow rates and rates of risefor the Namoi River. Daily river reports containing information ongauge heights and river flows are available from the website:http://waterinfo.nsw.gov.au/index.htmlg. Active Reconnaissance. The SES monitors a number of problem areassuch as low points on roads, flood runners and levees. These include;• Narrabri - Newell Highway• Wee Waa – Kamillaroi Highway (Glencoe Channel)• Wee Waa Levee3.8 Preliminary Deployments3.8.1 When flooding is expected to be severe enough to cut road access to towns,within towns and/or rural communities, the Narrabri SES Local Controller willensure that resources are in place for the distribution of foodstuffs and medicalsupplies to the areas that could become isolated.3.8.2 When access between Narrabri & Narrabri West is expected to be cut, theNarrabri SES Local Controller will advise appropriate agencies so thatresources (including sandbags, fire fighting appliances, ambulances, etc.) maybe deployed to ensure that operational capability is maintained.3.9 Warnings3.9.1 Warning services operate according to the following arrangements:a. The Narrabri SES Local and/or Unit Headquarters:• Provides advice to the Namoi SES Region Headquarters oncurrent and expected impacts of flooding.• Coordinates the delivery of warnings to the community by doorknocking,telephone, mobile public address systems, local radiostations and two-way radio.b. The Namoi SES Region Headquarters issues warning information in theform of SES Region Flood Bulletins to:• Media organisations and agencies listed in Annex D.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report29 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 391 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.9.2 Bureau of Meteorology Severe Thunderstorm Warning. These are issueddirect to the media by the Bureau when severe thunderstorms are expected toproduce dangerous or damaging conditions, including flash flooding. Severethunderstorms are usually smaller in scale than events covered by FloodWatches and Severe Weather Warnings.3.9.3 Bureau of Meteorology Severe Weather Warning for Flash FloodingThese are issued direct to the media by the Bureau and provide a warning ofthe possibility for flash flooding as a result of intense rainfall. These warningsare issued when severe weather is expected to affect land based communitieswith 6 to 24 hours. Severe Weather Warnings may also include otherconditions such as hail and damaging winds.3.9.4 Bureau of Meteorology Flood Watches. Flood Watches are issued by theBureau to advise people of the potential for flooding in a catchment area basedon predicted or actual rainfall. Flood Watches will be included in SES FloodBulletins issued by the Namoi SES Region Headquarters.3.9.5 Bureau of Meteorology Flood Warnings. The Namoi SES RegionHeadquarters upon receiving a Bureau Flood Warning applicable to theNarrabri Shire will issue a flood bulletin with information on the estimatedimpacts of flooding at the predicted heights. Distribution as per annex D.3.9.6 SES Livestock and Equipment Warnings. Following heavy rain or whenthere are indications of significant creek or river rises (even to levels belowMinor Flood heights), the Narrabri SES Controller will advise the Namoi SESRegion Headquarters which will issue SES Livestock and EquipmentWarnings. Distribution as per Annnex D.3.9.7 SES Local Flood Advices. The Narrabri SES Local Controller may issueLocal Flood Advices for locations not covered by the BOM Flood Warnings.They may be provided verbally in response to phone inquiries but willnormally be incorporated into SES Region Flood Bulletins. They will bedistributed to agencies listed in Annex D3.9.8 SES Flood Bulletins. The Namoi SES Region Headquarters will regularlyissue SES Flood Bulletins which describe information on the estimatedimpacts of flooding at the predicted heights (using information from BureauFlood Warnings and SES Local Flood Advices) to SES units, media outletsand agencies on behalf of all SES units in the Region. Distribution as perannex D.3.9.9 SES Evacuation Warnings and Evacuation Orders. These are usuallyissued to the media by the SES Namoi Region Controller on behalf of the SESNarrabri Local Controller. A template guide to the content of evacuationwarning and evacuation order messages is at Annex E.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report30 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 392 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.9.10 Special Warnings. The SES may issue Special Warnings to SchoolAdministration Offices including the Catholic Schools Office Armidale,Department of Education Employment and Training Moree Regional Officeand Private Schools particularly if it is appropriate for students to avoid traveland stay home from school or to be released early from school.3.9.11 Dam Failure Alerts. Dam failure alerts are issued to the SES by the damowner, in accordance with arrangements in the Dam Safety Emergency Plan(DSEP), the system involves the Dam Owner notifying SES StateHeadquarters Communications Centre, who in turn distribute the warning tothe SES Region Headquarters and SES Unit Headquarters.3.9.12 A flow chart illustrating the notification arrangements for potential dam failureis shown in Annex I.3.9.13 Dam failure alert levels are set in consultation with the SES and are used totrigger appropriate response actions. The conditions that define each of thealert levels are listed in the relevant DSEP. Responses escalate as the alertlevel migrates from white to amber to red. The below table briefly outlinesexampled defining conditions and appropriate SES responses associated witheach alert.AlertLevelWhiteAmberRedExample DefiningConditionMay be a structuralanomaly.May be increasedmonitoring inresponse to a heavyrainfall eventFailure possible ifstorage levelcontinues to rise orstructural anomaly notfixedFailure imminent oroccurredSES ResponseImplements notificationflowchart.Check operationalreadiness.Implements notificationflowchart.Warn downstreampopulation at risk toprepare to evacuateImplements notificationflowchart.SES WarningProductThis is a preliminaryalert to assist the SES inits preparation. This isnot a public alert.SES Evacuation WarningSES Evacuation OrderEvacuation ofdownstream populationsNote: Some DSEPs will have alert levels that proceed directly from White to Red. This is the case ifadequate time does not exist between the three alert levels to evacuate the downstream population atrisk. The decision to omit the Amber Alert level, and the general setting of Alert levels should beundertaken in consultation with the SES.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report31 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 393 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.9.14 The SES will disseminate warnings to the population at risk of dam failure(these arrangements are specific to each dam, are negotiated between the DamOwner and SES, and are documented in the DSEP).3.9.15 Special arrangements apply in the case of severe flooding that may have thepotential to cause the failure of Keepit or Split Rock Dams. Details of thesearrangements are described in Annex I.3.9.16 Standard Emergency Warning Signal (SEWS). This signal may be playedover radio and television stations to alert communities to EvacuationWarnings, Evacuation Orders, Special Warnings or Dam-Failure Warnings.Approval to use the signal is associated with who approves the warning/ordermessage.3.10 Information3.10.1 The Namoi SES Region Headquarters issues SES Flood Bulletins to mediaoutlets and agencies on behalf of all SES units in the Region. SES FloodBulletins contain the following information relating to all council areas inwhich flooding is occurring:a. Current warnings, together with indications of the likely impact offlooding at any predicted heights.b. Current flood heights and flood behaviour.c. Details of conditions and closures of main roads.d. Advice on safety matters and means of protecting property.3.10.2 The Narrabri SES Local Headquarters provides a “phone-in” informationservice for the community in relation to current warnings, river heights, floodbehaviour, road conditions and closures of local and main roads and advice onsafety matters and means of protecting property.3.10.3 Collation and dissemination of road information is actioned as follows:a. The Narrabri Shire Council provides road status reports for main roadsin the council area to the Narrabri SES Headquarters, the Namoi SESRegion Headquarters Road Information Cell and to the Barwon PoliceLocal Area Command Headquarters. This information is alsodistributed by Narrabri Shire Council to other members of the LocalEmergency Management Committee.b. The Roads & Traffic Authority provides information on the Newell &Kamillaroi Highways.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report32 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 394 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ac. The Namoi SES Region Headquarters distributes information on mainroads to SES units.3.10.4 The Narrabri SES Local Controller is to ensure that the Namoi SES RegionController is regularly briefed on the progress of operations and on futureresource needs.3.11 Road Control3.11.1 A number of roads within the council area are affected by flooding. Detailsare provided in Annex B.3.11.2 The council closes and re-opens its own roads. Council also in its capacity asagent for the RTA opens and closes the Kamillaroi Highway and the NewellHighway inside the Narrabri Town Boundary.3.11.3 The NSW Police Force has the authority to close and re-open roads but willnormally only do so (if the council or the RTA have not already acted) ifpublic safety requires such action.3.11.4 When resources permit, the SES assists Council or the Police by erecting roadclosure signs and barriers.3.12 Traffic Control.3.12.1 In the event of flooding, the Narrabri SES Local Controller may direct theimposition of traffic control measures. The entry into flood affected areas willbe controlled in accordance with the provisions of the State EmergencyService Act, 1989 (Part 5, Sections 19, 20, 21 and 22) and the StateEmergency Rescue Management Act, 1989 (Part 4, Sections 60KA, 60L and61).3.13 Flood Rescue3.13.1 The Narrabri SES Local Controller is responsible for the coordination of floodrescue.3.13.2 Flood rescues, may be carried out by accredited units in accordance withappropriate standards3.13.3 Additional flood boats and crews can be requested through the Namoi SESRegion Headquarters.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report33 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 395 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.14 Evacuations3.14.1 When there is a risk to public safety, evacuation is the primary strategy.(Refer also to Annex F for detailed comments) Circumstances may include:a. Evacuation of people when their homes or businesses are likely toflood.b. Evacuation of people who are unsuited to living in isolatedcircumstances, due to flood water closing access.c. Evacuation of people where essential energy and utility services havefailed or where buildings have been made uninhabitable.3.14.2 In most cases the decision to evacuate rests with the Narrabri SES LocalController who exercises his/her authority in accordance with Section 22(1) ofThe State Emergency Service Act 1989. However, the decision to evacuatewill usually be made after consultation with the Namoi SES Region Controllerand the Local Emergency Operations Controller (LEOCON).3.14.3 During floods evacuations will be controlled by the SES. Small-scaleevacuations will be controlled by the Narrabri SES Local Controller. Shouldthe scale of evacuation operations be beyond the capabilities of local resourcescontrol may be escalated to the Namoi SES Region Controller.3.14.4 During most floods in the Narrabri Shire there is little call for evacuations. Asmall number of homes in Narrabri and a number of homes in rural areassurrounding Boggabri, Narrabri & Wee Waa are however affected by floodingat minor to moderate levels. This situation however changes dramaticallyduring major flooding.3.14.5 During major flooding evacuations are required in Narrabri. In a 2 % AEP(9.60 metres on the Narrabri Creek Gauge) flood it has been estimated that upto 520 homes and 230 commercial premises could experience over floorinundation. In a 1% AEP flood (10.20 metres on the Narrabri Creek gauge) thenumber of properties affected by over floor level flooding could expand to1000 homes and up to 280 commercial premises. Evacuees may well need tobe relocated to other towns3.14.6 At Wee Waa the evacuation of the entire township may be required if thelevee is threatened with overtopping or failure. The population of Wee Waa is1800. Wee Waa is a low flood island. The evacuation trigger height is 7.25metres on the Wee Waa ( Glencoe ) Gauge.3.14.7 Evacuations will be controlled by the Narrabri SES Local Controller andconducted by SES and other emergency service personnel.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report34 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 396 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.14.8 When evacuations are possible, the Narrabri SES Local Controller will adviserelevant NSW Community Services personnel so that evacuation centres andwelfare support can be set up in timely fashion.3.14.9 Some residents may make their own decision to evacuate and move toalternative accommodation using their own transport. Such evacuees must beadvised via the media to inform the Police or the SES of their evacuation andtheir temporary address.3.14.10Field teams conducting doorknocks will record and report back to theOperations Centre:a. Addresses and locations of houses doorknocked and/or evacuated.b. Number of occupants.c. Details of support required (such as transport, medical evacuation,assistance to secure house and/or property and raise or movebelongings).3.14.11The field teams will then carry out evacuations as required. Details of thesepremises will be passed to the Narrabri Police Station.3.14.12The NSW Police Force will provide security for evacuated areas and at anyMotor Vehicle Storage Area established at the Narrabri Airport.3.14.13Evacuees will be taken to or advised to go to the nearest accessible evacuationcentre, which may initially be established at the direction of the Narrabri SESLocal Controller but which will be managed as soon as possible by NSWCommunity Services. Details of sites which may be used as evacuation centresare detailed in Annex “F”.3.14.14On arrival, evacuees will be registered, medically checked if necessary andprovided with their immediate welfare needs.3.14.15The caravan parks known to be flood liable are listed in Annex G, along witharrangements relating to the evacuation of residents and the removal ofcaravans.3.14.16Transport and storage of furniture from flood-threatened properties will bearranged as time and resources permit. A vehicle parking location above floodwaters will be provided at the Narrabri Airport.3.15 Registration3.15.1 NSW Police Force will ensure that all evacuees are registered on arrival atevacuation centres and details of registrations are sent to the Police Local AreaCommand as soon as possible.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report35 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 397 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.16 Management Of Evacuees’ Pets3.16.1 In the event of a large-scale evacuations of in the Narrabri Shire, animalshelter compound facilities will be set up for domestic animals and companionanimals. These facilities will be operated by Industry & Investment NSW.3.16.2 Assistance animals are to accompany and/or remain in the care of their ownersat all times. This includes transport and access into evacuation centres.Assistance animals (guide dogs, hearing assistance animals, etc) will remain inthe care of their owners throughout the evacuation. This includes transport andaccess into evacuation centres etc. Due to safety restrictions, it may not bepossible to allow companion animals to accompany their owners when beingtransported via aircraft or flood rescue boats.3.17 Essential Services3.17.1 The Narrabri SES Local Controller will ensure that the providers of essentialservices (electricity, water, sewerage, medical and public health) are keptadvised of the flood situation. Essential service providers must keep theNarrabri SES Local Controller abreast of their status and ongoing ability toprovide those services.3.18 Logistics3.18.1 The Narrabri SES Local Headquarters maintains a small stock of sandbags,and back-up supplies are available through the Namoi SES RegionHeadquarters. A motorised sandbag-filling machine is available from SESUnits at Narrabri, Boggabri & Wee Waa. Alternatively, local concrete trucksmay be used.3.19 Aircraft Management3.19.1 Aircraft can be used for a variety of purposes during flood operationsincluding evacuation, rescue, resupply, reconnaissance and emergency travel.See also comment at Annex B Item 16.3.19.2 Air support operations will be conducted under the control of the SES RegionHeadquarters, which may allocate aircraft to units if applicable.3.19.3 Helicopter Landing Points. Suitable landing points are detailed at clause 22in Annex F.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report36 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 398 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.19.4 Airport. Access to the airports is lost as follows;Narrabri Airport access to the airport is lost to normal vehicles when a heightof 8 metres is reached on the Narrabri Creek Gauge. Access for high clearancevehicles may be maintained until 9.0 metres. An alternative route may beavailable for high clearance 4wd emergency vehicles via Doyle and LittleMountain Road depending on local flooding. The airport is capable of handlingC130 Hercules and Dehaviland (Bombardier) Dash 8 aircraft.Wee WaaAccess to Wee Waa Airport is usually lost when a height of 6.7 metres isreached on the Wee Waa Gauge. This creates a reliance on the use of rotarywing aircraft at Wee Waa.3.20 Resupply of Isolated Towns and Villages3.20.1 The SES is responsible for the coordination of the resupply of isolatedcommunities. If flood predictions indicate that areas are likely to becomeisolated, the Narrabri SES local Controller should advise businesses (normallythrough the Narrabri Shire Council) that they should stock up.3.20.2 When isolation occurs, storekeepers will be expected to place orders onsuppliers where they have a line of credit and to instruct those suppliers topackage their goods and deliver them to loading points designated by the SES.3.20.3 Where practicable the Narrabri SES Local Controller will arrange for thedelivery from normal suppliers of essential foodstuffs, fuels or urgent medicalsupplies required by an isolated property or community. This may be doneusing high clearance vehicles, floodboats or, on occasions, aircraft.3.20.4 The Narrabri Shire Council will establish and chair a vetting committee toensure that only essentials are ordered and that the business requesting thesupplies is not using the flood as a means of restocking free of charge.3.20.5 Where supplies are not available within the council area, the Narrabri SESLocal Controller may request them through the Namoi SES RegionHeadquarters. The Region Headquarters will usually arrange for them to bedelivered to the Narrabri SES Local Controller for further distribution withinthe council area.3.20.6 The SES is prepared to deliver mail to isolated communities but may not beable to do so according to normal Australia Post timetables, and will assisthospitals with resupply of linen and other consumables.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report37 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 399 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.21 Resupply of Isolated Properties3.21.1 The resupply of isolated properties is a common requirement during floodsand coordination can be difficult because requests can emanate from a varietyof sources. Property owners may call their suppliers direct or place theirorders with the Narrabri or Wee Waa SES, through NSW CommunityServices, or through their own social networks.3.21.2 The principles to be applied when planning for the resupply of isolatedproperties are:a. The SES will coordinate resupply and establish a schedule.b. NSW Community Services will liaise with the SES concerning propertyholders who place orders with them. They will include people in direcircumstances who receive resupply at no cost. NSW CommunityServices has a well developed system for this situation, including astandard list of approved resupply items.c. If a property holder seeks resupply from the SES and claims to be, or isconsidered to be, in dire circumstances, he/she is to be referred to NSWCommunity Servicesd. Local suppliers will liaise with the SES regarding delivery of resupplyitems to the designated loading point.e. Local suppliers are responsible for packaging resupply items fordelivery.3.22 Assistance for Animals3.22.1 Matters relating to the welfare of livestock, companion animals and wildlife(including feeding and rescue) are to be referred to Industry & InvestmentNSW3.22.2 Requests for emergency supply and/or delivery of fodder to stranded livestock,or for livestock rescue, are to be passed to Industry & Investment NSW.3.23 Stranded Travellers3.23.1 Flood waters can strand travellers. Travellers seeking assistance will bereferred to NSW Community Services for the arrangement of temporaryaccommodation.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report38 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 400 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a3.24 All Clear3.24.1 When the danger to life and property has passed the Narrabri SES LocalController or the SES Namoi Region Controller will issue an 'all clear'message signifying that response operations have been completed. Themessage will be distributed through the same media outlets as earlierevacuation messages. The relevant Controller will also advise details ofrecovery coordination arrangements, arrangements made for clean upoperations prior to evacuees being allowed to return to their homes, and standdowninstructions for agencies not required for recovery operations.3.24.2 A template guide to the content of an all clear message is contained in AnnexE – Template Evacuation Warning, Evacuation Order and All Clear.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report39 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 401 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aPART 4 - RECOVERY4.1 Recovery Coordination at the Local level4.1.1 The Narrabri SES Local Controller will ensure that planning for long-termrecovery operations begins at the earliest opportunity, initially throughbriefing the Local Emergency Management Committee (LEMC). As soon aspossible the LEMC will meet to discuss recovery implications including theneed for a Local Recovery Committee. The LEMC will consider any impactassessment in determining the need for recovery arrangements. This isconveyed in the first instance to the State Emergency Operations Controller(SEOCON) for confirmation with the State Emergency Recovery Controller(SERCON). Community Services will provide for the long-term welfare ofpeople who have been evacuated.4.1.2 Once the need for recovery has been identified, the SERCON, in consultationwith the SEOCON, may recommend the appointment of a Local RecoveryCoordinator and nominate an appropriate candidate to the Minister forEmergency Services.4.1.3 The SERCON may send a representative to the LEMC and subsequentrecovery meetings to provide expert recovery advice and guidance.4.1.4 The Narrabri SES Local Controller and Local Emergency OperationsController (LEOCON) attend recovery meetings to provide an overview of theemergency response operation.4.1.5 The SES Namoe Region Controller, the District Emergency ManagementOfficer (DEMO) and appropriate District Functional Area Coordinators willbe invited to the initial local meeting and to subsequent meetings as required.4.1.6 The Recovery Committee will;a. develop and maintain a Recovery Action Plan with an agreed exitstrategyb. monitor and coordinate the activities of agencies with responsibility forthe delivery of services during recoveryc. ensure that relevant stakeholders, especially the communities affected,are involved in the development and implementation of recoveryobjectives and strategies and are informed of progress maded. provide the SERCON with an end of recovery reporte. ensure the recovery is in line with the National Principles of DisasterRecovery and the NSW tenetsNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report40 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 402 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a4.2 Recovery Coordination at the District Level4.2.1 In the event that that an emergency affects several local areas, a DistrictEmergency Management Committee (DEMC) will meet to discuss recoveryimplications including the need for a District Recovery Committee. This isconveyed in the first instance to the SEOCON for confirmation with theSERCON.4.2.2 In the event of an emergency which affects multiple districts, or is of state ornational consequence, or where complex, long term recovery andreconstruction is required, it may be necessary to establish a State RecoveryCommittee and the appointment of a State Recovery Coordinator.4.3 Arrangements for Debriefs / After Action Reviews4.3.1 As soon as possible possible after flooding has abated, the Narrabri SES LocalController will advise participating organisations of details of responseoperation after action review arrangements.4.3.2 The Narrabri SES Local Controller Local Controller will ensure that adequatearrangements are in place to record details of the after action review and eachitem requiring further action is delegated to an organisation or individual toimplement.4.3.3 Follow-up to ensure the satisfactory completion of these actions will beundertaken by the Narrabri Shire Council Local Emergency ManagementCommittee.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report41 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 403 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX A - THE FLOOD THREATLandforms and River System(s)The Namoi River Basin1. The Namoi River ( also known as the Macdonald River in its upper reaches) isone of the major tributaries of the Barwon-Darling River system and drains anarea of about 43,000 square kilometres (approximately 6% of NSW) extendingfrom near Walcha westward to Walgett. The main headwater tributaries are theManilla and Peel Rivers and downstream, at Gunnedah, the Mooki River.2. The Manilla and Namoi Rivers flow from the high mountainous country in thenorth of the catchment and combine at Manilla upstream of Keepit Dam. Thecontributing catchment area to the dam measures approximately 5,700 km 2 andis capable of producing high runoff peaks. The Peel River drains the easternportion of the catchment to join the Namoi at Carroll Gap immediately belowKeepit Dam. The Peel draining an additional 4,670 km 2. . The south-easternportion of the catchment is drained by the Mooki River which quickly falls ontothe flat terrain of the Liverpool Plains downstream of Quirindi. At Breeza, theMooki catchment area is 3,630 km 2 .3. Downstream of Carroll and Breeza, the Namoi and Mooki Rivers flow onto anexpansive floodplain before combining just upstream of Gunnedah. The totalcontributing catchment area at Gunnedah is approximately 17,100 km 2 .4. The Manilla and Peel Rivers both provide higher runoff than the Mookialthough high flows from the Mooki catchment can severely influence floodconditions at Gunnedah and further downstream when coinciding with majorflows in the Namoi itself.5. Both the Coxs and Maules Creeks join the Namoi River below Gunnedah.WhileBohena Creek joins the Namoi River immediately downstream of Narrabri.The Namoi River6. The MacDonald (or Namoi) River rises on the New England Plateau to the eastof Tamworth in the Woolbrook area. It flows north west through to Manilla,Gunnedah & Narrabri ultimately joining the Barwon River at Walgett. TheRiver changes name to the Namoi River after passing Boundary Creek in theranges to the Northeast of Manilla. The major tributaries of the Namoi drainfrom the New England Plateau in the east, the Nandewar Ranges in the north,and the Liverpool Range and the Warrumbungle Ranges in the south.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report42 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 404 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aThe Namoi and its Tributaries Upstream of Narrabri7. An important tributary from the east, the Peel River, flows into the Namoi Riverbelow Keepit Dam. The Peel River rises in the Nundle area to the east ofTamworth. The Peel River is joined by the Cockburn River, Goonoo GoonooCreek, the Tangaratta & the Attunga Creeks near Tamworth.8. The Manilla River that rises in the Barraba area flows south easterly some 50kilometres to join the Namoi River at Manilla. Split Rock Dam is locatedapproximately 30 kilometres upstream of Manilla on this river.9. On low lying land below its junction with the Peel River below Keepit Dam, theNamoi flows west across the Liverpool Plains to Gunnedah. This area is subjectto extensive local flooding plus extensive riverine flooding as the Namoi watersare joined from the south by those of the Mooki River. The Mooki and itstributaries, including Werris and Quirindi Creeks, drain the southern part of theLiverpool Plains and joins the Namoi just east of Gunnedah.10. From Gunnedah downstream the Namoi is carrying the waters of its three majortributary basins, the Manilla, the Peel and the Mooki. The Namoi Riverfloodplain between Gunnedah and just downstream of Narrabri is quite flat anda small channel capacity means that low-lying overbank areas are generallysusceptible to widespread and lengthy flooding11. At Boggabri, the Namoi River is joined by Cox's Creek from the left and beforereaching Narrabri is joined by Maules Creek from the right. A high flow inCox's Creek where it joins the Namoi River at Boggabri will force floodwatersto the east into the Barber's Lagoon area. Once this area is full, the water flowsto the north and rejoins the Namoi below the Iron Bridge on the Boggabri toManilla Road just near Gin's Leap.The Namoi River at Narrabri12. About 2.5 km upstream of the Narrabri town centre, the Namoi River dividesinto two branches, the Namoi River and Narrabri Creek, both these flow throughNarrabri approximately 500 metres apart. The two branches join back togetherabout 10 km downstream of Narrabri. Under low flow conditions, all flow iscarried by Narrabri Creek. A large sand and gravel bar in the Namoi River at itsoff take from Narrabri Creek prevents water from entering the Namoi Riveruntil local low-level flooding from Narrabri Creek starts to occur. Each of thesemajor flow paths has a gauge. These two gauges do not give the same level fora particular flood nor do they have the same gauge zero. After the winter floodsof July-August 1998, it was decided that all future warnings would be made forthe Narrabri Creek gauge. SES flood intelligence for Narrabri is also based onthe height at the Narrabri Creek gauge.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report43 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 405 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a13. Flood problems in Narrabri are exacerbated by the following water courses thatact as high-level flood runners that fragment the urban area at flood times:a. Lagoon Creek,b. Eathers Creek,c. O’Briens Creek,d. Doctors Creek,e. Mulgate Creek,f. Horsearm Creek, andg. Long Gully.14. Flood producing rain can originate from any of a number of sources, and eachof the contributing catchments is quite large. Storm centres may be located overthe upper eastern catchment boundary, over the Nandewar Range in the northeast,over the Liverpool Range in the south-east, over the Warrumbungle Rangeto the south or even over the middle of the plains as occurred in 1974.15. With Narrabri Creek now acting as the main stream, the Namoi River does notflow through Narrabri until a height of 3.60 metres (measured at the NewellHighway on Narrabri Creek – the Narrabri Creek gauge). The Namoi Riverthen flows with a higher peak level until about 5.0 metres when the twochannels even out. This occurs because of the development of a number ofother flood runners as follows.16. O'Brien's Creek and Eather's Creek breakout from the left bank of the NamoiRiver at about 5.9 metres (Narrabri Creek gauge). They feed into the NarrabriLake system to the south of Ugoa Street and then move back into the river.17. A breakout then occurs on the right bank of the Namoi River, downstream ofEathers Creek flowing into the Dangar Village.18. The next breakout is from the left bank of Narrabri Creek downstream of theNewell Highway. This develops into a flood runner, cutting Gibbons Streetnear the golf course and then flowing north across the Island Road.19. The last flood runner to develop is Lagoon Creek. This leaves the left bank ofNarrabri Creek upstream of the railway line (at about 8.30 metres on theNarrabri Creek gauge) and floods the Gibbons Street/Grace Street area, beforemoving across to the Namoi River near the Newell Highway Bridge.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report44 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 406 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a20. These flood runners start to develop during minor levels of flooding. Theirfuture behaviour may be significantly affected by the widening of the floodwayunder both the rail and road bridges over Narrabri Creek. As flood levels rise,more minor overbank flows develop until much of the town is inundated anddivided by floodwaters into six distinct precincts. These flood runners cancontinue for significant periods of between three to 16 days (eg. 1955 - 3 days,1971 – 16 days, 1974 – 6 days and 1976 – 4 days).21. A further flood runner can develop to ease the flooding problem in the town. Atabout 8.5 metres (Narrabri Creek gauge), floodwaters can breakout from theright bank of Narrabri Creek above the railway line and flow through HorsearmCreek and Doctor's Creek and back into the Narrabri Creek downstream of thetown. However, the capacity of this runner is dependent on whether or not theNandewar Creeks from the north are in flood.The Namoi River Downstream of Narrabri22. Below Narrabri, the river becomes a slow moving stream, which is joined byBohena ( approx 10 kms downstream ) and Coghill Creeks at Cuttabri which isbelow Wee Waa on its left bank and by a number of watercourses that drain thePilliga Scrub area. Although not contributing significantly to the flow of theNamoi River in normal periods, these streams can cause extensive shallowflooding which can persist for up to ten days.23. As far as Wee Waa, the flood pattern is largely dependent on the source of therunoff. If floodwaters originate in the upper catchment and are contained withinthe Namoi River flood plain itself, then major spreading of flood flows do notoccur until about Myall Vale, some 10 kilometres upstream of Wee Waa. Atthis location, major outflow occurs on both banks of the river, most significantlyon the northern bank.24. The alternate flood pattern is caused by local runoff from the streams drainingthe south-western slopes of the Nandewar Range. Spring, Bobbiwaa andGalathera Creeks form the main drainage pattern of this region. All have quitesmall channels and when in flood, spread over wide areas of cultivated land.Most of these flood flows, do not join the Namoi River, but veer to the northwest,ultimately joining the Thalaba Creek and the Barwon River system.25. The floodwaters that move north from Myall Vale flood large tracts of land onthe north-west floodplain, through Spring Plains to the Doreen area andeventually into Pian Creek and ultimately back to the Namoi River immediatelyupstream of Walgett.26. The water breaking to the south from Myall Vale develops as a flood runneralong the side of the Narrabri Road. It initially flows towards Wee Waa, thenthrough O'Briens Creek and the Wee Waa Lagoon and back into the NamoiRiver, thus effectively isolating Wee Waa.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report45 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 407 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a27. The Wee Waa to Pilliga Road can be cut by back-up flooding out of the NamoiRiver itself, although flooding from the Pilliga Scrub area (Bundock or MiddleCreek and Nuble Creek) can produce high enough flooding in the Lagoon to cutthis road.28. Immediately above and below Wee Waa, flood flows leave the Namoi via anumber of effluents, the most significant being Gunidgera and Pian Creeks.With the exception of high ridges adjacent to and to the north of Pian Creek,virtually all of the country west of Wee Waa is inundated during major floods.The floods in the river itself can be severely affected by high runoff that flowsfrom the south out of the Pilliga Scrub to join the river both upstream anddownstream of Wee Waa. In fact these flows can be of sufficient magnitude tocreate severe flooding problems themselves even if there is no significant flowin the river from upstream catchments.29. The flat nature of the terrain in the western parts of the valley allows largequantities of waters to be temporarily stored on the flood plain and the smallcapacities of the major river and creek channels only allow very slow drainageof this water.30. Floodwaters in the Pian Creek and Gunidgera Creek both rejoin the Namoi - theGunidgera upstream of the village of Pilliga and the Pian just before the Namoijoins the Barwon River. Flooding in the lower riverine area can be extensiveand last for up to 21 days. At the lower end of the valley, flood behaviour canalso be significantly affected by flooding in the adjacent Gwydir andCastlereagh River Basins.Storage Dams31. Detailed comments regarding Dam Failure Warning and Evacuation arecontained at Annex I for both Keepit Dam and Split Rock Dam .32. Keepit Dam. The largest storage on the Namoi River above Narrabri is KeepitDam about 55 kilometres upstream of Gunnedah. Storage capacity is 425,510megalitres. Although the dam is for conservation storage it can have mitigatingeffects on some floods. The dams impact on peak flood levels are morenoticeable close to the dam and less marked further down the river due to thecontributing catchment area below the dam and the natural flattening offloodwaters moving downstream. State Water usually operate Keepit Dam sothat peak releases from the dam do not coincide with Peel River peak flows. ThePeel River joins the Namoi immediately below Keepit Dam. This provides amitigating effect on downstream flood levels33. Split Rock Dam Split Rock Dam is situated on the Manilla River, about 30 kmupstream of Manilla with the Tamworth Regional Council local governmentarea.. The purpose of the dam is to provide water supply for irrigation, stock,domestic, urban and industry in the Namoi River Basin. The dam wasconstructed in 1988, full supply level is 397, 370 megalitres (ML). This dam isoperated by State Water in conjunction with Keepit Dam.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report46 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 408 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aWeather Systems and Flooding34. Historical records indicate that most common months for flooding in theNarrabri Shire are January, February and July.35. The most severe floods recorded have mostly occurred in the summer months,particularly January and February when summer cyclonic weather systems oftenmove south from Queensland and the Northern Territory. In these wettermonths the catchment is often saturated and more liable to flooding.36. Fronts passing the state from west to east, usually during the cooler months ofthe year, normally constitute the principle flood producing mechanisms of thesouthern inland parts of the state and winter flooding from frontal systems isless common in the more northern inland parts of the state. It can happen,however, and was experienced in 1998 on the Namoi River which had severalflood peaks in quick succession between July and September as the result ofrains from the passage of frontal systems.Characteristics of Flooding37. Some indicative peak flow timings on the Namoi River are shown in the tablebelow:From To Travel TimesKeepit Dam Gunnedah 18-21 hoursGunnedah Boggabri 24-30 hoursGunnedah Narrabri 45 hours (range 20-50 hours)Tambar Springs Boggabri 30 hoursBoggabri Narrabri 20-24 hoursTarrawan Narrabri 6-12 hoursNarrabriMollee Weir/confluence with 6 hoursBohena Creek gauge (NewellHwy)Bohena creek.Namoi RiverFigure 1 - Estimated peak flow travel times20 hours38. Over the past two decades changes in land use to high value, irrigated croppinghave been accompanied by large-scale private construction of levee banks andraised canals, particularly on the plains downstream of Narrabri. Although aseries of floodway restoration schemes have been undertaken, these activitiesstill have the potential to significantly affect previously existing flood flowpatterns.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report47 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 409 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a39. The approximate rate of rise of floodwaters in Narrabri has been estimated asfollows (Note: These are indicative timings only and can vary in major events):a. From minor to moderate flood levels (4.9 – 6.4 metres), about 6 – 12hours.b. From moderate flood level to a 10% AEP level (6.4 – 7.1 metres), about1 – 2 hours.c. It is likely that Narrabri would then have a minimum of about six hoursfor the flood height to reach the major flood level (6.7 metres) and thena minimum of another three hours to reach the 5% AEP level of 8.26metres.Flood History40. February 1955. This was the largest flood to occur in the lower Namoi Basin.At Narrabri the peak height reached 9.4 metres on the Narrabri Creek gauge(8.56 metres on the Narrabri gauge on the Namoi River) and was rated as beingapproximately a once-in-50-years flood (2% AEP), while at Gunnedah it wasabout a once-in-100-years flood (1% AEP). At Wee Waa the flood reached9.12 metres on the Wee Waa (Glencoe) gauge. Flow in the Namoi River wasincreased by high contributions from the Manilla and Mooki rivers but therewere particularly high flows in the Peel River. Most of Narrabri, except forhigh ground in Narrabri West, was inundated to significant depths.41. February 1971. The 1971 flood was not only a major event; it was verydamaging because of its long duration. This combined contribution made thisevent the second highest flood at Gunnedah and Narrabri. A saturated NamoiBasin and continuing rainfall resulted in the largest flood volume ever measuredat Narrabri. In addition to flooding from the Namoi River, very high rainfall inthe Mulgate Creek catchment in the Nandewar Ranges caused initial flooding inthe north-east part of town. Peak flood levels in this area of Narrabri occurredabout three days before the peak flood level from Namoi River flooding.Further downstream the flooding was worsened by concurrent flooding in thePilliga streams and a moderate flood on the Barwon. This combination resultedin record levels at Goangra. Flooding below Mollee lasted for about threeweeks.42. January 1974. The 1974 flood differed again with little contribution from theUpper Namoi and only a moderate flood on the Manilla. Significantcontributions came from the Peel and the Mooki with the latter being the majorsource. This combination led to a major flood at Gunnedah and Narrabri butsomewhat less than 1971 flood levels. At Mollee there were two flood peaks.The creeks draining the Pilliga Scrub contributed significant runoff althoughthis had largely drained by the time the main floods arrived. The first peak wasprimarily from Cox's Creek, whereas the second peak (two days later) wasmainly from the upper catchment of the Namoi River.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report48 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 410 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a43. January 1976. This flood was similar in peak level to the 1974 flood inNarrabri. Floodwaters originated mainly from the Peel and upper Namoisystems. There was a major flood in the Mooki River and contributions fromthe Manilla and Cockburn Rivers were also significant.44. January/February 1984. Major flooding was experienced during late Januaryand early February after above average rainfalls, which had saturated thecatchment and promoted rapid rates of runoff when the flood producing rainoccurred. The catchment in the vicinity of and downstream of Narrabri hadexperienced wet conditions right through the latter half of 1983 and into 1984.Flood problems were made worse by the arrival of significant inflows fromBohena Creek ( below Narrabri ) - filling the main channel of the Namoi Riverprior to the arrival of the main flood peak. Dense vegetation on the flood plain,the poor condition of many floodways and obstructions in the entrances tofloodways all contributed to the unique behaviour of this flood. Breakouts werehampered, floodways did not begin to operate until levels above those for whichthey were designed and some areas of the flood plain stored more floodwaterthan had been expected. These factors meant that in some areas higher thanexpected flood levels were experienced and an unusual redistribution of floodflows occurred. For example, almost 35 percent greater peak discharge thanexpected for a flood of this magnitude was experienced in the Wee Waa Lagoonand to the south west of Wee Waa. Although the flood was estimated to be onlyone third of the total volume of the 1971 flood, it produced similar flood heightsin some locations such as immediately upstream of Collins Bridge.45. July/August 1984. Moderate flooding occurred on the lower Namoi Riverduring late July and Early August 1984. This flood was about 0.5 metres belowthe peak level recorded on the Glencoe gauge earlier in the year. A distinctivefeature of this event was the speed at which is dissipated by comparison with theJanuary - February flood event. This occurred because there was significantlyless vegetation on the flood plain following years of drought, obstructions hadbeen removed from floodway entrances, and the floodway network operatedmuch more effectively because floodways had been cleared, sown to wheat orjust ploughed.46. July/September 1998. A rain band with some unusually active thunderstormactivity for mid-winter crossed the central eastern parts of the country on the 18July 1998. Heavy rain, partly from thunderstorms, continued to fall over theNorth West Slopes and Northern Tablelands saturating the catchment areas. Asin the 1976 event, floodwaters originated mainly from the Peel and upperNamoi systems and combined with major flood in the Mooki River andcontributions from the Manilla and Cockburn Rivers. Narrabri experienced fourseparate peaks above the minor flood classification over the period 24 July – 8September 1998. The town was subjected to flooding above major flood levelson 24 July 1998 and 8 September 1998. Wee Waa was isolated on fouroccasions over the same period when the town was subjected to four peakheights above the major flood classification. There was widespread ruralflooding upstream of Narrabri and across the floodplain above and below WeeWaa. Boggabri, Pilliga and Cuttabri were also subjected to extensive flooding.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report49 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 411 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aFlood Mitigation Systems47. Wee Waa -Urban. A nine-kilometre long ring levee around Wee Waa wascompleted in 1978 at an overall cost of $637,000.00. It was intended for thelevee to have a design level that is one metre above the 1971 flood which wouldequate to approximately 8.5 metres on the Wee Waa – Glencoe gauge. Therehas however over the years been slumping in the levee and remediation workthis together with the uncertainty about the reconstruction height of the levee inrelation to the Wee Waa – Glencoe Gauge has left a situation of uncertainty asto the levees exact height. The Wee Waa Risk Management Study which is duefor completion in early 2011 will investigate this issue and determine the exactheight of the levee for flood protection purposes. Pending completion of thisstudy the best available information indicates that a height of 7.25 metres onthe Wee Waa gauge should be used as a trigger for evacuations.48. Rural. The change in land use to high value, irrigated cropping has beenaccompanied by large-scale private construction of levee banks and raisedcanals in the plains downstream of Narrabri. Some of this construction mayhave been undertaken without regard to the overall effects of the works topreviously existing flood flow patterns. Since then there has been considerablework done in an attempt to remove the worst effects of these developments andnatural floodways have been reopened as far as practicable.Extreme Flooding49. Narrabri -Results of recent flood studies indicate that a once-in-100-years (1%AEP) flood (10.2 metres at the Narrabri Creek gauge) has the potential toinundate nearly 40% of residences (about 1,000) and 75% of businesses (about280) in Narrabri above floor level, with all precincts except Narrabri Westexperiencing extensive flooding. The same studies estimate that an extremeflood in Narrabri could be more than two metres higher than these (ieapproximately 12.2 metres at the Narrabri Creek gauge). The NarrabriFloodplain Management Study of September 1996 (Narrabri Shire Council &Bewsher Consultants) considered that this may be a conservative estimate of theprobable maximum flood (PMF) in Narrabri.50. Wee Waa – Present information regarding the Wee Waa Levee indicates thatthe township could suffer significant inundation from a flood that had a AEP of1% or greater.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report50 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 412 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX B - EFFECTS OF FLOODING ONTHE COMMUNITYCommunity ProfileCensus Description LGA Narrabri Wee Waa BoggabriTotal PersonsTotal DwellingsTotal persons aged 65 yearsand overTotal persons aged below 15yearsTotal persons with a need forassistance (profound / severedisability)Total persons of indigenousoriginTotal persons using InternetSingle parent familiesPersons living aloneTotal persons who do notspeak English wellTotal persons who lived at adifferent address 5 years agoHouseholds without vehiclesTotal persons residing incaravans, cabins orhouseboatsMean household sizeTable B-1: Census of Housing and Population data (2006)13117 6102 1689 9014832 2255 627 3411863 928 208 1863001 1340 406 222568 310 69 681203 649 289 602247 989 268 112565 313 85 451269 631 197 1089 6 3 03824 1860 545 298427 266 82 3378 20 12 82 2 2 2Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report51 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 413 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aSpecific Risk AreasBoggabri1. Boggabri (population 901 – 2006 Census) has only minor flood problems in thetown itself. In terms of flooding premises and evacuation of residents, Boggabridoes not have a major flood problem. Even in the 1955 flood only a smallnumber of homes had to be evacuated; in lesser floods it is only a matter of twoor three homes. The main problems at Boggabri are the closure of theKamilaroi Highway between Boggabri and Gunnedah (Trunk Road 72) and theisolation of the small residential area on the eastern side of the Creek (about 20residents) from the main town area. Both these problems arise from theflooding of the Coxs Creek bridges. Numerous rural properties in the Boggabridistrict have to be evacuated, or become isolated in major floods.Gwabegar2. In the Pilliga Sector the village of Gwabegar (population – about 125) suffersshallow flooding from the Baradine Creek and local run-off and the village canbe isolated for several weeks.Narrabri3. Narrabri is susceptible to extensive flooding ( population 6100 - 2006 census ).Narrabri is dissected into three parts by the Namoi River and its anabranchNarrabri Creek. When the Namoi River and its tributaries are in flood numerousflood runners develop and the town can be cut up into as many as twelvedistinct areas with access between areas lost or impeded. This in itself presentssignificant challenges for the community and emergency services.4. It is estimated that a 1 % AEP flood (10.20 metres on Narrabri Crk Gauge)would inundate up to 1000 homes & up to 280 commercial premises above floorlevel in Narrabri. All areas of the town with the exception of Narrabri Westwould experience extensive flooding in a 1% AEP flood.Pilliga5. Pilliga (population 139 – 2001 Census) is located about 90 km west of Narrabriat the junction of MR 127 from Wee Waa, MR 329 to Burren Junction, MR 383to Coonamble, MR 329 to Gwabegar and SR 18 to Walgett. The major Namoifloodplain passes to the north of Pilliga with the town itself being flooded bylocal creeks and the back-up of floodwaters behind the embankment of MR 329to the north.6. Etoo Creek, about 3 km east of town, appears to be the major cause of the floodproblem. This creek, with the added contributions from Plain and OakeyCreeks, inundates much of the eastern portion of Pilliga up to a depth of about1.5 metres. In the flood of 1971, about 20 homes were affected but only two orthree required evacuation.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report52 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 414 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a7. Pilliga, is isolated by main-river flooding to the north and local run-off to thesouth. Namoi waters to the north of the village and local creeks to the south cutall access to the town for lengthy periods during major floods (in 1971 all roadswere cut for two months), with actual town flooding coming from the southerncreeks. This inundation is limited to only a portion of the residential areas soevacuations can be catered for locally.Wee Waa8. Wee Waa (Population1689 – 2006 census) becomes a low flood island at aheight of 6.70 metres with all road and rail access lost. The town is protected bya ring levee. The township can suffer isolation from flooding for a weeks inlarge events. Resupply will need to be undertaken if isolation occurs. Apredicted flood height of 7.25 metres (Glencoe Gauge) will trigger steps forevacuation commencing with vulnerable elements of the community. In theevent of levee failure or anticipated levee failure or overtopping it is expectedthat the whole township will require evacuation.Rural Areas9. Major flooding leads to extended isolation of numerous homesteads and a needfor resupply, particularly downstream of Narrabri and in the Wee Waadistrict.While flooding can be extensive it is generally of a shallow nature. Upto 250 rural properties downstream of Narrabri can become isolated at shortnotice.Camping Reserves & Caravan Parks10. Flood affected camping grounds and caravan parks in the Narrabri Shireinclude;NarrabriBig Sky Caravan ParkNarrabri Motel Caravan ParkHighway ( also spelt Hi-Way) Tourist VillageNarrabri Show GroundWee WaaWaioma Caravan Park11. Camping grounds and caravan parks in Narrabri are all flood affected andrequire evacuations from heights commencing at 5.9 metres on the NarrabriCreek Gauge. Refer also to Annex G.12. The Waioma Caravan Park in Wee Waa is located within the town levee andwould only require evacuation if the township itself required evacuation.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report53 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 415 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a13. National Parks & Wildlife Service and State Forests to close and evacuatecamping grounds in National Park and State Forest managed areas.Road Closures14. The majority of the council roads in the Narrabri Shire area are ‘black soil’roads that are impassable to normal vehicles after 10mm of rain and toemergency four-wheel drive or multi-tyred vehicles when the roads becomesaturated.15. The following highways and main roads in the Narrabri Shire Council area maybe affected by riverine flooding:Name From-To Designatio Location of ClosurenNewell Highway Narrabri—Coonabarabran NH 39 NarrabriNewell Highway Narrabri—Moree NH 39 Tycannah Creek (24 kmsouth of Moree)Kamilaroi Highway Narrabri—Boggabri—Gunnedah SH 37 At numerous locationsKamilaroi Highway Narrabri—Wee Waa SH 37 At numerous locationsKamilaroi Highway Wee Waa—Burren Junction SH 37 At numerous locationsWee Waa—Pilliga MR127 UnsealedEffects on Utilities and InfrastructureAirports16. Normal road access to the Narrabri airport is lost when the Narrabri Creekgauge reaches 8.00 metres. However, access to the airport may be able to bemaintained by high clearance emergency vehicles up to readings of 9.0 metres.Local run-off can affect the southern end of the airstrip but this is usually onlyfor short periods of time. There is an additional all-weather airstrip on highground at the northern end of the airfield. This airstrip is safe for C130Hercules and other short landing take off aircraft it is also an ideal helicopterLanding Zone.17. The Wee Waa airfield is also protected by a levee but quickly becomes isolatedfrom Wee Waa itself and is thus not accessible during periods of major floodsfor the purpose of servicing the town. This creates a reliance on the use of rotarywing aircraft.Water & Sewerage18. Water supply to the main urban centres of Narrabri, Boggabri & Wee Waa is viabore and is not usually impacted by flooding. The operation of SewerageTreatment Works particularly at Narrabri & Wee Waa is adversely impacted bymajor floods and could become an issue in periods of extended inundation.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report54 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 416 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX C - GAUGES MONITORED BYNARRABRI SES UNITSStationAWRC StreamFlood Type SES UnitNoClassificationMin Mod MajCoxs Ck @ Boggabri 419032 Coxs Creek Telemeter BoggabriNamoi River @ Boggabri 419012 Namoi River Telemeter BoggabriNarrabri Creek 419003 Narrabri Creek 4.9 6.4 6.7 Telemeter NarrabriKaruah 419013 Narrabri Creek Manual NarrabriKaruah (Namoi River) 419018 Namoi River Manual NarrabriTurrawan (Wallah) 419023 Namoi River Telemeter NarrabriWomerah 419040 Namoi River Manual NarrabriGunidgera Weir D/S 419059 Namoi River Telemeter PilligaCuttabri 419906 Namoi River Manual PilligaWee Waa 419019 Namoi River Manual Wee WaaMollee Weir D/S 419039 Namoi River Telemeter Wee WaaWaminda 419049 Pian Creek Telemeter Wee WaaGunidgera Weir – WL 419060 Namoi River Telemeter Wee WaaGunidgera Offtake 419061 Namoi River Telemeter Wee WaaMollee Weir WL 419062 Namoi River Telemeter Wee WaaMerah North 419063 GunningbarTelemeter Wee WaaCreekRossmore 419064 Pian Creek Telemeter Wee WaaOld Burren 419065 Pian Creek Manual Wee WaaWeeta Weir (Storage) 419067 Namoi River Telemeter Wee WaaWeeta Weir D/S 419068 Namoi River Telemeter Wee WaaPian Cutting D/S 419079 GunidgeraTelemeter Wee WaaCreekDuncan Junction 419082 Namoi River Telemeter Wee WaaBrigalow Creek (Tharlane) 419083 Namoi River Telemeter Wee WaaWee Waa (Glencoe) 419900 Namoi River 5.3 6.4 6.7 Telemeter Wee WaaBohena Creek 419905 Bohena Creek Telemeter Wee WaaNote:1. The Bureau of Meteorology (BOM) provides flood warnings for the Narrabri Creekat Narrabri and Wee Waa ( Glencoe) gauges. Flood warnings are also provided bythe BOM for Bugilbone and Goangra which are located on the Namoi River andserviced by the Pilliga Unit. Both Bugilbone and Goangra are however locatedwithin the Walgett Shire. The SES maintains flood intelligence cards for these fourgauges.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report55 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 417 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX D - DISSEMINATION OF SESFLOOD BULLETINSThe Namoi SES Region Headquarters distributes SES Flood Bulletins and other floodrelated information (including Flood Warnings) to the following regional media outlets:Television Stations:Prime TVNBN TVABCNRTVStationTamworthTamworthTamworthTamworthLocationRadio Stations:Station Location Frequency Modulation2TM Tamworth 1287 AMTamworth FM Tamworth (co-located with 2TM) 92.9 FM2NU (ABC) Tamworth 648 AM2MO Gunnedah 1080 AM2GGG Gunnedah (co-located with 2MO) 97.5 FM2VM Moree 1530 AM2CR (ABC) Orange 549 AM2AD Armidale 1134 AM2DU Dubbo 1251 AM2WEB Bourke 585 AMMAX FM Narrabri 91.3 FM2NZ Inverell 1188 AMNewspapers:NameThe Northern Daily LeaderNamoi Valley IndependentNorth West CourierTamworthGunnedahNarrabriLocationOther Agencies:• All SES units, Police and Emergency Services in the Namoi area.• Councils in the Namoi area.• Members of Parliament in the Namoi area.• Tourist Information Centres.• NRMANarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report56 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 418 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX E - TEMPLATE EVACUATIONWARNING & EVACUATION ORDER FOR USEIN NARRABRI SHIRENamoi SES Region Headquarters Telephone 02 6740 230028 Borthistle Road Fax 02 6740 2333Gunnedah NSW 2380Email:nmr.ops@ses.nsw.gov.auIssued [day] [date] at [time in civilian format (am,pm)]Radio stations are asked to immediately broadcast this message and repeat it.Use of the Standard Emergency Warning Signal (SEWS) with this message is authorisedFlood Evacuation Warning for [Enter location/s]Authorised By: [ (operational position title) ]As a result of the flood level predicted by the Bureau of Meteorology for [ location ] at[date/time] the State Emergency Service recommends that residents within the nominated areasshould prepare to evacuate within the next [number] hours.Residents should monitor the situation and be prepared to evacuate when instructed to do so.A Flood Evacuation Order will be issued by the SES if evacuation is required.You can also choose to go to friends or relatives. Alternatively, evacuation centres will beestablished at [ location/s ] where you can obtain temporary accommodation and other help.To prepare for possible evacuation you should:• Raise belongings by placing them on tables, beds and benches. Put electrical items on top.You may be able to place light weight items in the roof space.• Collect together medicines, personal and financial documents, mementos and photos• If possible, check to see if your neighbours need help• Make arrangements for care of pets or other animals, or take your pets with you when youevacuate• Take three days’ supply of clothing and medicines• Find out where to turn off the electricity and gas• Continue to listen to a local radio station for updatesDon’t walk ride or drive through floodwaters – this is the main cause of death and injury duringfloodsFor emergency assistance telephone the SES on 132 500Web site: www.ses.nsw.gov.auEnd SES Flood Evacuation Warning[enter update and currency details]General Manager's ReportNarrabri Shire Local Flood Plan - Displan Review57 of 89 March 2012 Ordinary Business PaperPage 419 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aNamoi SES Region Headquarters Telephone 02 6740 230028 Borthistle Road Fax 02 6740 2333Gunnedah NSW 2380Email:nmr.ops@ses.nsw.gov.auIssued [day] [date] at [time in civilian format (am,pm)]Radio stations are asked to immediately broadcast this message and repeat it.Use of the Standard Emergency Warning Signal (SEWS) with this message is authorisedFlood Evacuation Order for [Enter locations]Authorised By: [ (name & operational position title) ]As a result of the flood level predicted by the Bureau of Meteorology for [ location ] at[date/time] the State Emergency Service is directing residents within the nominated areas toevacuate within the next [number] hours.Do not delay your evacuation. Roads will be congested or closed. You could become trappedand need rescue. Remaining in flooded areas is dangerous and may place your life at risk.You can also choose to go to friends or relatives. Alternatively, evacuation centres will be established at [location/s ] where you can obtain temporary accommodation and other help.Delete as required {If you don’t have a car, buses may operate where possible on normalroutes. Special transport can also be provided on request if necessary, telephone [telephonenumber]}As you evacuate you should:• Take your important documents, mementos and photos• Take your spare clothing and medicines• If possible, check to see if your neighbours need help• Turn off the electricity and gas• Do not walk ride or drive through floodwater• Continue to listen to a local radio station for updatesFor emergency assistance telephone the SES on 132500SES web site: www.ses.nsw.gov.auEnd SES Flood Evacuation OrderThis Flood Evacuation Order remains current until the All Clear has been issuedNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report58 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 420 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aALL CLEARNamoi SES Region Headquarters28 Borthistle RoadGunnedah NSW 2380 Telephone: (02) 6740 2300Issued [day] [date] at [time in civilian format (am,pm)]Fax: (02) 6740 2333Email: nmr.ops@ses.nsw.gov.auRadio stations are asked to immediately broadcast this message and repeat it.All Clear for [Enter locations]Authorised By: [ (name & operational position title) ][Describe the condition that justify the All Clear including any special precautions/conditionsand safety advices that people must take]The SES has issued the ALL CLEAR for [enter locations] at [time / date]. This means that it isnow safe to return to [enter locations].People with access to transport can return to their properties now.[People who/If you] require transport assistance you should contact [insert contact details] forfurther information on arrangement for return.For emergency assistance telephone the SES on 132500SES web site: www.ses.nsw.gov.auEnd SES All ClearNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report59 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 421 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aBackgroundANNEX F - EVACUATIONARRANGEMENTS FOR THE NARRABRISHIRE AREA1. During most floods there is little call for evacuations. A small number ofhomes in Narrabri and a number of homes in rural areas surroundingBoggabri, Narrabri & Wee Waa are however affected by flooding at minor tomoderate levels. This situation however changes dramatically during majorflooding.2. During major flooding evacuations are required in Narrabri. In a 2 % AEPflood it has been estimated that up to 520 homes and 230 commercialpremises could experience over floor inundation. In a 1% AEP flood thenumber of properties affected by over floor level flooding could expand to1000 homes and up to 280 commercial premises. Evacuees may well need tobe relocated to other towns.3. At Wee Waa the evacuation of the entire township may be required if thelevee is threatened with overtopping or failure. The population of Wee Waais 1689.Arrangements4. Control. During floods evacuations will be controlled by the NSW SES.Small-scale evacuations will be controlled by Narrabri SES Local Controller.Should the evacuation operations escalate beyond the capabilities of localresources control may be handed over to the Namoi SES Region Controller.5. Conduct. Evacuations have the following phases:a. Decision to evacuateb. Mobilisation (mobilisation may begin prior to the decision toevacuate)c. Evacuation Warning/Order Deliveryd. Withdrawale. Shelterf. ReturnNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report60 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 422 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aSectors6. Operational Sectors For the purpose of managing flood response operationsand evacuations during severe floods, the Narrabri Shire will be divided intofour operational sectors based on SES unit boundaries as detailed in Part 3 ofthis plan. The sectors are:Tasksa. Narrabri,b. Boggabri,c. Pilliga, andd. Wee Waa.7. The following tasks and roles will be undertaken in relation to evacuations;Narrabri Sector:• Narrabri SES:• Control evacuation operations in the Narrabri Sector.• Coordinate evacuation operations.• NSW Police, Narrabri:• Assist with the delivery of evacuation warnings and theconduct of evacuation operations in the Narrabri area.• Assist with the conduct of evacuation operations.• Conduct road and traffic control operations inconjunction with council and/or RTA.• Ensure all evacuees are registered.• Secure evacuated areas.• NSW Fire Brigades, Narrabri:• RFS:• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in Narrabri area.• Assist with the conduct of evacuations.• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in Narrabri area.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report61 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 423 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aBoggabri Sector:• Boggabri SES:• Control evacuation operations in the Boggabri Sector.• Coordinate evacuation operations.• NSW Police, Boggabri Station:• Assist with the conduct of evacuation operations.• Conduct road and traffic control operations inconjunction with council and/or RTA.• Ensure all evacuees are registered.• Secure evacuated areas.• NSW Fire Brigades, Boggabri:• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in Narrabri area.• Assist with the conduct of evacuations.• RFS, Boggabri:• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in the Boggabri area.Pilliga Sector:• Pilliga SES:• Control evacuation operations in the Pilliga Sector.• Coordinate evacuation operations.• NSW Police, Pilliga Station:• Assist with the conduct of evacuation operations in thePilliga Sector.• Conduct road and traffic control operations inconjunction with council and/or RTA.• Ensure all evacuees are registered.• Secure evacuated areas.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report62 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 424 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aMobilisation• RFS, Pilliga Brigade:• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in the Pilliga area.Wee Waa Sector:• Wee Waa SES:• Control evacuation operations in the Wee Waa Sector.• Coordinate evacuation operations.• NSW Police, Wee Waa Station:• Assist with the conduct of evacuation operations in theWee Waa Sector.• Conduct road and traffic control operations inconjunction with council and/or RTA.• Ensure all evacuees are registered.• Secure evacuated areas.• NSW Fire Brigades, Narrabri:• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in Narrabri area.• Assist with the conduct of evacuations.• RFS, Wee Waa (Myall Vale Brigade):• Provide manpower and vehicles to assist the SES in theconduct of evacuation operations in the Wee Waa area.8. The SES Narrabri Local Controller will mobilise the following to providepersonnel for doorknock teams for designated sectors / locations:a. SES Volunteers from Boggabri, Narrabri, Wee Waa & Pilliga Unitsb. RFS Gwydir Team Members via the RFS Fire Control Officerc. Local Police OfficerNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report63 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 425 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a9. The SES Namoi Region Controller will mobilise any additional personnelrequired to assist with doorknock teams using;a. SES members from the Namoi SES Region and other SES Regionsb. RFS personnel arranged via the RFA Liaison Officer located at NamoiRegion Headquarters.c. NSWFB personnel arranged via the NSWFB Liaison Officer located atNamoi Region Headquarters.10. The SES Narrabri Local Controller will request Narrabri Shire CouncilLEMO to provide Council personnel to assist with traffic coordination.11. The SES Narrabri Local Controller will arrange liaison officers for sectorcommand centres as determined necessary.12. The SES Namoi Region Controller will mobilise the required number ofbuses for sectors via the Transport Services Functional Area CoordinatorDecision to Evacuate13. The decision to evacuate. The responsibility for issuing any generalevacuation order during flooding rests with the Narrabri SES LocalController who exercises his/her authority in accordance with Section 22(1)of The State Emergency Service Act 1989. However, the decision toevacuate will usually be made after consultation with the Local EmergencyOperations Controller and the Namoi SES Region Controller.14. When deciding to evacuate the following should be considered;a) Predicted flood level and rate of riseb) Rainfall situation and rainfall predictionsc) Condition of levee banksd) Condition of evacuation routese) Characteristics of the at risk populationf) Available day light hours for any evacuation operationg) Likely duration of any evacuation operations and time available toconduct operationsh) Likely duration of any isolation and the preparedness of the communityto cope with that isolationi) The condition of essential servicesNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report64 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 426 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aj) The risks posed to evacuees in evacuating15. When evacuation should occur. As far as possible, evacuation will be carriedout before inundation occurs.16. Self-motivated evacuation. Some people will make their own decision toevacuate earlier and move to alternative accommodation using their owntransport. These evacuees will be advised, via the media, to inform thePolice or SES of their evacuation and their temporary address.17. Evacuation Triggers:a. Narrabri Sector. The first evacuations in Narrabri commence at 5.9metres on the Narrabri Creek gauge when water starts to enter the lowlyingarea of the Narrabri Shire Council Caravan Park (southern end) inTibbereena Street. The other key heights (Narrabri Creek gauge) atwhich homes and property are affected are listed below:• 6.55 metres – Water enters low-set home in Barwan Street.• 6.8 metres – Narrabri Shire Council Caravan Park inundated.• 7.46 metres – Water starts to enter three shops and 13 houses inWee Waa Road and four houses in Barwan Street.• 7.51 metres – Water enters the Narrabri Motel Caravan Park(NB: The evacuation route via Ugoa Street is lost at 7.0 metres).• 7.60 metres – 22 houses in Fraser and Peel streets experienceover-floor inundation and enters the CBD.• 8.00 metres – The Kaputar Motel experiences over-floorinundation in all rooms.• 8.26 metres – Most of the evacuation routes in Narrabri areclosed. Estimated that a total of approximately 80 houses in theVillage and Cooma precincts would be flooded above floorlevel.• 8.5 metres – Estimated that most of Narrabri, including the CBDwould be inundated.• 9.6 metres – Estimated that about 520 residences and 230businesses would be flooded above floor level.• 10.2 metres – Estimated that about 1,000 residences and 280businesses would now be flooded above floor level.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report65 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 427 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ab. Boggabri Sector. Several houses in the low-lying area of Boggabri,including houses along the Narrabri road, are at risk of over-floorinundation from the Namoi River at heights between 10.3—10.7 metreson the Boggabri (Namoi R) gauge.c. Pilliga Sector. Several houses in Pilliga are at risk of being flooded bybreak-outs from the southern creeks. However, this inundation islimited to only a portion of the residential area so evacuations canusually be catered for locally.d. Wee Waa Sector. The most likely event to trigger the decision toundertake a large-scale evacuation in Wee Waa would be evidence of apossible failure or overtopping of the Wee Waa levee. A predicted floodheight of 7.25 metres (Glencoe Gauge) will trigger steps for evacuationcommencing with vulnerable elements of the community ( based uponDECCW advices to SES). In the event of levee failure or anticipatedlevee failure or overtopping it is expected that the whole township willrequire evacuation.Phase 1 – Warning18. Evacuation Warnings will be issued by the Narrabri Local Controller whenit is considered appropriate to warn a community of the need to prepare forpossible evacuation. On the receipt of flood warnings the Narrabri LocalController will consult as necessary to determine the level of the threat andthe need to consider evacuations. The Narrabri Local Controller will issueevacuation warnings to the ‘at risk’ residents, indicating what people shoulddo before evacuating and when actually doing so.19. Content of Evacuation Warnings. A template guide to the content ofevacuation warning messages is at Annex E. These are disseminated via:• The radio and TV stations listed in Annex D.• Door-knocks by emergency service personnel.• Public address systems from emergency service vehicles.• Telephone.• Two-way radio.• Direct access to Radio Station Max FM, 2MO,2GGG, 2NU (ABC),2VM• SES Flood Bulletins.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report66 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 428 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aPhase 2 – Withdrawal20. Evacuation Orders are issued when the decision to evacuate is made.Withdrawal or evacuation involves the actual removal of thecommunity/individuals from dangerous or potentially dangerous areas tosafer areas.21. Content of Evacuation Orders A template guide to the content of anEvacuation Order is at Annex E. These are disseminated via:• The radio and TV stations listed in Annex D.• Door-knocks by emergency service personnel.• Public address systems from emergency service vehicles.• Telephone.• Two-way radio.• Direct access to Radio Station Max FM, 2MO,2GGG, 2NU (ABC),2VM• SES Flood Bulletins.22. Movement. Evacuees are to be encouraged to move using their owntransport where possible. The Narrabri Local Controller will arrangetransport for those people without their own vehicles.23. Evacuation routes.NarrabriWithin Narrabri most escape routes are lost and movement around the townbecomes problematic and dependent of the behaviour of the various floodrunners by the time a flood height of 8.26 on the Narrabri Creek Gauge isreached.Narrabri Airport access to the airport is lost to normal vehicles when a heightof 8 metres is reached on the Narrabri Creek Gauge. Access for high clearancevehicles may be maintained until 9.0 metres. An alternative route may beavailable for high clearance 4wd emergency vehicles via Doyle and LittleMountain Road depending on local flooding.Wee WaaAll road access to Wee Waa is usually lost when a height of 6.7 metres isreached on the Wee Waa Gauge.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report67 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 429 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a24. Traffic Control. When large-scale evacuations are likely, evacuation routesare to be secured by the NSW Police and kept clear by the following means:a. Denying access to all traffic except for emergency vehicles (includingbuses and private vehicles being used for the purpose of evacuation).b. Keeping one lane clear at all times for use by emergency vehicles.c. Positioning a tow truck or similar vehicle at appropriate entry points,road blocks and exit points along the evacuation routes.25. Large-scale evacuations. - Narrabri. Under extreme circumstances, Narrabricould have to be completely evacuated as most of the township with theexception of parts of Narrabri West is a low flood island for emergencyresponse planning. A number of options are available:a. Air. If the airport is not isolated from the main town area (east ofNarrabri Creek) by flooding. See also Section 27 on Helicopter LandingZones.b. Rail. Evacuees could be collected from boarding points at NarrabriWest, at the Narrabri Railway Station and at the Grace Street crossingand evacuated through Gunnedah.c. Road. Usually, the Newell Highway to the south stays open duringfloods except when there are very heavy rainfalls over the Pilliga StateForest. Bus turn-around points could be established at the NarrabriRoad House on the Newell Highway to the south west of the town.Evacuees could them then be road transported to Coonabarabran.Evacuation routes to the north and east may also be available dependingon whether or not the Gwydir River and Nandewar Creeks are in flood.In this case, a bus turn-around point could be established at the NewellHighway railway overpass just north of the town.26. Large-scale evacuations. - Wee Waa. Wee Waa is classified as a low floodisland for emergency response planning purposes. In the event of actual leveefailure or overtopping, all essential services would be cut and the town wouldalmost certainly have to be completely evacuated. Wee Waa usually has upto three days warning of a peak flood height. As this also includes up to twodays warning of when the town may be isolated by road, some preliminaryevacuations may be possible. In the event that predicted flood heightsindicate a threat of levee overtopping, the Narrabri SES Local Controller &Wee Waa SES Unit Controller will consider preliminary road evacuation ofthe aged, infirm and children. This could reduce the population by up to 40percent.a. Safe Havens. Locations at which people could be above flood watersuntil evacuated are the Public School (Cowper Street), High School(Purcell Street), Sports Complex (Narrabri Road), two hotels, (RoseStreet), Church Hall (Cowper Street), CWA Rooms (Rose Street),Namoi Cotton Co-Op and Cotton Grower Services (Boolcarrol Road).Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report68 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 430 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ab. Assembly Areas. An assembly area and helicopter pick-up pointwould be established at the Wee Waa Sporting Complex. A secondassembly area and pick-up point could be established at Cotton GrowerServices - with the two locations linked by a bus shuttle service. Otherlanding points could be at the Namoi Cotton Co-Op and on the townapproaches to the Lagoon Bridge.c. Withdrawal. Evacuees would be flown to a transit area at "The Pines".If the Bohena Creek Crossing on the Narrabri to Yarrie Lake Road isopen, the evacuees could be moved out of "The Pines" by bus. If not,they will need to be moved by air from Nicholson's Airport, which isnext to "The Pines" and flood free.27. Helicopter Landing Points. Suitable landing points are located at:a. Narrabri:• Narrabri Airport (Landing Zone).• Reid St ( utlising the street in front of the SES HQ)• The Prime Wheat Silo Compound at 6 Reid Streetb. Boggabri:• Boggabri Hospital.• Boggabri Sporting Oval.• Boggabri Showground.c. Pilliga:• At the intersection of Dangar and Vivienne streets, in front ofthe CWA building.d. Wee Waa:• Wee Waa Sports and Community Centre.• Namoi Cotton Services.• Namoi Cotton Co-op.28. Special Needs Groups. There are a number of people in the communitywho have special needs and support in the event of evacuation and these mayinclude;a. Persons with pre-existing medical conditions or disabilitiesb. Pregnant women and childrenNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report69 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 431 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ac. Home Care patients ( details of these people and their location will bemaintained by Hunter New England Area Health Service )d. Residents of Aged Care Facilitiese. Hospital Patients29. Hospitals and Aged Care Centres. There are three hospitals and four AgedCare Centres in the Narrabri Shire Council area. They are:a. Narrabri:• Narrabri Hospital – 38 beds.• Namoi Valley Aged Care – 34 aged care beds, 28 self-containedunits; and• Jessie Hunt Nursing Home – 60 nursing home beds.b. Wee Waa:• Wee Waa Hospital – 33 beds; and• a eight unit Retirement Village.c. Boggabri:• Boggabri Hospital – 16 high and low care beds and four inpatient’s beds; and• a 12 unit Retirement Village.30. Vehicle Compound. During major floods in Narrabri, the Narrabri SESLocal Controller will establish a secure vehicle compound at the NarrabriAirport where residents may leave vehicles above flood levels. Police willattend to security of the area.31. Animals. Assistance animals (guide dogs, hearing assistance animals, etc)will remain in the care of their owners throughout the evacuation. Thisincludes transport and access into evacuation centres etc. Due to safetyrestrictions, it may not be possible to allow companion animals toaccompany their owners when being transported via aircraft or flood rescueboats. Industry & Investment NSW will make separate arrangements for theevacuation and care of companion animals.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report70 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 432 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a32. Doorknocking. Field teams conducting doorknocks will record and reportback the following information back to the Operations Centre:• Addresses and locations of houses doorknocked and/or evacuated.• The number of occupants.• Details of support required (such as transport, medical evacuation,assistance to secure house and/or property and raise or movebelongings).• Details of residents who refuse to comply with the evacuation order.33. Refusal to evacuate. Field teams should not waste time dealing with peoplewho are reluctant or refuse to comply with any evacuation order. Thesecases should be referred to the Local Controller who will arrange for referralof the matter to Police.34. Security. The NSW Police Force will provide security for evacuated areas.35. Transport and storage. Transport and storage of furniture from floodthreatened properties will be arranged as time and resources permit.Phase 3 – Shelter36. Evacuation centres. The usual purpose of evacuation centres is to meet theimmediate needs of victims, not to provide them with accommodation.Evacuees will be advised to go to or be taken to the nearest accessibleevacuation centre, which may initially be established at the direction of theNarrabri SES Local Controller but managed as soon as possible by theDepartment of Community Services. Any or all of the following sites maybe used as evacuation centres:a. Boggabri:b. Pilliga:• CWA Rooms in Brent Street.• Uniting Church Hall in Norton Street.• CWA Rooms in Dangar Street.• Community Centre in Lagoon Street.• Pilliga School.c. Narrabri:Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report71 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 433 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a• The Crossing Theatre in Tibbereena St• Narrabri RSL Club, 7 Maitland St• Narrabri Public School in Barwan St.• Narrabri West Public School in Coomoa Rd.d. Wee Waa:• Wee Waa Public School in Cowper Street.• Wee Waa High School in Purcell Street.• Sports Complex on Narrabri Road.• Church Hall in Cowper Street.• CWA Rooms in Rose Street.• Namoi Cotton Co-Op and Cotton Grower Services onBoolcarrol Road.37. Action on arrival. On arrival, evacuees will be:a. registered;b. medically checked, if necessary; andc. provided with their immediate welfare needs.38. Registration. The NSW Police Force will ensure that all evacuees areregistered on arrival at the designated evacuation centres.39. Animal shelter compounds. Animal shelter compounds will be set up forthe domestic pets and companion animals of evacuees. These facilities willbe operated by Industry & Investment NSW.Phase 4 – Return40. Once it is considered safe to do so, the Narrabri SES Local Controller willauthorise the return of evacuees to their normal or alternative place ofresidence. This decision will be made in consultation with the following;a. Health Service Functional Area Coordinator (public health),b. Engineering Services Functional Area Co-coordinator (electrical safetyof buildings, structural integrity of levees/dams),c. Transport Services Functional Areas Coordinator (status of Stateroads),Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report72 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 434 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.ad. Narrabri Shire Council (public health and status of local roads)41. The return will be controlled by the Narrabri Local Controller and may beconducted, at his/her request, by the Recovery CoordinatorNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report73 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 435 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX G - ARRANGEMENTS FOR THEEVACUATION OF CARAVAN PARKS ANDTHE RELOCATION OF CARAVANSGeneral1. The Narrabri Council, Narrabri and Hi-Way caravan parks are flood liable andare flooded when the Narrabri Creek gauge reaches:a. 5.9 metres – Big Sky Caravan Park ( formerly known as the NarrabriShire Council Caravan Park ). Water starts to enter the low-lyingsouthern end of the park. The park is inundated when the gauge reaches6.8 metres.b. 7.51 metres – Narrabri Motel Caravan Park. Water enters the park atthis height. However, evacuations have to be completed before thegauge reads 7.0 metres. At this height the evacuation route (UgoaStreet) is closed by floodwaters near Forbes Street.c. 8.6 metres – Hi-Way (also spelt Highway) Tourist Village.Floodwaters threaten the village at about this height. The height thatthe complex is inundated is not known but it would probably occurshortly after reaching this height.Advising Procedures2. Caravan Park proprietors will ensure that the owners and occupiers of caravansare:a. Made aware that the caravan park is flood liable by:• Handing a printed notice to occupiers taking up residence. The noticewill indicate that the caravan park is liable to flooding and outline theevacuation and van relocation arrangements as detailed in this Annex.• Displaying this notice prominently in each van.b. Made aware that if they are expecting to be absent from their vans forextended periods, they must:• Provide the manager with a key; in a sealed envelope; to the van.• Provide a contact address and telephone number.• Inform the manager if a vehicle will be required to relocate the vanduring flood time.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report74 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 436 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a• Leave any mobile van in a condition allowing it to be towed in anemergency (ie: tyres inflated, jacks wound up, personal effects securedand annexes and lines for water, sewer, electricity and gas readilydetachable).c. Informed when a flood is rising. At this time, occupiers will be advised to:• Ensure that they have spare batteries for their radios.• Listen to a local radio station for updated flood information.• Prepare for evacuation and van relocation.3. The Narrabri SES Local Controller will ensure that the managers of caravanparks are advised of flood warnings and the details of any evacuation order.Evacuation of Occupants and Relocation of Vans4. Caravan park proprietors will install flood depth indicators and road alignmentmarkers within their caravan parks.5. When an evacuation order is given:a. Occupiers of non-movable vans should:• Secure their vans by tying them down to prevent flotation.• Isolate power to their vans.• Collect personal papers, medicines, a change of clothing, toiletries andbedclothes.• Lift the other contents of their vans as high as possible within the van.• Move to a designated evacuation centre in Narrabri if they have theirown transport, or move to the caravan office to await transport.b. Where possible, vans that can be moved will be relocated by theirowners. Park managers will arrange for the relocation of mobile vanswhose owners do not have a vehicle. Council and SES personnel willassist if required and may be able to provide additional vehicles. Vansare to be moved to the Narrabri Airport.6. Caravan park managers will:a. Ensure that their caravan park is capable of being evacuated within 12hours.b. Advise the Narrabri SES Local Controller of:• The number of people requiring transport.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report75 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 437 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a• Details of any medical evacuations required.• Whether additional assistance is required to effect the evacuation.c. Check that no people remain in non-removable vans that are likely to beinundated.d. Inform the Narrabri SES Local Controller when the evacuation of thecaravan park has been completed.e. Provide the Narrabri SES Local Controller with a register of people that havebeen evacuated.Return of Occupants and Vans7. The Narrabri SES Local Controller, using council resources as necessary, willadvise when it is safe for the caravan parks to be re-occupied.8. Vans will be towed back to the caravan park(s) by van owners or by vehiclesand drivers arranged by the park managers. Again, Council and SESpersonnel will assist if available.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report76 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 438 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aSituationANNEX H - RESUPPLY REQUIREMENTSAND OPERATIONS1. During periods of flooding; towns, villages and rural properties in the NarrabriShire Council area can be isolated for prolonged periods and will requireresupply.2. The two main highways that are used as the main supply routes for Narrabri andthe surrounding areas are the Newell and Kamilaroi highways. Both of thesehighways are subject to inundation of varying levels and are often closed to allbut emergency vehicles during periods of major flooding.3. There are a large number of roads within the Narrabri Shire Council area thatare “black soil” roads that are impassable to normal vehicles after 10mm of rainand to emergency four-wheel drive or multi-tyred vehicles when the roadsbecome saturated.4. Flooding in the Narrabri Shire area normally results in extended periods ofisolation for Wee Waa, Pilliga, Gwabegar, Cuttabri, Maules Creek and ruralresidents located on the floodplain with the potential for the need to resupplyabout 5,000 people. The Narrabri SES maintains a database of rural propertieslocated in the Wee Waa area with the potential to be at risk of isolation duringflooding.Mission5. The NSW SES is to coordinate resupply operations during periods of floodingin order to sustain people located in isolated towns and villages or isolated onrural properties.Execution6. General. Rural residents can become isolated on outlying properties evenbefore the onset of flooding due to the “black soil” roads becoming impassable.People on these isolated properties may not have had an opportunity to stock upand may require resupply early in a flood event.7. Concept of Operations. During periods of major flooding the normal mode ofresupply will be maintained for as long as practicable. The main supply routeswill be kept open to essential and emergency vehicles for as long as it is safe todo so. Once these routes are closed (either by the road owner, the Police orSES) the delivery of essential foodstuffs, fuel, urgent medical supplies andstores to Narrabri will be coordinated by Namoi SES Region using aircraftpossibly operating out of Narrabri, Tamworth Moree and/or Dubbo. From there,the Narrabri SES Local Controller will coordinate the delivery of these suppliesto outlying areas via the most practicable method.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report77 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 439 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a8. Normal Supply Arrangements.a. Narrabri. Storekeepers in Narrabri normally source their suppliesfrom Sydney or Brisbane. These stores are usually delivered by roadtransport using the Newell Highway.b. Boggabri.c. Pilliga.d. Wee Waa.e. Outlying Areas.9. Main Supply Routes. Normally, goods are shipped by road via any of thefollowing main supply routes:a. Newell Highway The Newell Highway links Narrabri to Moree &Coonabarabran.b. Kamilaroi Highway The Kamilaroi Highway links Narrabri toBoggabri and Gunnedah to the south-east and to Wee Waa and Walgettto the north-west.10. Pre-Stocking. If flood predictions indicate that areas are likely to becomeisolated, the Narrabri SES Local Controller will inform businesses, normallythrough the Narrabri Shire Council and, where possible, rural residents that theyshould stock up on high usage non-perishable items.11. Dependency. Almost all of the towns and villages in the Narrabri Shire willrequire resupply during periods of major flooding. In major floods, some 260rural properties will require resupply by air, predominantly by helicopters.12. Resupply Procedures. When isolation occurs, storekeepers and rural residentson isolated properties will be expected to place orders on suppliers where theyhave a line of credit and to instruct those suppliers to package their goods anddeliver them to loading points designated by the SES. Similarly, essentialservices (eg. hospitals) will make arrangements to acquire their resupply needsfrom the normal sources and have the supplies delivered to the designatedloading point. The SES will arrange for the stores to be conveyed to anappropriate distribution point that will be established as required in Narrabri &Wee Waa. From there the SES will arrange for delivery via the mostappropriate and practical means. Due to the extent of flooding and its impact onthe road system, stores and equipment will usually be transported by SES floodrescue boats or by air using both fixed wing and rotary wing aircraft.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report78 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 440 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a13. Vetting Committee. If the isolation of towns or villages is expected to occur,the SES may establish a vetting committee to ensure that only essential goodsare ordered. If and when established, the committee will consist ofrepresentatives from the SES, Narrabri Shire Council, Police, NSW CommunityServices, retailers (represented by the Narrabri Chamber of Commerce) and theaboriginal community. The committee will ensure that businesses requestingsupplies are not using the flood as a means of restocking free of charge and alsothat load space in resupply vehicles and aircraft is optimally used (ie no wastedcapacity).14. Essential Items. As a guide, the priorities for the resupply of essential itemsare:a. Priority 1 - Subsistence Items and Operational Supplies. Foodstuffs(including animal food for companion animals), water, health andwelfare items and items for the maintenance of morale (eg.newspapers).b. Priority 2 - Pharmaceutical and medical supplies (including hospitallinen).c. Priority 3 - Petrol, Oils and Lubricants (including AVTUR andAVGAS).d. Priority 4 - Repair parts for essential machinery.e. Priority 5 - General Stores.15. Operational Supplies. The SES will also coordinate the resupply ofoperational supplies such as sandbags, sandbagging machines, plastic sheetingand chemicals for disease or pest control.16. Resupply of Isolated Properties. There are at least 260 rural properties thatrequire resupply during periods of flooding. The Narrabri Shire SES LocalController maintains a list of these properties and their geographicalcoordinates. The SES will coordinate the resupply of isolated properties. Ruralresidents will liaise with the SES (Narrabri, Boggabri, Pilliga or Wee Waa units)to ensure that the items they seek are essential to their well being or livelihood.The Local Controller will coordinate the resupply of approved items andestablish a delivery schedule. Property owners are responsible for sourcing thesupplies and arranging finance. People who claim to be or are considered to bein necessitous circumstances and require financial assistance are to be referredto Welfare Services. A flow chart outlining the resupply system for isolatedproperties is shown below at Figure 1:Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report79 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 441 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aFigure 1: Resupply FlowchartNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report80 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 442 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a17. People in Necessitous Circumstances. Some people in the isolatedcommunities or on isolated properties may find themselves in financialdifficulty or dire circumstances. People in this situation should be directed toliaise with NSW Community Services (Welfare Services) who will arrange forthe necessary assistance.18. Hospital Linen and Medical Stores. There are three hospitals in the NarrabriShire Council area—Narrabri Hospital (38 beds), Wee Waa Hospital (33 beds)and Boggabri Hospital (16 high and low care beds and four in patient’s beds).The SES will arrange for the delivery and resupply of linen and other medicalstores (including oxygen bottles) to Hospitals in the Narrabri Shire if required.As a guide the following weekly estimates are provided.Wee Waa• Linen 200 kg a week and dirty linen returns 201 kg serviced in 3deliveries / pick ups• Catering supplies 12 mixed boxes a week ( this includes frozen food,tinned items and dry food)• Hospital Stores 80 kgNarrabri• Linen 800 kg a week and dirty linen returns 800 kg serviced in 3deliveries / pick ups• Catering supplies 25 to 30 boxes a week (this includes frozen food,tinned items and dry food)• Stores 180 kg19. Pharmaceutical Supplies and Prescription Medicine. Pharmaceutical andmedical supplies may need to be delivered to isolated residents. The procedurefor the resupply of prescription medicine to isolated communities is outlined inthe flow chart at Figure 1.20. Mail. At the request of Australia Post, the SES will deliver mail to isolatedcommunities. However, it may not be possible to do so in accordance withnormal Australia Post timetables.21. Personnel Movement. Where possible, the SES will assist isolatedcommunities or properties with the movement of people to and from isolatedareas. This includes property owners who require access to their property,school children and/or university students who need to get to or return fromboarding schools or universities and members of the isolated communities whohave to attend medical appointments etc. Each request will be considered on itsmerit and available resources.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report81 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 443 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.a22. Air Resupply. When isolation by road is predicted, the Narrabri Shire SESLocal Controller will liaise with the Namoi SES Region Controller who willmake arrangements with the SES State Headquarters for air resupply. If airresupply is authorised the concept is that suppliers will be responsible to packand deliver the approved stores to a nominated loading point from where it willbe delivered to Narrabri by fixed wing aircraft operating on scheduled flights.From Narrabri the stores will be delivered to the retail outlets in Narrabri ortranshipped to either high clearance vehicles, SES flood rescue boats, lightaircraft or helicopters for delivery to the outlying communities in accordancewith pre-determined delivery schedules.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report82 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 444 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX I - DETAILS OF THE DAM-FAILURE WARNING AND EVACUATIONSYSTEM FOR KEEPIT DAMBackground1. In 2001 following the introduction of new safety standards by the NSW DamSafety Committee short comings in the ability of Keepit Dam to handleextreme weather was identified. Following this detailed technicalinvestigations were carried out by the dam’s owners State Water.2. Upon completion of these detailed investigations into Keepit Dam, a planwas adopted to rectify identified shortcomings. This plan included improvingcommunity safety in the short term by interim safety work and theintroduction of an Early Warning System pending the completion of a MajorDam Upgrade due for completion by 2013.3. The failure of Keepit Dam could have extreme consequences for areas downstream of the dam. This includes for parts of Gunnedah and all or significantparts of the towns of Boggabri, Narrabri & Wee Waa. The population ofthese communities and surrounding rural areas could be at risk in a damfailure. Flood extent mapping has been carried out by State Water. A copy ofthe extent of this flooding is held at Namoi Region Headquarters.4. There is an Early Warning System for the dam that is monitored by NamoiSES Region Headquarters. Namoi Region Headquarters will keep theNarrabri SES Local Controller appraised of the situation at the dam.Keepit Dam Early Warning System (EWS)5. The operation of the system is simplistic and may be summarised as follows; Anautomatic storage level recorder, built into the main dam wall at Keepit Dam,determines the storage level at the dam. The river flow downstream of the damis also measured as part of the EWS. This information is relayed via a radiorepeater network to the State Water Office at Keepit Dam. A Personal Computercompares the storage level at Keepit Dam and the river flow downstream of thedam with pre-determined set points. When the storage level and/or thedownstream river flow reach these set points the system converts to a predetermined“state”. Each of these states has defined actions associated to them.Alerts will be sent to the SES and affected residents who live immediatelydownstream of the dam. Residents who live outside the village of Carroll willbe contacted by telephone and, at the same time, the sirens and lights of thetown warning units (TWUs) will begin sounding and flashing in the village ofCarroll. The residents of Carroll will not receive automated telephone calls.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report83 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 445 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aKeepit Dam Alert Levels6. The Dam Safety Emergency Plan for Keepit Dam ( a copy is held at SESState HQ and Namoi Region HQ ) details the alerts levels andcommunication process when the Dam is not under normal operatingprocedures. These alert levels are as follows;AlertLevelWhiteDefining Condition SES Response SES Warning ProductWhen the river flowdownstream of KeepitDam reaches 100 000megalitres a day or theremay be a structuralanomaly.Notification of supportagenciesMonitoring areas at riskdownstreamCheck operationalreadinessThis is a preliminary alertto assists the SES in itspreparation. This is not apublic alert.AmberRedA high storage level,water height isimmediately below thefirst fuse bay at thesubsidiary embankment.Failure is possible ifstorage level continues torise or structural anomalynot fixedThe storage level atKeepit has reached acritical level and is equalto the top of the fuse baysat the subsidiaryembankment.Failure imminent oroccurredWarn downstreampopulation at risk toprepare to evacuateEvacuation ofdownstream populationsSES Evacuation WarningSES Evacuation OrderPrior Advice to People Potentially at Threat7. Since the introduction of the Keepit Dam Early Warning System State Waterand the SES have carried out community education and consultation with thecommunity at Carroll.Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report84 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 446 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX JCHILDCARE CENTRES & PRESCHOOLS INNARRABRI SHIRELicensed Children’s services in the Narrabri & DistrictGumnut Cottage Childcare & Preschool Centre11 Fitzroy StreetNarrabri NSW 2390Ph: 0267925111Contact Person: Janice FoxeMaria Jenkins Home Based Care11 Huxley StNarrabri NSW 2390Contact Person: Maria JenkinsPh: 67924324Newtrain Family Day CareShop 6 Tanya ArcadeMaitland StreetNarrabri NSW 2390Contact Person: Maryanne McDonaldPh: 02 6792 4022Kogil St Preschool10 Kogil StNarrabri NSW 2390Contact person: Dianne FosterPh: 6792 1465Nurruby Child Care Centre72 Gibbons StNarrabri NSW 2390Contact Person: Pru JamiesonPh: 6792 6566Neighbourhood Early Learning Centres - Narrabri41 Nandewar StNarrabri NSW 2390Contact Person: Katherine RicePh: 026792 4977Nurruby Wee Waa Community Child Care Centre and Preschool97 Cowper StreetWee Waa NSW 2388Contact person: Joanne McInleyPh: 026795 4501Wee Waa & District Preschool118 Alma StWee Waa NSW 2388Ph: 026795 4438Contact person: Patricia BennieNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report85 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 447 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aANNEX K – SCHOOLS WITHIN NARRABRISHIRE COUNCILPublic SchoolsBellata Public SchoolGurley StBellata NSW2397Fairfax Public SchoolMaules Creek viaBoggabri NSW 2382Narrabri High School2 Gibbbons StNarrabri NSW 2690Narrabri West Public6 Cooma RdNarrabri NSW 2390Wee Waa High SchoolPurcell AveWee Waa NSW 2388Boggabri Public SchoolMerton StBoggabri NSW 2380Gwabegar Public SchoolChauvel StGwabegar NSW 2356Narrabri Public SchoolBarwan StNarrabri NSW 2390Pilliga Public SchoolDangar StPilliga NSW 2388Wee Waa Public SchoolCowper StWee Waa NSW 2388Catholic & Private SchoolsNamoi Valley Christian SchoolRose StWee Waa NSW 2388St Josephs Primary SchoolAlma StWee Waa NSW 2388Sacred Heart Primary SchoolLaidlaw StBoggabri NSW 2382St Xaviers SchoolNandewar StNarrabri NSW 2390Narrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report86 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 448 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aMAP 1 - RIVER BASINRequest map from SES State Headquarters Planning SectionNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report87 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 449 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aMAP 2 - COUNCIL AREARequest map from SES State Headquarters Planning SectionNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report88 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 450 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.6.aMAP 3 - TOWN/VILLAGE/SUBURB AREARequest map from SES State Headquarters Planning SectionNarrabri Shire Local Flood Plan November 2010 Sub-Plan of Narrabri Shire DisplanGeneral Manager's Report89 of 89 March 2012 Ordinary Business PaperNarrabri Shire Local Flood Plan - Displan ReviewPage 451 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.7 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Wee Waa Levee BankGeneral ManagerNil to this reportRECOMMENDATION:received.That the information on the Wee Waa Levee Bank beIssuesTo provide Council with an update on the Wee Waa Levee Bank following the breach withworks cutting the levee bank.BackgroundThe Council was made aware of a contractor digging through the levee bank and through Councilresolution the administration has been following up with Public Works to ensure the integrity of thelevee.Current SituationDuring the recent February 2012 flood, the repair to the bank stood the test.The following are expunged details from a letter from Public Works Project Management dated 15December 2011:“I refer to our recent telephone conversation and Council’s letter dated 11November 2011 regarding the works recently undertaken to the Wee Waa LeveeBank as part of the stormwater upgrade works at Wee Waa High School.It is my understanding that the levee bank works were witnessed by Councilrepresentatives and carried out in accordance with plans reviewed and approvedby Council. The work method for the works was also witnessed and approved byReinforced Soil Technologies Consulting Engineers and compaction testing wasundertaken by South Queensland Soils. A copy of the Engineer’s certification andsoil compaction test results will shortly be forwarded to Council.The levee bank was inspected by Mr Jack Domis (New England DistrictEngineering Services Functional Area Coordinator) on 27 November 2011 at therequest of the SES responding to flooding in the Namoi River. The entire levee wasinspected, particularly the recently completed works near the Wee Waa School.These works showed no visible deleterious signs such as settlement, slipping, pipingor shear cracking. The level of these works was raised compared to the adjoiningGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 452 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTlevee, presumably to allow for settlement over time but there was no evidence ofsettlement at that time. The only improvement recommended from that inspectionwas more consistent grass coverage.With regard to the responsibility for any consequential loss in the vent of futurefailure of the repaired section of the Wee Waa Levee bank, I have referred thismatter to our legal section of their guidance.”The Council is following up in our letter dated 30 January 2012 regarding the legal advice asfollows:“I refer to your letter dated 15 December 2011 in regards to the above.I note in your letter the matter was being referred to your legal section for theirguidance and further note I have not heard further from you to date. I would bepleased if you could provide your further advice as soon as possible.”The Council further followed up on the 28 th February 2012 seeking responsibility of the Levee.AttachmentsNil to this report.Financial ImplicationsNil to this report.Statutory/Legal ImplicationsNil to this report.Environmental ImplicationsNil to this report.Management Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 453 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.8 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Upgrade of Netball CourtsGeneral ManagerNot ApplicableRECOMMENDATION: That the Council authorise the upgrade of the Netball Courtswith a budget allocation not exceeding $231,000 in total.IssuesCouncil allocated $50,000.00 in the 2011/12 budget toward increasing the available courtarea.A grant application was lodged with NSW Sport and Recreation in early 2011 and itscurrent status is unknown.Council has been advised of $50,000 grant approval to undertake the works from NSWSport and Recreation.BackgroundOn 15 March 2011 Council resolved that:‘the Council determine which projects should receive attention in applying for the Sport andRecreation Facility Grant Program as follows:Subject to Narrabri West clearing up basketball issues, items 5, 6, 7 of notices of motion(Cr Bolton);Shade shelters over playground equipment at Boggabri (Cr Bates)New amenities at Netball Courts, lights at netball courts (Cr Kelly)Upgrade of facilities at WWSI (Cr Lowder & Mayor);Lights at Cooma Oval (Cr Knox);Shade shelters over playground Shire wide (Cr Redding)Disabled amenities at Cooma Oval (Cr Kelly)Half basketball court at Gwabegar (Mayor)’Accordingly, Narrabri Shire Council applied to NSW Communities, Sport and Recreation 2011 fora dollar-for-dollar grant to fund the co-location of Narrabri Netball and Basketball at the existingnetball courts. The project detailed in the grant application included installation of lighting,extension and improvement of paved surfaces to allow for more courts and line marking forbasketball to be played on the same courts. The grant application is Attachment 10.1.8.a to thisreport.When the 2011/12 Management Plan was reviewed by Council prior to its adoption, Councilallocated $50,000.00 toward the project (for the extension of the courts only).GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 454 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTCurrent SituationNotification of the success or otherwise of the grant application was originally expected by October2011.Design for the proposed extension to the courts is complete. The Design is Attachment 10.1.8.b tothe report.Detailed design for lighting is yet to commence and to be undertaken sometime in the future, andnot as a Council expense.AttachmentsAttachment 10.1.8.a: NSW Community, Sport and Recreation grant application.Attachment 10.1.8.b: Design of Netball Court ExtensionFinancial ImplicationsCouncil allocated $50,000.00 in the 2011/12 financial year toward the project.The total estimated cost of the project at the time of lodging the grant application was $240,289.00.As the grant provides 50% of the total project cost, Council’s contribution would be approximately$120,144.80.Since lodging the grant application the estimated cost of the court extension is $25,000.00(earthworks) and an asphalt overlay for the entire court area has been quoted at $130,500.00excluding GST.Other costs include line marking, new basketball/netball hoops and court lighting to the requiredAustralian Standard.Detailed design for lighting has not commenced due to the lack of budget allocated for this purposeand the delay in notification of the status of the grant application. Members of the basketballassociation have previously commented that donated lights and light poles were available for theproject however this advice has not been received by Council in writing.The proposed works are: Extension of the courts $ 50,000 Asphalt overlay $131,000 Line marking, new hoops etc $ 50,000$231,000GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 455 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTBudget:$131,000 transfer from General Fund;$50,000 approved in Management Plan;$50,000 grant NSW Sport & Recreation.Statutory/Legal ImplicationsAny works completed prior to the announcement of the grant will be considered as ‘retrospectiveworks’ by the funding body.These works will not be approved as eligible expenditure for the purposes of the grant funding, ifCouncil’s application is successful.Environmental ImplicationsNilManagement Plan/Strategic PlanCommunity FacilitiesCouncil is committed to providing facilities that promote a healthy lifestyle, social interaction andprovide essential services for residents, visitors and businesses within the Shire.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 456 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILProject DetailselNSW IGS¡üS¡{TICommunitiesSpoË & RecrcatlonProject TitleCO-TOCRTION OF NARRABRI NETBALLAND BASKETBALL COURTS PROJECTMajor Sport or Activity that the project wÍll benefitNETBALL AND BASKETBALL.Proposed start date of project07111Anticipated finish date of project06112Project DesøiptionNairabri Shire'Council in conjunction with sporting groups in Narrabri Shire are keen to create a multipurposecentre at the current netball iourts. The current netball courts have 6 courts and fencing around the courts.The project will involve installation of lighting, extension and improvement of paved surfaces to allow for morecouris aîo line marking allowing tor oaét

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILGontact DetailsCommunitiesSpoft & RecrcatlonGiven NameKRISTYPositionGRANTS OFFICERFamilY NameFARISBusiness Phone Home Phone Mobile Fax67996865 0410 043 250Emailkristyf@narrabri.nsw.gov.auAddress46-48 Maitland StSuburbNARRABRIPostcode2390Given NamePHILLIPPositionGENERAL MANAGERFamilY NameMARSHALLBusiness Phone Home Phone Mobile Fax67996833Emailgm@narrabri. nsw. gov.auAddress46-48 Maitland StSuburbNARRABRIPostcode2390Given NameHELENPositionCOMMUNITY FACILITIES MANAGERFamilY NameCARROLLBusiness Phone Home Phone Mobile Fax67996870Emailcfm@narrabri.nsw. gov.auAddress46-48 Maitland StSuburbNARRABRIPostcode2390SFGP-2402-7409-11-12 Printed on 1510412011 al 12:15:51 Page 2General Manager's Report2 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 458 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILLocation DetailsCommunitiesSport & RecrcationLocationNARRABRI NETBALL COURTSAddress33 Bohena StSuburbNARRABRIState Electorate GouncilNameNSW Banruon NarrabriPostcode2390sFGP-2402-7409-11-12 Printed on 1510412011 al 12:15:51 Page 3General Manager's Report3 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 459 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW GommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILBudget DetailsCommunitiesSpoft & RecrcatlonA. FundinoFundino requested from Sport and Recreation 120144.80Confirmed fundinq from Federal Government 0.00Confirmed fundinq from State Government 000Confirmed fundino from Local Government 000Sub-Total (A) 120144.80B. lncome (e.q. applicant's contNSC in-kind labour and materials to re-surface courts 47289.64Cash contribution from NSC 72855.2QSub-Total (B) 120144.80C. EXPENDITURE - DIRECT COSTS (e.g. venue hire, equipment, presenter fees, travel andaccommodation etc)Extension of court surface and overlay existing surfAçe 47289.60Construction of liohtino (verbal ouote awaitinq written quote) 171000.00Power Box Upqrade (verbal quote awaiting written quote) 22000.00Sub-Total (C) 240289.60Budoet surolus or deficit 0sFGP-2402-7409-11-12 Printed on 1510412011 al 12:15:51 Page 4General Manager's Report4 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 460 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILObjectives&NSWCommunitiesSporl & Recrcationlncrease ropportunitphysical aObiectiveonturedHow will the proiect do thisbe involved in soorts more often.sFGP-2402-7409-11-12 Printed on 151O412011 at12:15:51Page 5General Manager's Report5 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 461 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILObjec'tives&NS\ /CommunitiesSport & RecrcationObiectivelmprove access for people from groups thattraditionally find it diffìcult to access sport.How will the proiect do thisMost ofd as Rural orRemoteto gain access tosports aisolation frommajor centres.Narrabri is located I hour from other similar sized towns andState levelssFGP-2402-7409-11-12 Printed on 1510412011 at 12:15:51 Page 6General Manager's Report6 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 462 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILObjectivesCommunitiesSport & RecrcatlonObiectivelmprove safety at sport and recreation facilities.How will the oroiect do thisthebewhichSFGP-2402-7409-11-12 Printed on 1510412011 al 12:15:51 Page 7General Manager's Report7 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 463 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILObjec'tivesCommunitiesSpoÊ & RecrcatlonObiectiveDevelop environmentally sustainable sport andrecreation facilities.How will the oroiect do thislnstallation of lighting in the current netball courts will increaseutiliation of this-facilit-y reducing the need for more courts inthe future.sFGP-2402-7409-11-12 Printed on '1510412011 al 12:15:51 Page 8General Manager's Report8 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 464 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILObjectivesCommunitiesSpoÊ & RecrcationObiectiveAssist people from identified groups that facebarriers to participating in sport and recreation.How will the oroiect do thisIhis oroiect addresses the needs of three groups Departmentrf Sport-and Recreation has identifìed as facing barriers toparticipating in sport and recreation, these are;Group 1 - lndigenous peopleNarrabri Shire consists of 6 small townships; Narrabri, WeeWaa, Boggabri, Pilliga, Gwabegar & Bellata'This is a significantly higher proportion of indigenous residentsthan the average Australian community.Group 2 - People from Rural and Remote areasGroup 3 - Women and girlsNetball is predominately played by female_s.aged..18 to.24vears. And where women make up just 45% of all sportóarticipation, 86.6% of people who take part in netball are.400 ,400 oarticioants participants nationallY).y 300 women and girls in the shireh¡s ¡s t0% of the eligible femalebooulátion in our shire. The national average participation ratein iretball for regional areas is 26.2%.lmprovement of thefacilities availa5le for netball in our shire will increase the rateof participation, affecting up to 490 additional players. (Basedon'2006 Census data añd statistics from the Ausport'gov.auwebsite).sFGP-2402-7409-11-12 Printed on 1510412011 al12:15:51Page 9General Manager's Report9 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 465 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW GommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILOrganisational capacityCommunities # w Sport & RecrcatlonYearDescription2011 NSW Local Government Authority with significant capacity to manage capital projects of a large anddiverse nature.Recentlv comoleted Lioht Uo Collins Park Proiect (Federalfunding)2007 lnstallation of Shade Structure over plav equipment at Collins Park in 2007 (DSR qrant funding)sFGP-2402-7409-11-12 Printed on 1510412011 al12:15:51Page 10General Manager's Report10 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 466 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW CommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILProject OuþutsCommunitiesSpoË & RecrcatlonNumber ofBeneficiaries/Target G rou PsBeneflt to the particiPantsParticipantsNARRABRI NETBALL ASSOCIATION 300 Safety and participation ratesto be improved via lightingand oavement surface upgr¿ de.NARRABRI BASKETBALLassôetaTloN80 More courts and better facilities will increaseoarticioation in Basketball in the shire.sFGP-2402-7409-11-12 Printed on 1510412011 at 12:15:51 Page 11General Manager's Report11 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 467 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.aNSW GommunitiesSport and Recreation Facility Grant ProgramNARRABRI SHIRE COUNCILProiect OutcomesCommunitiesSpoÊ & RecrcationWhat is the longer term benefit to the sport, community or industryThe intended outcomes of the project are as follows;* lmprove safety for isability and surface* lmproved participa basketball* lmþroved iacilitiès cess to training days and clinics to improve skills in local community* imþroved health in and girls " and "rural and remote areas" and "indigenous"The following strategies will be implemented to achieve and sustain the above outcomes;* Project management plan will be drafted to manage the various stages of the project to the successfulinstallation of new lighting, pavement and line marking'* Council will liase wiín ine sporting groups that cùrrently utilise this facility to encourage them to make use ofthe new lighting and promote this facility to their players and the wider community.sFGP-2402-7409-11-12 Printed on 1510412011 al 12:15:51 Page 12General Manager's Report12 of 12 March 2012 Ordinary Business PaperUpgrade of Netball CourtsPage 468 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.1.8.b\ltl/,l_ldd;i@liìlÌoa)ær1tllo oI)IVOLUI,lESASPHAtTBASE {(RUSHED 6RAVTL)111.7ó m'2t*.6 n'51.12 IGeneral Manager's ReportUpgrade of Netball Courtsrab riNARR/IBRI SHIRE GOUNCIL.æ rmiD ffGEÎiMil x¡w us PXr (oz) aæ0 6aæ Fsr (o2) a7¡a 6l¡NARRABRI NETBALL COURTSPROPOSED COURT UYOUTNETBALL AND BASKETBALL1 of 1 March 2012 Ordinary Business PaperPage 469 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.9 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Appointment of Acting General ManagerGeneral ManagerNil to this reportRECOMMENDATION: That the Council accept the resignation of Mr Phillip Marshallfrom the position of General Manager as at 9 th April 2012.RECOMMENDATION 2: That the Council appoint Mr Paul Wearne as Acting GeneralManager from 10 th April 2012 until as such time as Council appoints a General Manager inaccordance with Clause 336(1) of the Local Government Act 1993.RECOMMENDATION 3: That the Council set the salary payable to Mr Wearne whilstundertaking the role of Acting General Manager, at the equivalent of that presently paid tothe outgoing General Manager.RECOMMENDATION 4: That the Council delegate to Mr Paul Wearne for such time ashe holds the position of Acting General Manager with the exception of these items listed inSection 377 of the Local Government Act 1993 which are specifically reserved to Council fordetermination.IssuesTo meet the requirements of Section 336 Filling of vacancy in position of General Manager“(1) If a vacancy occurs in the position of General Manager, the Council mustimmediately appoint a person under Section 334 to the vacant position orappoint a person to act in the vacant position.”Section 377 General Power of the Council to Delegate“(1) A decision may, by resolution delegate to the General Manager or any otherperson or body (not including another employee of the Council) any of thefunctions of the Council, other than the following:(a) the appointment of a general manager;(b) the making of a vote,……(u) any function under this or any other Act that is expressly required tobe experienced by resolution of the Council.”BackgroundThe resolution follow a formalised process and meet the terms and conditions of the LocalGovernment Act 1993.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 470 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTCurrent SituationIn my opinion, Mr Wearne is more than capable of holding down the position of Acting GeneralManager and has proven his capabilities since arriving in Narrabri in July 2011. In that time he hasperformed the Acting role during periods of leave of the General Manager.AttachmentsNil to this report.Financial ImplicationsSalary increase from $150K to $180K.Statutory/Legal ImplicationsCovered in issues of this report.Environmental ImplicationsNil to this report.Management Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 471 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.10 GENERAL MANAGER’S REPORTSubject:Author:Conflict of Interest:Recruitment of General ManagerGeneral ManagerNil to this reportRECOMMENDATION 1: That the Council appoint Red Eagle Recruitment to undertakethe recruitment to the position of General Manager.RECOMMENDATION 2: That the Council authorise the Mayor to be the liaison withthe Recruitment Consultant and that the full Council be the interview panel.RECOMMENDATION 3: That the remuneration package be set at $190,000 to includesuperannuation contributions and an amount to be salary sacrificed for the motor vehicle inaccordance with Council policy.IssuesSection 344 appointment of General Manager“(1) A Council must appoint a person to be its General Manager……..(2) The position of General Manager is a senior staff position.”Section 338 Nature of Contracts for Senior Staff“(1) The General Manager and other senior staff of a Council are to be employed undercontracts that are performance-based.(2) The term of the contract must not be less than 12 months or more than 5 years…”BackgroundAs alluded to in report titled Appointment of Acting General Manager.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 472 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTCurrent SituationThe Council has sought quotations from five recruitment organisations which have had experiencein local government recruitment. These are:COMPANYBlackadder Associates(Stephen Blackadder)Local Government Management Solutions(Mark Anderson)Local Government Appointment(Denis McGuinn)Red Eagle Recruitment(Tama Wallace)McArthur(Matthew McArthur)COSTSFixed Fee of $15,000GST exclusive, travel and accommodationcostsFixed Fee of $14,000GST exclusive, travel and accommodationcosts10% based on the gross cash component =$18,000 GST exclusive, travel andaccommodation costs6.5% based on the total remunerationpackage ie. using $190,000 then the feewould be $12,350 GST exclusive, travel andaccommodation costsFixed fee of $17,500GST exclusive, travel and accommodationcostsThe recruitment firms which have submitted an Expression of Interest are known to the Council,and offer similar levels of service.In order of costs, bearing in mind, advertising, travel and accommodation costs and any otherservice to be provided including applicant profiling will incur similar costs, the lead organisation isRed Eagle Recruitment at $12,350 + GST.AttachmentsNil to this report.Financial ImplicationsTo be covered within the Human Resources Recruitment budget.Statutory/Legal ImplicationsCovered in report.Environmental ImplicationsNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 473 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTManagement Plan/Strategic PlanNil to this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 474 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.11 GENERAL MANAGER’S REPORTSubject:Human Resources UpdateAuthor:Conflict of Interest:Human Resource ManagerNilRECOMMENDATION: That the Council note and receive information on activities withinthe Human Resources section of Council.Issues:Recruitment UpdateMake It Work – Sharing Workers Locally Pilot updateBackground: An update on activities was provided at the February 2012 Council meeting. Thisinformation follows on from that report.Current SituationNew appointments Adam Scott Road Services LabourerGrant WhitingGlenn SandsSteven SharpleyBrendan WilkinsScott DewarKane RussellPeter FoxeRoad Services LabourerRoad Services LabourerRoad Services LabourerRoads Services LabourerRoads Services Labourer (temporary)Roads Services Labourer (temporary)Roads Services Labourer (temporary)Exiting employeesMIW General HandCurrent recruitment Waste DepotAttendant x 2Gardener (Narrabri)Selection processSelection processGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 475 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTRoads MaintenanceProjectsCoordinatorRecruitment processWater ServicesOperators x 2Human ResourceOfficer – WHS(temp)Recruitment processRecruitment processSpecialistOperatorPlantRecruitment processMake It Work: Sharing Workers Locally Pilot updateThree General Hands were successfully appointed to the Road Services Labourer positions andhave commenced in these positions on the 27 th February 2012. Two of the successful applicantswere offered permanent full time positions and the other successful applicant was offered a 12month full time position.The three remaining General Hands are currently filling vacancies within Council. Two areworking as Waste Attendants and one is covering a vacant Gardener position in Wee Waa while anemployee is on leave.Three host employers have said they would like to host General Hands in the near future includingAuscott, ACRI & Whitehaven Coal. Council is waiting to receive signed Employer Agreementsprior to the employees starting with the host employers. Safety inspections have been conductedand approved for Auscott and ACRI. A safety inspection will need to be conducted and approvedfor Whitehaven Coal.The final training course “Trim & Cross Cut Felled Trees” is to be held in Gunnedah on the 22 nd &23 rd of March 2012.AttachmentsNil to this reportFinancial ImplicationsThese activities have been budgeted for the 2011/2012 budgetStatutory/Legal ImplicationsReference to various acts, policies etcGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 476 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNil to this reportManagement Plan/Strategic PlanContinued roll-out of the Sharing Workers Locally Pilot for seven (7) employees includingassistance to the Make It Work in the development of program documentation.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 477 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.1.12 GENERAL MANAGER’S REPORT ED/REPORTINGSubject:Author:Conflict of Interest:Economic Development March UpdateCommunity Development OfficerNil.RECOMMENDATION: That Council receive and note the March update from theEconomic Development Section.IssuesTo provide Council with an update on projects undertaken by the Economic DevelopmentSection (EDS) during the last month.BackgroundThe Economic Development Section encompasses Economic and Community Development.Current SituationThe following ongoing tasks are being undertaken by the EDS.Prepared one page brief on the impacts of recent flood events. Included various flood photos.Finalised further Sporting Wall Of Fame amendments. Six new plaques were required and thesewill be mounted in the next month.Received email from Hunter New England Population Health requesting assistance in recruiting ahost to establish a Sentinel Chicken Flock to survey flaviviruses in Wee Waa. Contacted Wee WaaHigh School who were very interested in the project and thankfully contact was made with themprior to any advertising to find a host. Put Wee Waa High in contact with Hunter New EnglandPopulation Health.Successful in receiving $1,100 grant from Office for Women’s Policy for International Women’sDay. Organised local speakers on womens health and movie screening evening at The CrossingTheatre. Arranged advertising through newspaper, posters, website and facebook. Prepared mediarelease.Attended Narrabri Tidy Towns Meeting. Advised group of requirements being the coordinator ofClean Up Australia Day. Advised group of opening date for entries in Tidy Towns and of a newcategory for New Towns in 2012.Represented Council at Narrabri Place Team meeting. Meeting was held to discuss proposedPlanning Day. It was noted by the group it was important that Council have representation on thisday.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 478 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTLiaised with Narrabri Tidy Towns, Rotary, Scouts and McDonalds regarding their sites for CleanUp Australia Day. Arranged rubbish collection points and vouchers. Arranged advertising andprepared media release for local radio and newspaper.Prepared feature advertisement to show Council support for Seniors Week Wheel Chair Challenge.Communicated with Woollahra Municipal Council to receive update on ‘Bush meets the Beach’event where Year 9 aboriginal youth from Narrabri Shire will travel to Sydney in November 2012.Woollahra Municipal Council have also been in contact with Wee Waa and Narrabri High School’saboriginal liaison officers.Comtinued to liaise with Youth Worker at NDCAS to plan activities for Youth Week in April.Applied for shuttle bus grant through NSW Centre for Road Safety in Transport for NSW (undertheir banner ‘Take the Slow Down Pledge’).Weekly discussions with various departments of Council to obtain information to place inCouncil’s weekly Whats Happening at Council article in each Thursdays’ edition of The Courier.Continuously updated and maintained Council’s website and Facebook page as required withadvertisements and public exhibition documents. Providing and updating all flood assistanceinformation on home page of website.Spoke to Louis Dreyfuss in relation to fixing the Newell Highway near their business. He advisedthat the RTA had given them 3 months to finalise the road which came about due to heavy rainsrecently experienced.Spoke to and ultimately provided a number of promotional brochures and information to a builderwho is considering moving to Narrabri Shire from Queensland.Put together and delivered 50 Narrabri Shire information packs to Speedie Staff Solutions to use asrequired for potential clients outside of the Shire. Speedie Staff Solutions appreciated thebrochures.Researched a cleaning organisation in Boggabri to do an initial clean of the Boggabri Caravan ParkCabins prior to fitting it out and arranged for a thorough clean to be undertaken.Collated all Expression of Interests received in relation to the sale of Council owned land. Madecontact with all parties and advised them that the Expressions of Interest will be going to Councilfor a decision and subsequently wrote a report.Confirmed with electrician that all works have been finalised at the Boggabri Caravan Park Cabins.Arranged a valuation for the Francis Street property.Provided Integrity New Homes with a verbal update on the Narrabri Shire economy as well asforwarded promotional material to them to use to assist them in selling Council’s Shannon Estateblocks.Delivered and set up televisions to the Boggabri Caravan Park cabins.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 479 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTChecked all water, plumbing and electrical items were working at the Boggabri Caravan Parkcabins, which they were.Received and checked all goods to be placed in cabins after the cleaning is finished.Company NameSpeedie StaffSolutionsLocal BusinessPartnershipSantos and TheAllen ConsultingGroupMeetings HeldDiscussionMet with the new manager of Speedie Staff Solutions and her supervisor.Arranged to take them to The Courier for an introduction and story. Companyis excited to be in Narrabri and are looking forward to the short to mediumterm future.Met with a local business partnership and provided information in relation toinitial enquiries. With that information they are going to consider their wayforward and the potential for their business.Met with both parties who were doing the rounds of Council’s, stakeholdersand community groups throughout north west New South Wales providingthe results of their research.Christina O’Brien Introduced Speedie Staff Solutions recruitment officer to The Mac andprovided and introductory tour and information relating to Narrabri Shire.This provided a good understanding of the Shire economy.The MacAustralia MillingIdemitsuInvestorAustralia MillingEldersPeeceVisited the business with Speedie Staff Solutions. Enquired about currentoccupancy at the village and found out they were running in the high 100’s.Met with the manager to allay any concerns he had in relation to vehicleaccessibility to their business when the road is being built. Any interruptionshould only be for a period of approximately 2 months.With General Manager, met with company to discuss mine and road progressand initiate change to VPA.Provided requested overall information about the Narrabri Shire economy aswell as potential sites for their consideration. Investor undertaking initialresearch.With General Manager met company manager to discuss new road beingbuilt by Council coming off Yarrie Lake Road.Met with local agent to discuss potential blocks for sale and general health ofthe real estate industry.With Design Services Manager provided a range of road movement andeconomic data for a report they are undertaking on behalf of RegionalDevelopment Australia.The EDS proactively, and on request, provide a range of detailed and ongoing information toexisting and new businesses that are considering establishing or expanding their presence inNarrabri Shire. Initial contact in the form of phone calls and follow up letters and marketingmaterials were sent to potential new businesses.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 480 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTAeropelican have recorded the following figures up until February 2012.Narrabri to Sydney Passenger Figures2009 2010 2011 2012Month Number Month Number Month Number Month NumberJanuary 521 January 517 January 793February 923 February 1101 February 1378March 67 March 1165 March 1279April 1048 April 1009 April 1098May 1170 May 1009 May 1356June 1170 June 1054 June 1290July 1222 July 1032 July 1100August 1176 August 1005 August 1432September 1169 September 1215 September 1306October 1156 October 1136 October 1296November 1077 November 1086 November 1351December 951 December 801 December 1060Narrabri to Brisbane Passenger Figures2011 2012Month Number Month NumberMarch 387 January 313April 395 February 444May 367June 413July 347August 400September 295October 334November 305December 318Narrabri to NewcastlePassenger Figures2011Month NumberMarch 101April 198May 205June 230July 148August 173September 178October 74AttachmentsNil.Financial ImplicationsThere are no financial implications resulting from this report.Statutory/Legal ImplicationsThere are no statutory / legal implications resulting from this report.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 481 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsThere are no environmental impacts resulting from this report.Management Plan/Strategic PlanNil.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 482 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.2.1 DIRECTOR CORPORATE SERVICES REPORTSubject:Author:Conflict of Interest:Questions Without Notice RegisterDirector Corporate ServicesNilRECOMMENDATION: That the Questions Without Notice Register report be received andnoted and that the completed items marked ‘yellow’ be approved for deletion from theRegister.IssuesProvide an updated Questions Without Notice Register to CouncilBackgroundQuestions of staff raised by Councillors at Council Meetings are recorded so that responses can beprovided.Current SituationQuestions raised at the February Council meeting have been included on the Register and responsesfrom the relevant staff have been provided.AttachmentsQuestions Without Notice Register – Attachment 10.2.1.aStatutory/Legal ImplicationsNilEnvironmental ImplicationsNilFinancial ImplicationsNilManagement Plan/Strategic PlanNilGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 483 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.1.aQUESTIONS WITHOUTNOTICE REGISTERREF NOQ 047Q 048Q 049Q 050Q 051Q 052DATE OFMEETING21‐Feb‐1221‐Feb‐1221‐Feb‐1221‐Feb‐1221‐Feb‐1221‐Feb‐12QUESTIONRAISED BYCr BatesCr BoltoinCr EtheridgeCr KellyCr SevilCr LowderMATTER RAISEDDEPT OFFICERHave we receivednotification/confirmation of the roadsflood damage claim yet? ENG DESWill staff be concentrating on "openingroads" in the short term?Do we have all available gradersworking?ENGENGDESDESCan an inspection of urban floodways beundertaken by the Urban Area FloodwayCommittee?ENG DESCan staff arrange for the pair of shoescaought on the power lines inENG DESTibberinna St to be removed?Are Cottonpickers able to be "walked"along highways and major roads? ENG DESRESPONSEThe estimated damage bill is in thevicinity of $10M to $15M.Assessment of some roads has beenundertaken by the RMS to date andis continuing.YesCouncil's 6 graders along with 2contract graders are concentratingon flood damage works now. Asroads are assessed additionalresources will be engaged. Staff arealso investigating lease and/orpurchase of additional gradersOne will be arrangedRESPONSEDATE21/02/201221/02/201221/02/201221/02/2012The matter has been reported toEssential Energy as it is their 21/02/2012responsibilityThis matter will be referred to theTraffic Committee. 21/02/2012Director Corporate Services ReportQuestions Without Notice1 of 2 Last Updated 15/03/20121 of 2 March 2012 Ordinary Busines PaperPage 484 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.1.aQUESTIONS WITHOUTNOTICE REGISTERREF NODATE OFMEETING21‐Feb‐12QUESTIONRAISED BYCr O"ReganMATTER RAISEDWhen will SR7 be graded?DEPTENGOFFICERDESRESPONSEThe maintenance grading program iscurrently under review so that flooddamage works can be incorporatedwhere possible to improveefficiencies. More information willbe availoaable at the CouncilBreifing session in early MarchRESPONSEDATE21/02/2012Q 053Q 05421‐Feb‐12Cr ReddingCould the matter of Roadtrain and BDoubles past the Narrabri West Schoolbe referred to the Traffic Committee?ENGDESThis matter will be referred to theTraffic Committee.21/02/2012Director Corporate Services ReportQuestions Without Notice2 of 2 Last Updated 15/03/20122 of 2 March 2012 Ordinary Busines PaperPage 485 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.2.2 DIRECTOR CORPORATE SERVICE’S REPORT F10/02005Subject:Author:Conflict of Interest:Quarterly Financial ReviewFinancial Services ManagerNil.RECOMMENDATION 1: That the Council approve the budget variations arising as aresult of the December 2011 quarterly review.RECOMMENDATION 2: That pursuant to section 407(1) of the Local Government Act1993, the Council adopts the quarterly review report covering the period October toDecember 2011 as presented.RECOMMENDATION 3:Program as presented.That Council adopt the Revised 2011/12 Capital WorksIssues Present the financial performance of Narrabri Shire Council against the 2011/2012Management Plan, adjusted for revised estimates, for the quarter October 2011 toDecember 2011.BackgroundSection 407(1) of the Local Government Act 1993 requires that the General Manager must reportto Council within 2 months after the end of each quarter as to the extent to which the performancetargets set by the council’s current management plan have been achieved during that quarter. Thedelegated authority extends to the Finance Manager to report on the financial performance ofCouncil.Current SituationCouncil’s current position is outlined in Attachment 10.2.2.a. These reports show Total Income &Expenditure, Capital, Investment & KPI’s compared to Total Annual Budget including budgetrevisions with the format a requirement set by the Division of Local Government.Budget revisions approved at the September Quarterly Budget Review have already been includedin all reports. Given that this report covers the second quarter of the year, no significant variationsin Operating Income and Expenditure are apparent. All changes to the operational budget havebeen neutral.Operating Income ReportThe total operating income budget for Council was $35.796M. To date, $24.583M has beenreceived representing 68% of the budget, as at the 31 st December 2011.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 486 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTOperating Expenditure Summary ReportAs at the 31 st December 2011, $19.585M has been spent representing 61% of the 2011/2012 budgetof $32.189M.Capital Expenditure Summary ReportThe capital expenditure report shows out of an original budget of $38.811M, that $8.706M hasbeen spent to date representing 22% of the budget.Council originally adopted a large number of Capital Works projects for the year ($32.185M) andalso “carried over” projects (Minute 685/2011) that were not completed as at 30/06/2011. Thesecarryover projects totalled $6.603M. Capital funding totalling $33.961M has been identified forthese works. The resulting shortfall is $4.850M.A thorough review of the Capital Works Program has been undertaken by staff taking intoconsideration the financial and physical resources presently available and the timeframe until theend of the financial year. This review included consultation with relevant managers particularly inrelation to the level of resources available and the timeline required to complete projects.A Revised Capital Works Program has been prepared for the consideration of Council and isenclosed as Attachment 10.2.2.b. This program incorporates:Known budget variations (+/-) to existing votesStatus of projects already commencedSuggested deferment of projects not yet startedImpact on Council’s Rates & Other Untied Funding (General Fund)With respect to the deferment of projects it is proposed, subject to the approval of Council, thatthese items be placed in the list of projects to be considered for inclusion in the 2012/13 Budget.This will allow Council to review its priority for capital expenditure as part of the managementplan process.The revised works schedule is still large however is viewed by staff as being more easilyachievable between now and year end.Attachments:Attachment 10.2.2.a: Quarterly Budget Review Statement for the period 01/10/11 to 31/12/11;Attachment 10.2.2.b: Revised 2011/12 Capital Works ProgramFinancial ImplicationsThe quarterly review gives Council the opportunity to analyse the performance of actualexpenditure and income against budget.Statutory/Legal ImplicationsRequirement of the Division of Local GovernmentGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 487 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTEnvironmental ImplicationsNil.ConclusionThe responsible accounting officer believes the quarterly financial review statement indicates thatCouncil’s financial position is satisfactory, having regard to the original estimate of income andexpenditure and variations resulting from this review.Management Plan/Strategic PlanProficient Financial Management – Accurate and Timely Provision of Management AccountingProcesses; Ensure management accounting processes under the function areas of debtors, creditors,rating, payroll, fleet, supply and investments are accurate and in line with appropriatelegislation and proper accounting principles.Proficient Financial Management – Provision of Timely and Accurate Statutory Reporting; Submit all statutory financial reporting within legislated timeframes.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 488 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 lo 31112111Table of Gontents1. Responsible Accounting Officer's Statement2. lncome & Expenses Budget Review Statement's- By Type- By Activity3. Capital Budget Review Statement4. Cash & lnvestments Budget Review Statement5. Key Performance lndicator (KPl) Budget Review Statement6. Contracts & Other Expenses Budget Review Statement2346I1011-12Director Corporate Services ReportQuarterly Financial Review1 of 15 March 2012 Ordinary Business PaperPage 489 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 to 31112111Report by Responsible Accounting OfficerThe following statement is made in accordance with Clause2A3Q) of the Local Government (General)Regulations 2005:It is my opinion that the Quarterly Budget Review Statement for Narrabri Shire Councilfor the quarter ended 31112111 indicates that Council's projected financial position al3016112 will besatisfactory at year end, having regard to the projected estimates of income and expenditureSigned:PaulWearneResponsible Accounting OfficerDirector Corporate Services ReportQuarterly Financial Review2 of 15 March 2012 Ordinary Business PaperPage 490 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire Councillncome & Expenses Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 lo 31112111Budget review for the quarter ended 31 December 2011lncome & Expenses - Gouncil Gonsolidated($000's)lncomeRates and Annual ChargesUser Charges and Feeslnterest and lnvestment RevenuesOther RevenuesGrants & Contributions - OperatingGrants & Contributions - CapitalNet gain from disposal of assetsShare of lnterests in Joint VenturesTotal Income from Continuing OperationsOriginal Approved Changes RevisedBudget Otherthan SeP Dec Budget2011112 by a QBRS QBRS QBRS 201111215,2633,7398361,8957,9936,013435,7433023- 15,263- 3,739- 836- 1,895- 8,023- 6,036-435,796Variations Notesfor thisDec QtrProjectedYear EndResult15,2633,739836I,8958,0236,036435,796ActualYTDfigures15,5761,4835771,7035,1 13131ExpensesEmployee CostsBorrowing CostsMaterials & ContractsDepreciationLegalCostsConsultantsOther Expenseslnterest & lnvestment LossesNet Loss from disposal of assetsShare of interests in Joint VenturesTotal Expenses from Gontinuing OperationsNet Operating Result from Gontinuing OperationsDiscontinued OperationsNet Operating Result from All Operations10,4956817,7429,2621361173,7263010,4956817,7729,2621361173,72632,159 32,1893,584 233,6073,584 233,60710,4956817,7729,2621361173,7265,6752525,8054,8282051922,36726132,189 19,5853,607 4,998Net Operating Result before Capital ltems (2,4291 - (2,4291This statement forms part of Council,s euarterly Budget Review Statement (QBRS) for the quarter ended 31t12t2011 and should be read in conjuction with the total QBRS repDirector Corporate Services Report3 of 15 March 2012 Ordinary Business PaperQuarterly Financial ReviewPage 491 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire Councillncome & Expenses Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 lo 31112111Budget review for the quarter ended 31 December 2011lncome & Expenses - Gouncil Consolidated($ooo's¡lncomeAdministrationPublic Order & SafetyCommunity Services & EducationHoousing & Community AmenitiesWater SuppliesSewer SuppliesRecreation & CultureManufacturing & ConstructionTransport & CommunicationEconomic AffairsTotal lncome from Continuing OperationsOriginal Approved Ghanges Revised VariationsBudget Other than Sep Dec Budget for this2011t12 by a QBRS QBRS QBRS 2011112 Dec Qtr14,32137256-30-3,5273,0472,163___22911,50951914,321372863,5273,0472j6322911,53251935,796ProjectedYear EndResult14,321372863,5273,0472,16322911,53251935,796ActualYTDfigures13,264285252,2462,0082,1541,7091562,520216ExpensesAdministrationPublic Order & SafetyCommunity Services & EducationHousing & Community AmenitiesWater SuppliesSewer SuppliesRecreation & CultureManufacturing & ConstructionTransport & CommunicationEconomic AffairsTotal Expenses from Continuing OperationsNet Operating Result from Continuing OperationsDiscontinued OperationsNet Operating Result from AII Operations4,714898687,3762,2622,012754-3030(30)4,744868987,3762,2622,01275412,510 - 12,5101,565 - 1,56532,159 32,1893,584 23 - 3,607 -4,744868987,3762,2622,01275412,5101,5653,6072,0083941561,383I,1001,0163,3129898,50772032,1 19,5854,998Net Operating Result before Capital ltems(2,4291 (2,42e)(2,42e)This statement forms part of Counc¡l,s euarterly Budget Review Statement (QBRS) for the quarter en ded 31t'12t2o11 and should be read in coniuction with the total QBRS repDirector Corporate Services Report4 of 15 March 2012 Ordinary Business PaperQuarterly Financial ReviewPage 492 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 to 31112111lncome & Expenses Budget Review StatementRecommended changes to revised budgetBudget Variations being recommended include the following material items:Notes DetailsDirector Corporate Services ReportQuarterly Financial Review5 of 15 March 2012 Ordinary Business PaperPage 493 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire CouncilGapital Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 lo 31112111Budget review for the quarter ended 31 December 2011Gapital Budget - Council GonsolidatedOriginal($000's)Budget2011112Gapital ExpenditureNew Assets- Plant & Equipment- Land & Buildings- OtherRenewal Assets (RePlacement)- Plant & Equipment- Land & Buildings- Roads, Bridges, FootPaths- OtherLoan Repayments (PrinciPal)Other Expenditure...Water & SewerTotal Gapital ExPenditureRevised Variations ì'lcir'3Other than Sep Dec Budget for thisby a QBRS QBRS QBRS 2011112 Dec Qtr898 2511,595 148,561 2,502Approved Ghanges3,702 214 23125 1,1773,756 2,352473 52930 117- (148)(u':):- 3,939273 1,575148 6,256- 525- 1,047775 (260)11,089 (1,469)11,063 (2,840)(8)185'1,084ProjectedYear EndResult5159,6208,2233,9311,7607,3407161,0471,68934,841ActualYTDfigures2,4022,7221,5981878801995381802,145 150 - 247 2,542 (853)æ 23 - 38,811 (3,970) 8,706191Capital FundingRates & Other Untied FundingCapital Grants & ContributionsReserves:- External Resrtictions/Reserves- lnternal Restrictions/ReservesNew LoansReceipts from Sale of Assets- Plant & Equipment- Land & BuildingsOther Funding... enter description hereTotalGapital Funding6,8336,013 9726,603 7811,424 4,7335,35060950023- 6,833 (1,905)- 7,008 5,0157,384 (1,481)6,157 (2,171\- 5,350 1,48060e (10e)- 500 823 1 17 - ..1?o= !2!)4,92812,0235,9033,9866,830500582891,6861,8901,0513,100T 33,961 880 34,841 8,7067272493Net Capital FundingDirector Corporate Services ReportTh¡s statement forms part of council,s euartely Budget Rev¡ew sratement (QBRS) for the quarter ended gM2t2o11and 6 of 15should be read in coniuct¡on with the total QBRS repMarch 2012 Ordinary Business PaperQuarterly Financial ReviewPage 494 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 to 3111211'lGapital Budget Review StatementRecommended changes to revised budgetBudget Variations being recommended include the following material items:Notes DetailsDetails of variations totalling $4.850M reduction in the Capital Budget are attachedDirector Corporate Services ReportQuarterly Financial Review7 of 15 March 2012 Ordinary Business PaperPage 495 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire CouncilCash & Investments Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 to 31112111Budget review for the quarter ended 31 December 2011Gash & lnvestments - Council Consolidated($000's)Externally Restricted (r)Water FundsSewer FundsDomestic Waste FundDeveloper s94 ContributionsSection 93F (Mining) ContributionsRTA ContributionsUnspent GrantsSecurity DepositsShannon Estate LoanTotal Externally Restricted(1) Funds that must be spent for a specific purposeOriginalBudget20111127,449 943,301 (153)72583945Otherthan Sep DecbyaQBRS QBRS QBRS16',175772'13(5e8)Revised VariationsBudget for this2011112 Dec Qtr7,5433,148161791 ,160213347941952,649 (1,334) 1,31515,093 (1,032) 14,061ProjectedYear EndResult7,5433,148161791 ,16021334795ActualYTDfigures7,5433,148176791 ,160213347951,315 1,31514,061 14,O76lnternally Restricted (2)Employee Leave EntitlementsContributions & Donations PolicyNurruby Land PurchaseOffice EquipmentAdministration BuildingNarrabri LibraryWee Waa LibraryCultural CentreHousingFrancis StreetCommunity I nfrastructureWWSI MaintenanceCollateralised Debt ObligationsParks & GardensCaravan ParksSwimming PoolsDepotPlant Replacement504511025515;24725945221521558040050291(e)(4)(1)(10)126- 2505724 (11)68 (2)59-224512142 (42)15582526 (318)This statement forms part of Council's Quarterly Budget Review Statement (OBRS) for the quarter ended 31t12t2011 and should be read in conjuction with the total OBRS repDirector Corporate Services Report8 of 15 March 2012 Ordinary Business PaperQuarterly Financial ReviewPage 496 of 555 of the March 2012 Ordinary Business Paper79551012550512991,0945101255051250571366592245121155822081,094510125505125057136659224512115582208

Narrabri Shire CouncilCash & Investments Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 to 31l,12fi1Budget review for the quarter ended 31 December 2011Cash & lnvestments - Gouncil Consolidated($ooo's¡QuarriesRTA SRMCC Contract ReserveSaleyardsSection 355 CommitteesCarryoversOther Restricted FundingTotal lnternally Restricted(2) Funds that Council has earmarked for a specific purposeOriginalBudget2011t121,468100Other thanby a QBRSQBRS1221,59010096962,6042,218117 75(344)ProjectedYear EndResult1,246100962,27059ActualYTDfigures1,246100962,270596,481 6,481Unrestricted (ie. available after the above Restrictions)Total Gash & InvestmentsThis statement forms part of Council's Quarterly Budget Rev¡ew Statement (QBRS) for the quarter ended 3111212011 and should be read in conjuction with the total QBRS repDirector Corporate Services Report9 of 15 March 2012 Ordinary Business PaperQuarterly Financial ReviewPage 497 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 to 31112111Gash & lnvestments Budget Review StatementComment on Gash & lnvestments PositionNot ApplicableInvestmentslnvestments have been invested in accordance with Council's lnvestment Policy.GashThe value of Cash at Bank which has been included in the Cash & lnvestment Statement totals $314,861This Cash at Bank amount has been reconciled to Council's physical Bank Statements.The date of completion of this bank reconciliation is 31112111Reconciliation StatusThe YTD Cash & lnvestment figure reconciles to the actual balances held as follows:Cash at Bank (as per bank statements)lnevstments on Hand$ 000's31920,242less: Unpresented Chequesadd: Undeposited Funds(Timing Difference)(Timing Difference)(6)2Reconciled Gash at Bank & lnvestments20,557Balance as per Review Statement:20,557Difference:Director Corporate Services ReportQuarterly Financial Review10 of 15 March 2012 Ordinary Business PaperPage 498 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire CouncilKey Performance lndicators Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 to 31112111Budget review for the quarter ended 31 December 2011($ooo's¡The Council monitors the following Key Performance lndicators:1. Unrestricted Gurrent RatioCurrent Asstes less all Extenal RestrictionsCurrent Liabitities less Specific LiabilitiesCurrent Projection Original ActualsAmounts lndicator lndicator Prior Periods11t12 11112 11112 10111 09/10+i 4.62:1 4.oo:1 3.24:i 1.e3:1To assess the adequacy of working capital and its ability to satisfy obligations in the short term for theunrestricted activities of Council.2. Debt Service Ratio. ,6!.1 7 o/o g % 1'ro/o 16 %9,1 58To assess the impact of loan principal & interest repayments on the discretionary revenue of council.14.0012.0010.00, 8.00: 6.00.9 4.00Ë 2.oost o.oo25 o/o20 o/o15 o/o5.t 10 o/o3 5o/oO o/o1. Unrestr¡cted Current Ratio3.ro ,.933.24 4'oo n'u',lt rr tt i,¡ [l2008109 2o09lt0 2010/11 20lut2 zotuLz(o) (P)2. Debt Service Ratio160/€8oh I I :tisoh 7oh2008/09 20o9lt0 20t0ltt zoLLlL2 20tur2(o) (P)3. Rates & Annual Charges Coverage Ratio16.82724,928Rates & Annual Charges + ae -/o 35 % g6 % 41 o/oTo assess the degree of Council's dependence upon revenue from rates and annual charges and to assessthe security of Council's income.100 o/o0 o/o 2008/09 2009/10 20r0/1L 20tut2 20ttlt2(o) (P)3, Rates &Annual Charges çoyerage Rat¡o690h42ot6 qLoh3¡6oh 350/6,l80 o/oS 600/oE 40o/oE 2ovoDirector Corporate Services ReportQuarterly Financial Review11 of 15 March 2012 Ordinary Business PaperPage 499 of 555 of the March 2012 Ordinary Business Paper

Narrabri Shire CouncilKey Performance lndicators Budget Review StatementAttachment 10.2.2.aQuarterly Budget Review Statementfor the period 01110111 lo 31112111Budget review for the quarter ended 31 December 2011($ooo's¡Current Projection Original ActualsAmounts lndicator lndicator Prior Periods11112 11t12 11112 10111 09/104. Rates & Annual Charges Outstanding RatioRates. Annual& Extra Charqes OutstandingRates, Annual& Extra Charges Collectible 16,827+ 5.4 o/o 6.7 o/o 6.8 o/o o.B %To assess the impact of uncollected rates and annual charges on Council's liquidity and the adequacyof recovery efforts.4. Rates & Annual Charges Outstanding10.0 o/o8.0 o/o 6.4oh 6.8o/o 6.8 of¡ 6., oh5.40/60.0 o/oS 6.O0/oE 4.0o/og 2.oo/o2008/09 2009/10 z0Lollt 2otut2 zoLLltz5. Building & lnfrastructure Renewals RatioAsset Renewals [Byildings_&.lnfra.structyrel 1,991 61yo 1OO% 4'o/o 81%Depreciation, Amortisation & lmpairment 1,745To assess the rate at which these assets are being renewed relative to the rate at which they are depreciating.(Building & lnfrastructure Assets)5. Building & InfrasEucture RenewalsL40 o/o120 o/o100 o/o100 o/o 81 96 StohS 80 o/o61o/oo @o/oß016H 4ooloÉ 20o/o0 olo2008/09 2OO9|L0 20l0lLt 20tLlL2 207ut2Director Corporate Services ReportQuarterly Financial Review12 of 15 March 2012 Ordinary Business PaperPage 500 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aDuration Budgeted Notesof Gontraet (YtNlDirector Corporate Services ReportQuarterly Financial Review13 of 15 March 2012 Ordinary Business PaperPage 501 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aNarrabri Shire CouncilQuarterly Budget Review Statementfor the period 01110111 to 31112111Consultancy & Legal Expenses Budget Review StatementConsultancy & Legal Expenses OverviewExpenseConsultanciesLegal FeesYTD Expenditure(ActualDollars)191,733204,677Bugeted(Y/N)NYDefinition of a consultant:A consultant is a person or organisation engaged under contract on a temporary basis to providerecommendations or high level specialist or professional advice to assist decision making by management.Generally it is the advisory nature of the work that differentiates a concultant from other contractors.CommentsExpenditure included in the above YTD figure but not budgeted includes:DetailsConsultancies used as staff unavailable thisLeqal Fees reqardino the Crossing TheatreDirector Corporate Services ReportQuarterly Financial Review14 of 15 March 2012 Ordinary Business PaperPage 502 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.2.aDirector Corporate Services ReportQuarterly Financial Review15 of 15 March 2012 Ordinary Business PaperPage 503 of 555 of the March 2012 Ordinary Business Paper

Revised 20101/12 Capital Works Programas at 31/12/2011Attachment 10.2.2.bProject Orig Bud Curr BudTot Act +CommRevisedBudgetGeneralFund This DeferredYear WorksCarryover Jobs 2011-12Corp Supt Asset Purchases 68,870 68,870 - 69,885 1,015Admin Build Renovations Front 33,016 33,016 17,118 33,016Stage 2 Ext Ramp & Covered C/ 150,000 150,000 3,130 150,000Land Nurraby Childcare Upgrade 35,000 35,000 9,091 35,000Replace Phone System 110,000 110,000 5,000 110,000Replace 25 Desktops Computers 35,000 35,000 6,795 35,000WW Library Upgrade (Grant) Exp 450,000 722,909 28,729 722,909 272,909Bbri Library Paint & Carpets 10,000 10,000 4,509 10,000Pilliga Wetlands Walk - Grant 31,750 31,750 - 31,750Wee Waa Lagoon 10,000 10,000 - 10,000Dripping Rock 15,051 15,051 2,983 15,051Gwabegar CWA Insurance Claim - 42,263 1,572 48,194Dog Pound Replacement - Nbri 263,500 263,500 35,017 38,463 263,500Dog Holding Facility - Bgbri 27,000 27,000 0 27,000Dog Holding Facility - WW 27,000 27,000 0 27,000ANIMALS - Security Cameras 5,000 5,000 0 1,200 3,800Baan Baa Station Amenities Bui 25,000 6,366 1,387 6,366Pilliga Station Amenties Build 25,000 17,013 6,033 17,013Nbri Lawn Construct/Seal s4 Rd 150,000 150,000 0 -Nbri Lawn Sec 6 Development 150,000 44,000 0 -Nbri Lawn Irrigation Upgrade - 61,678 64,581 64,581Nbri Lawn Bin Covers 3,319 3,319 854 854Bbri Common Riparian Rehab 28,085 28,085 10,762 28,085Grant Anzac Pk Disabled Acces 5,000 5,000 0 5,240 240Land Buy Toilet Adj RUDD 21,000 21,000 21,000CPTIGS Bus Stop Collins/Gibbon 17,250 17,250 0 17,250CPTIGS Bus Stop Dangar/Camer 17,250 17,250 0 17,250CPTIGS Bus Stop Signage (25) 25,000 25,000 1,450 25,000Nbri CBD Master Plan 48,162 53,063 39,776 53,063 4,901No 1 Oval - Paint Change Rooms 9,800 9,800 0 - 9,800Nbri Ck - Est Phragmitis 8,000 8,000 0 - 8,000Sporting Monument 103,000 103,700 32,052 110,000 6,300Collins Pk - Playground Seats 6,200 6,200 1,637 6,200Collins Pk - Playground Fence 21,700 8,700 903 8,700Ck banks restrict access - S 1 20,000 20,000 0 - 20,000Maitland St Tlts Landscaping 4,599 4,599 0 5,939 1,340Bowen/Dewhurst St Garden Bed/M 9,554 4,653 0 4,653Nbri Town Park Signage 15,000 15,000 1,474 9,174Grant Nbri Lake Jetty Installa 20,000 20,000 3,687 34,371 14,371Cooma Oval Amenities Upgrade 62,650 62,650 41,495 62,650Narrabri Lake Management Plan 29,830 29,830 10,130 29,830Cook Oval Training Field Light 37,586 37,586 0 37,586Cook Oval Canteen Alterations 9,200 9,200 0 - 9,200Levee Rehabilitation 31,000 31,000 0 - 31,000Refurbisment Weighbridge Offic 30,000 30,000 1,236 20,130Water Recycling Proj Nbri (S2) 12,500 12,500 474 5,381Lock Replacement Nbri 5,500 5,500 1,335 5,500WW Pool Structure Replacement 6,000 6,000 7,498 7,498Nbri Terminal Refurbishment 70,000 70,000 80,924 88,994 18,994Credit Card Facility Refueling 20,000 20,000 0 -Emulsion Tank 10,000 10,000 0 10,000New Shed NBRi Depot 13,481 13,481 13,079 13,079Second Stage Cameras 25,000 25,000 0 15,187 9,813MR127 P9-Oakey Ck Bridge Rplm 652,875 652,875 11,974 652,875SR8 Rehab - Airport Rd 100,000 100,000 0 146,453 46,453SR19 Reseal - Maules Ck Rd 100,000 100,000 0 - 100,000SR5 Seal from end of Seal 525,000 525,000 0 590,135 65,135SR 29 Rehab Kiandool-Smiths 193,465 193,465 0 - 193,465SR4 Reseal (SR44 to SR103) 208,531 208,531 0 - 208,531SR4 Reseal (last 2kms of seal) 41,904 41,904 0 - 41,904SR29 Reseal - Yarrie Lake Rd 100,000 100,000 0 - 100,000SR103 Rehab Roma Lne RTR 270,000 270,000 249,589 270,000SR9 Bit Seal C/ways 5.7km 17,000 17,000 1,902 17,000SR9 Bit Seal C/ways 11.0km 17,000 17,000 0 17,000SR9 Bit Seal C/ways 48km 19,000 19,000 0 19,000SR64 Bit Sl C/ws 3.6k Cotton L 15,000 15,000 0 15,000SR1/SR107 Culvert Inst 15,000 15,000 6,414 15,000Seal Rehab Barwon Doyle-Lloyd 206,760 170,760 118,437 170,760K&G Barwan RHS Dew-Doyle 71,050 71,050 0 - 71,050K&G Buri St RHS Mool-Goob - 0 0 -K&G Boundary St LHS Rw Nth EO 115,500 115,500 750 - 115,500K&G BoundarySt RHS R/w Nth E 115,500 115,500 750 - 115,000F/P Gibbons St RHS Grace St 36,200 36,200 0 - 36,200Narrabri St Reseals - 0 0 -Cooma Oval Nets entr Seal Ugoa 20,000 20,000 0 - 20,000Showground ent Seal Ugoa 25,000 25,000 165 - 25,000Drainage WW Rd Francis-Newell 50,000 50,000 0 - 50,000Doyle St Drain Blocked Balonne 50,000 0 0 -Doyle St Stm W Balonne-Barwan 95,000 0 0 -Doyle St Drain Blocked Barwan 50,000 0 0 -Dewhurst St Drain Nand-Reid 93,750 0 0 -Culverts Walowa St extend 4,500 4,500 0 4,500K&G Cormie Ave RHS Bound 150 52,500 52,500 0 - 52,500K&G Cormie Ave LHS Bound 150 52,500 52,500 0 - 52,500Wee Waa St Reseals - 0 0 -Charles St Sldr C&S LHS Alma-R 27,200 27,200 5,583 27,200Director Corporate Services Report1 of 4 March 2012 Ordinary Business PaperQuarterly Financial Review1 of 4Page 504 of 555 of the March 2012 Ordinary Business Paper

Director Corporate Services ReportQuarterly Financial ReviewRevised 20101/12 Capital Works Programas at 31/12/2011Project Orig Bud Curr BudTot Act +CommRevisedBudgetGeneralFund This DeferredYear WorksChiffley Rd Cons & Seal MR127- 16,329 16,329 20,443 20,443 4,114Rose St Cons & Seal ext Rose-A 59,500 59,500 0 - 59,500Alma - Church Intsect Drain Rp 160,000 160,000 0 160,000Rost St Ext Drain Rpr Wst End 8,000 8,000 0 8,000K&G WWaa St LHS Burt-Bost 107,677 107,677 0 61,236K&G Lynn Burt-Bost LHS 61,200 61,200 0 - 61,200K&G Lynn Burt-Bost RHS 62,735 62,735 0 - 62,735Seal/Grav Merton LHS Brent-Dal - 0 0 -Wee Waa Lane Seal LHS Caxton - 0 0 -Wee Waa St Lane Seal Brent - - 0 0 -Walton St - SR21 Drain Struct 6,000 6,000 7,033 7,033 1,033W&F Jackson 27 Laidlaw St Bogg - - 213 213 213Nbri Swr Pump Station Ctl Cabi 150,000 150,000 0 150,000WW TW Pump Station 130,000 130,000 0 130,000STRATEGIC PROJECTSAttachment 10.2.2.b6,468,529 6,375,708 857,964 4,576,890 437,018 1,720,198Financial Year Ending 2012New & other works 2011-12Nbri Pool Upgrade 4,833,228 5,333,228 320,984 5,500,000Cook Oval Upgrade 430,152 430,152 269,256 430,152BBRI Caravan Park Upgrage 1,651,809 1,651,809 52,352 1,651,809Shannon Estate Costs 2,400,000 2,400,000 2,034,103 2,400,000Total: 9,315,189 9,815,189 2,676,695 9,981,961 -Nurruby Softfall (Insurance) - - 22,100 22,100CT Network Cabling 40,000 40,000 38,916 40,000Replace Wkgrp Printers 6,000 6,000 231 6,000 6,000Replace Server NSCNAMOI 10,000 10,000 180 10,000 10,000Replace Server NSCYARRIE 10,000 10,000 - 10,000 10,000Replace Server NSCNINGADOO 5,000 5,000 - 5,000 5,000Replace 20 Desktops 30,000 30,000 - 30,000 30,000Chambers Microphone upgrades 20,000 20,000 - - 20,000Chambers Projector upgrade 5,000 5,000 1,968 5,000 5,000Replace Server Room A/c 5,000 5,000 2,968 5,000 5,000GIS Instruments 10,000 10,000 - 10,000 10,000Admin Bldg Wireless Network 25,000 25,000 - 25,000 25,000Email archiving software 10,000 10,000 - 10,000 10,000Deduplication software 5,000 5,000 2,724 5,000 5,000Councillor Tablets 30,000 30,000 14,589 30,000 30,000Grant-Positive Ageing Computer - - - -Laptop & Scanner 3,000 3,000 - 3,000 3,000Cut-Off Drain Library & Patchi 40,000 40,000 (19) 40,000 40,000Cotton Ctre -Step Outside Step 30,000 30,000 22,222 30,000 30,000Cotton Ctre Inside Walls Paint 50,000 50,000 31,936 50,000 50,000Cotton Centre IT 20,000 20,000 17,042 20,000 20,000Conferencing equipment - - 1,428 1,428 1,428HP Colour Laser Printer - 2,032 2,032 2,032 2,032Units to be built 550,000 29,425 29,425 29,425Pound Fencing/Security Lights 35,000 35,000 - - 35,000SES SUB Vehicles - 214,000 244,477 244,477 30,447Fire Control Centre Upgrade 100,000 100,000 193 100,000Construct & Seal Section 6 Roa - - - -Section 7 Development -Stage 1 - - - -Replacement Section - Row Sign 15,000 15,000 1,720 15,000 15,000Establish Lawn Cemetery -Stg 1 50,000 50,000 521 50,000 50,000Vickery Pk Replace Play Equip 60,000 60,000 850 5,000 Helen 55,000Jubilee Oval Perimeter - Fence 50,000 50,000 - - 50,000CBD Upgrades - Boggabri 150,000 150,000 482 -Middle Pk Event Power Supply S 6,000 6,000 5,315 6,000 6,000Jubilee Oval Seal Internal Rd 25,000 25,000 - - 25,000Cooma Oval Bird Damage Cricket - 13,000 23,570 23,570Street Seating Maitland - - 9,727 9,727Repaint ring fence Ovals 1-2-3 45,000 45,000 38,135 45,000 45,000Collin Pk Amenities Ext Render 20,000 20,000 - - 20,000Town Creek Bank Internal Road 50,000 50,000 556 - 50,000Collins Pk Canteen install Fan 5,000 5,000 - 5,000 5,000Creek Irrigation Pump Well 80,000 80,000 - 80,000 80,000Creek Banks Vehicle Restrictio 20,000 20,000 - - 20,000Netball/B'ball Seal & Mark 50,000 50,000 - 350,000 350,000Gately Fields Reseal Car Park 35,000 35,000 2,281 - 35,000Cooma Oval Amen Refurbish S2 24,900 24,900 - 24,900 24,900Nri Lake PoM Implementation 30,000 30,000 - 30,000 30,000Entry Roundabout Landscaping 25,000 15,000 13,381 15,000 15,000Wee Waa PCYC Bid - 30,000 - 30,000 30,000Dangar Pk extend Traffic Bolla 10,000 20,000 18,355 20,000 20,000Ludiwici Park Fence 30,000 30,000 30,300 30,300 30,300WW Skate Park 30,000 - 1,800 1,800 1,800Pilliga ANZAC Park Irrigation 5,000 5,000 3,600 5,000 5,000Truck loading ramp improvement 10,000 10,000 - 10,000Relocate pump detention pond 3,000 3,000 - 3,000Saleyard perimeter fence 5,000 5,000 1,090 5,000Effluent pump generator 10,000 10,000 - 10,000Drafting pen with catwalk 25,000 25,000 103 25,000Bgbri Pool Redevelopment - - - -2 of 4 March 2012 Ordinary Business Paper2 of 4Page 505 of 555 of the March 2012 Ordinary Business Paper

Revised 20101/12 Capital Works Programas at 31/12/2011Attachment 10.2.2.bProject Orig Bud Curr BudTot Act +CommRevisedBudgetGeneralFund This DeferredYear WorksWW Pool - Filtration Sys Repla 100,000 100,000 6,911 100,000 100,000WW Pool - Replace pool stairs 5,000 5,000 3,295 5,000 5,000WW Pool - Perimeter Fence Ext 15,000 15,000 6,690 15,000 15,000Runway 18/36 Line Marking 30,000 30,000 - 30,000 30,000Car Park Line Marking 15,000 15,000 - - 15,000Implement Airport Master Plan 1,500,000 1,500,000 9,420 1,500,000Nbri Depot - Fill/Seal Carpark 75,000 75,000 - 75,000Nbri Dep Move Pressure Cleaner 30,000 30,000 - 30,000 30,000Nbri Dpt - Emulsion Tank 5,000 5,000 - 5,000 5,000Nbri Depot - Shed Gardens 50,000 50,000 - 50,000Pilliga Depot - - 5,710 5,710 5,710MR133 Rehab 1.5km 180,000 180,000 - 180,000 180,000MR127 Pilliga Rd Rehab R2R/RTA 1,141,000 1,141,000 - 1,141,000Rd curve advance warning signs 25,000 25,000 - 25,000 25,000Sundry reseals 550,435 550,435 - - 550,435SR 28 Rehab 306,000 231,000 - - 231,000SR 3 Rehab 0.191 - 12.24 km 110,250 110,250 62,690 110,250 110,250Seal all Baan Baa Sts 82,500 82,500 6,093 82,500 82,500Seal Edgeroi Queen St 540m 50,000 50,000 66,129 66,129 66,129Seal Bellata Hwy nth Wiga 10,000 10,000 28,024 28,024 28,024Seal Bellata Lane behind hotel 5,000 5,000 1,343 5,000 5,000Seal Edgeroi Shop Nth 70x20 8,000 8,000 19,031 19,031 19,031Seal Edgeroi shop nth 50x20 6,000 6,000 1,256 6,000 6,000SR54 Stoney Ck Rd Upgrade - 75,000 - 75,000 75,000HARPARARY BRDG SR11 4,000,000 4,000,000 1,411 4,000,000HARPARARY CK SR11 - - - -HORSE ARM CK BR SR11 - - - -MAULES CK BRDG SR11 - - - -TARRIARO BRDG SR61 - - 880 -C/way f/way signposting 25,000 25,000 - 25,000 25,000Rd curve advance warning signs 25,000 25,000 31 25,000 25,000SR 46 Seal 5.5km EOSeal RTR 750,000 750,000 - 750,000Spongs Lane Reconstruction - 280,000 - 280,000CPTIGS Bus Shelter Pilliga - 43,000 - 43,000SR29 Bohena Ck Causeway 200,000 236,000 205,698 236,000 236,000C/way f/way signposting west 25,000 25,000 - 25,000 25,000CPTIGS Kogil St Bus Shelter - 23,250 11,240 23,250K&G Hind St various 140,000 140,000 750 - 140,000K&G Tibereena RHS Den - Bowen 57,050 57,050 - - 57,050K&G Bowen RHS Tib - Maitland 18,550 18,550 - - 18,550K&G Bowen RHS Mait - Barwan 38,150 38,150 368 - 38,150K&G Bowen RHS Balonne-Nandewa 40,250 40,250 - - 40,250K&G Bowen RHS Barwan-Balonne 40,250 40,250 - - 40,250K&G Fitzroy LHS Maitland 38,150 38,150 - - 38,150Fpth Dewhurst LHS Balonne-Barw 15,064 15,064 - - 15,064Fpth Nandewar RHS Bowen-Dewh 27,180 27,180 - - 27,180Fpth Barwan LHS Dewhurst-Doyle 9,900 9,900 - - 9,000Rehab Barwan Lloyd-Doyle 137,290 137,290 - -Rehab Maitland Killarney-Namoi 169,535 - - -Various Reseals 101,850 101,850 - - 101,850Maitland St CBD Asphalt Seal - - 6Francis St Ext (saleyards end) 311,280 341,804 7,563 341,804 341,804Yarrie Lake Rd Subdivison 692,000 981,476 9,588 981,476 981,476Avon St Cons & Seal 46,000 46,000 300 46,000Kulaba St Shoulder Cons & Seal 101,250 101,250 - - 101,250Fpth Dangar Namoi-Lagoon Bridg 81,000 81,000 - - 81,000Fpth Nandewar LHS Denison-Bown 38,160 38,160 - - 38,160Fpth Selina Dangar-Violet Ck 108,000 108,000 - - 108,000Fpth Fitzroy No 11-TBA 2,700 2,700 - - 2,700Fpth Guest LHS Taylor-School 54,000 54,000 - - 54,000Fpth Goobar LHS Buri-Burigal 36,540 36,540 - - 36,540Fpth Violet LHS Peadon-Gibbons 17,280 17,280 1,223 - 17,280Fpth Barwan RHS Doyle-Vinnies 18,000 18,000 32,642 32,642 32,642Shldr Anne Dangar-Kate 35,500 35,500 21,493 35,500 35,500Shldr Droubalgie Ugoa-Genanagi 106,380 106,380 - - 106,380Seal Carpk Cooma Oval Nets 52,500 52,500 - - 52,500Gravel Resheet Arnold St 25,200 25,200 2,040 - 25,200Low Level Bridge SW Abutment 20,000 20,000 - -Dewhurst St Reid Stormwater Up 450,000 - - -Drain Dewhurst Maitland-Lane 18,000 - - -K&G Maitland LHS Mitchell-Boun 82,250 82,250 - - 82,250Wee Waa St Reseals 42,000 42,000 - - 42,000Drain Charles - Boundary 55,000 55,000 - 55,000 55,000K&G Brent Merton-Laidlaw 44,640 44,640 - - 44,640K&G Wee Waa LHS Brent-Dalton 76,320 76,320 - - 76,320Fpth Laidlaw LHS Brent-Caxton 10,800 10,800 - - 10,800Fpth Brent RHS Merton-Wee Waa 16,200 16,200 - - 16,200Fpth Caxton LHS Lynn-Laidlaw 19,800 19,800 - - 19,800Boggabri St Reseals 18,025 18,025 - - 18,02514,644,129 14,417,301 1,096,042 11,940,075 3,580,973 2,610,974Total General Fund 30,427,847 30,608,198 4,630,701 26,498,926 4,017,991 4,331,172WATER & SEWERBel Security of Supply Upgrade 30,000 30,000 - 30,000Bellata Replace Bore Shed 8,000 8,000 - 8,000Director Corporate Services Report3 of 4 March 2012 Ordinary Business PaperQuarterly Financial Review3 of 4Page 506 of 555 of the March 2012 Ordinary Business Paper

Revised 20101/12 Capital Works Programas at 31/12/2011Attachment 10.2.2.bProject Orig Bud Curr BudTot Act +CommRevisedBudgetVarious Renewals 17,600 17,600 - 17,600Upgrade Telemetry 60,000 60,000 - 60,000Replace Water Tank 30,000 30,000 - 30,000Bellata Bore Fence 3,000 3,000 - 3,000Mains Rnwl Wee Waa St B 220mtr - - 25,371 -Mains Rnwl Burton St B 180mtr - - 7,168 -Connect - Jackson 25 Laidlaw - - 1,432 -Connect - Sullivan 100 Merton - - 145 -Connection-Whelan 3 Burton St - - - -Connect - Fresh Const 82 Lynn - - 1,072 -Connect - M&S Faith 201 Merton - - 494 -Connect-Lot 21 Walton Gillham& - - 360 -Connect - L6 Clare St Bbri - - -Upgrade Telemetry 60,000 60,000 - 60,000GWB Wtr Security Supply Upgrad 30,000 30,000 - 30,000Upgrade Telemetry 30,000 30,000 - 30,000Replace Reservoir & deck 30,000 30,000 - 30,000Nbri Electrical upgrades & VSD 80,000 80,000 - 80,000Decom Dual Main Clark St 250,000 250,000 - 250,000Narrabri Water Renewals 265,695 265,695 - 265,695Elizabeth St Bore Renewal 55,205 55,205 59,845 55,205Upgrade Telemetry 150,000 150,000 - 150,000Fraser St renewal 15,000 15,000 37,966 15,000Clarke St renewal 10,000 10,000 25,362 10,000Cyber lock 15,000 15,000 - 15,000VS Drive Tibbereena St Bore 26,000 26,000 - 26,000Treatment Plant Planning 70,000 70,000 - 70,000Pilliga Reservoir replacement 30,000 30,000 - 30,000Upgrade Telemetry 30,000 30,000 - 30,000Replace Reservoir 30,000 30,000 - 30,000Pil Security of Supply Install 30,000 30,000 - 30,000Upgrade Telemetry 120,000 120,000 - 120,000Cyber locks 5,000 5,000 - 5,000Connect - Fresh Const 82 Lynn - - 493 -Connect - M&S Faith 201 Merton - - - -Connect-Lot 21 Walton Gillham& - - 907 -Upgrade Telemetry 90,000 90,000 - 90,000Cyber locks 5,000 5,000 - 5,000Shannon Estate Sewer Line Adju - - 10,711 -New Pump Station Sprays - 30,000 26,000 30,000Walowa renewal 15,000 15,000 - 15,000Upgrade 5 PS Cabinets 100,000 100,000 - 100,000Upgrade Telemetry 300,000 270,000 - 270,000Cyber lock conversion 20,000 20,000 - 20,000Drs Ck PS inc well capacity 50,000 50,000 - 50,000Upgrade Telemetry 150,000 150,000 - 150,000New Pump Station Sprays 30,000 30,000 - 30,000Vacuum Unit 75,000 75,000 - 75,000Cyber lock 20,000 20,000 - 20,000Various Renewals 20,000 20,000 - 20,000Various renewals 60,000 60,000 - 60,000Relocate Saleyards discharge p 15,000 15,000 - 15,000Cyber locks 2,000 2,000 - 2,000Access Rd upgrade 30,000 30,000 - 30,000New Mixer 15,000 15,000 - 15,000New Pump Well 35,000 35,000 - 35,000Cyber locks 2,000 2,000 - 2,000Total Water & Sewer 56,901,665 2,514,500 197,326 2,514,500 -GeneralFund This DeferredYear WorksDOMESTIC WASTE MANAGEMENTNbri Lined Waste Cell New 500,000 500,000 - 500,000Electrical Supply to Site 150,000 150,000 103 150,000Vacuum 30,000 30,000 18,529 30,000Liquid Trade Waste 100,000 100,000 - 100,000Total DWM 780,000 18,632 780,000 - -PLANT & FLEETMajor Plant Replacements 1,200,000 1,200,000 1,111,854 1,200,000Medium Plant Replacements - - - -Leaseback Vehicle Replacements 250,000 250,000 213,436 250,000Operational Vehicle Replacemen 45,000 45,000 39,310 45,000Major Plant Replacements 375,000 375,000 114,717 375,000Medium Plant Replacements 100,000 100,000 - 100,000Leaseback Vehicle Replacements 1,335,000 1,335,000 345,502 1,335,000Operational Vehicle Replacemen 176,000 176,000 88,101 176,000Small Plant Replacements 20,000 20,000 - 20,000Jetpatcher 400,000 400,000 351,177 400,0002 Mowers P&G 100,000 100,000 - 100,000Total Plant & Fleet 4,001,000 2,264,097 4,001,000 - -Total All Funds 37,903,698 7,110,756 33,794,426 4,017,991 4,331,172Director Corporate Services ReportQuarterly Financial Review4 of 4 March 2012 Ordinary Business Paper4 of 4Page 507 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.2.3 DIRECTOR CORPORATE SERVICES REPORTSubject:Author:Conflict of Interest:Investments Monthly ReportSenior Finance OfficerNilRECOMMENDATION: That in accordance with Section 625 of the Local GovernmentAct, 1993 that Council note and receive the monthly investment report as at 29 th February2012.RECOMMENDATION 2: That Council note that Council’s Senior Finance Officer hascertified that Council’s investments have been made in accordance with the LocalGovernment Act 1993, the Local Government Regulations and Council’s own investmentpolicy.Issues To report the balance of investments held as at 29 th February 2012.BackgroundA report is required to be presented to the Council meeting every month as per the Clause 16 of theLocal Government (Financial Management) Regulation 1999.Current SituationThe Investment Movements Summary for February 2012 is as follows:The following term deposits and/or investments were made during this period: 01/02/2012 ME Bank $1,000,000 140 days @ 5.90%The following investments matured or were redeemed during this period: 01/02/2012 National Australia Bank $1,000,000 92 days @ 5.85% 27/02/2012 BELO PLC Kalgoorlie CDO $500,000The investment returns for February 2012 exceeded the benchmarks; the 90 day bank bill Indexand the Bank Bill Swap Rate (BBSW).Interest Rate Summary for February 2012Average Interest Rate on investments for February 2012 4.34%Weighted Average Interest Rate on investments for February 2012: 5.24%90 day Bank Bill Rate (1 st March 2012): 1 4.40%Bank Bill Swap Rate (BBSW) 90 day index (1 st March 2012) 2 4.53%RBA Cash Rate (1 st March 2012) 4.25%1 Source: Australian Financial Review2 Source: Australian Financial ReviewGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 508 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTCollateralised Debt Obligations (CDOs)The BELO PLC Kalgoorlie CDO matured in February 2012. Full redemption of this CDO wasreceived during the month. The next CDO scheduled to mature is the Magnolia Finance FlindersCDO which is scheduled to mature in March 2012.Current values for the CDOs stated in the report are as at 31 st January 2012.Floating Rate Notes (FRNs)There were no FRN transactions in February 2012.Current values for FRNs stated in the report are as at 31 st January 2012.AttachmentsAttachment 10.2.3.a: Listing of Cash and Investment holdings as at 29th February 2012;Attachment 10.2.3.b: Monthly Investment Performance Indicators;Attachment 10.2.3.c: Interest Earned versus Budget; and,Attachment 10.2.3.d: Current Cash Available versus Last Year Cash Available.Financial ImplicationsThe total interest income for the financial year to 29 th February 2012 is $387,823 for the GeneralFund plus $410,252 distributed to the water and sewer funds giving a total interest income for theperiod of $798,075. This is up on the budget for the same period of $128,040 for the General Fundand of $374,944 for the water and sewer funds with a total budget for the period of $502,984.General Fund interest income has achieved 202% to date of the annual budgeted figure for thecurrent financial year with Water and Sewer Funds achieving 73%. The total interest income hasachieved 106% of the annual budget. Previous interest rate budgets for this financial year wereerroneously over-reported as the budget for the year previously included the combined general,water and sewer funds budgets. This has skewed previous comparisons in a negative way. Thecorrection this month shows the correct budgets and comparisons on a year to date basis.Global economic uncertainty has eased as the European sector has agreed to additional funding fortroubled Greece and other Euro fund countries.Current end of month market values for investments is as per Attachment 10.2.3.a.General, Water and Sewer fund interest allocation is as per Attachment 10.2.3.b.Investment CommentaryThe investment portfolio has remained relatively steady for the month..The investment portfolio is diversified across a number of investment types, including termdeposits and on-call accounts. All CDO’s, and FRN’s are investments held under the“grandfathered” clause of Council’s investment policy.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 509 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTThe investment portfolio is regularly reviewed in order to maximise investment performance andminimise risk.Statutory/Legal ImplicationsStatutory StatementI, Shirley Burraston, Senior Finance Officer, certify that Council’s investments have been made inaccordance with the Local Government Act 1993, the Local Government Regulations andCouncil’s own investment policy.Local Government Act 1993 Section 625 “How may councils invest?”(1) A council may invest money that is not, for the time being, required by the council forany other purpose;(2) Money may be invested only in a form of investment notified by order of the Ministerpublished in the Gazette.Editorial note. See Gazettes No 152 of 24.11.2000, p 12041; No 94 of 29.7.2005, p3977; No 97 of 15.8.2008, p 7638 and No 160 of 24.12.2008, p 13140;(3) An order of the Minister notifying a form of investment for the purposes of this sectionmust not be made without the approval of the Treasurer;(4) The acquisition, in accordance with section 358, of a controlling interest in acorporation or an entity within the meaning of that section is not an investment for thepurposes of this section.Environmental ImplicationsNil.Management Plan/Strategic PlanCouncil to ensure management accounting processes under the function areas of debtors, creditors,rating, payroll, fleet, supply and investments are accurate and in line with appropriate legislationand proper accounting principles. All accounting processes completed in line with legislation and accounting principlesthroughout the 2011/12 Financial Year.Council to prepare and submit all statutory financial reporting within legislated time frames. All statutory reports were submitted to the relevant authorities within the required timeframe for the 2011/12 Financial Year.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 510 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.3.aInvestmentAttachment OneCash and Investments Holdings as at 29th February 2012S&P/FitchRatingInvestmentFinal MaturityDateCurrentInterestRateInterestFrequencyNext InterestDateAmountInvested Value($)% of TotalFunds (FaceValue)Market ValueEnd of Month($)AccruedInterest toEnd of MonthOn-Call AccountsNational Australia Bank Cash Maximiser A/Stable/ On Call 4.70% Monthly EOM 2,007,613 9.06% 2,007,613 Pd MonthlyAMP A/Stable/ On Call 5.10% Monthly EOM 1,000,000 4.51% 1,000,000 Pd MonthlyTotal On-Call Accounts 3,007,613 13.58% 3,007,613Term DepositsBankwest A-1+ 02/03/2012 5.82% Maturity 02/03/2012 1,000,000 4.51% 1,000,000 14,191ANZ A-1+ 12/03/2012 5.75% Maturity 12/03/2012 1,000,000 4.51% 1,000,000 12,445National Australia Bank A-1+ 12/03/2012 5.79% Maturity 12/03/2012 1,000,000 4.51% 1,000,000 12,532National Australia Bank A-1+ 30/03/2012 6.02% Maturity 30/03/2012 1,000,000 4.51% 1,000,000 14,679National Australia Bank A-1+ 04/04/2012 6.01% Maturity 04/04/2012 1,000,000 4.51% 1,000,000 13,502Bank of Queensland A-2 10/04/2012 5.75% Maturity 10/04/2012 1,000,000 4.51% 1,000,000 7,719Defence Force Credit Union N/A 10/04/2012 6.00% Maturity 10/04/2012 1,000,000 4.51% 1,000,000 23,342National Australia Bank A-1+ 18/04/2012 6.00% Maturity 18/04/2012 1,000,000 4.51% 1,000,000 7,890ME Bank A-1+ 20/06/2012 5.90% Maturity 20/06/2012 1,000,000 4.51% 1,000,000 4,526Suncorp A 24/04/2012 5.90% Maturity 24/04/2012 1,000,000 4.51% 1,000,000 5,658Community CPS N/A 24/04/2012 5.91% Maturity 24/04/2012 1,000,000 4.51% 1,000,000 5,667IMB A-3/BBB- 30/04/2012 5.85% Maturity 30/04/2012 1,000,000 4.51% 1,000,000 4,648Suncorp A-1 24/05/2012 5.88% Maturity 24/05/2012 1,000,000 4.51% 1,000,000 5,638AMP A-2 24/08/2012 6.00% Maturity 24/08/2012 1,000,000 4.51% 1,000,000 4,767Total Term Deposits 14,000,000 63.21% 14,000,000 137,205Floating Rate NotesDandelion Notes NRi 21/12/2012 0.00% NA N/a 500,000 2.26% 460,700 No CouponTotal Floating Rate Notes 500,000 2.26% 460,700 0Director Corporate Services ReportInvestments Monthly Repot1 of 2 March 2012 Ordinary Business PaperPage 511 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.3.aInvestmentAttachment OneCash and Investments Holdings as at 29th February 2012S&P/FitchRatingInvestmentFinal MaturityDateCurrentInterestRateInterestFrequencyNext InterestDateAmountInvested Value($)% of TotalFunds (FaceValue)Market ValueEnd of Month($)AccruedInterest toEnd of MonthYield/ Bank / Property Notes (Lehman Brothers)Beryl Finance Global Bank Note (See Notes 1) B- 20/09/2014 0.00% NA N/a 100,000 0.45% 110,000 No CouponLehman Global Property Note (See Notes 1) D 15/06/2009 0.00% NA N/a 200,000 0.90% 40,000 No CouponTotal Yield/ Bank/ Property Notes 300,000 1.35% 150,000Collateralised Debt Obligations (LehmanMagnolia Finance Ltd Series 2005-14 (Flinders) N/A 20/03/2012 5.93% Quarterly 20/03/2012 302,043 1.36% 300,000 3,485Omega Capital Investments Series 40 (Henley) B 22/06/2012 5.27% Quarterly 22/03/2012 500,000 2.26% 445,000 4,981Helium Capital Ltd Series 60 (Esperance) D 20/03/2013 0.00% Quarterly 20/03/2012 104,597 0.47% 33,000 0Corsair Cayman Island No. 4 Series 5 (Torquay) D 20/06/2013 0.00% Quarterly 20/03/2012 8,137 0.04% 2,500 0Zircon Finance Ltd (Merimbula) BB- 20/06/2013 0.00% Quarterly N/a 250,000 1.13% 235,000 No CouponCorsair Cayman Islands No 4 Series (Kakadu) CCC 20/03/2014 5.83% Quarterly 20/03/2012 148,995 0.67% 13,500 1,690Zircon Finance (Coolangatta) B+ 20/09/2014 0.00% Quarterly 22/03/2012 500,000 2.26% 485,000 No CouponAphex Pacific Capital Series 2006-5 (Glenelg) CCC- 22/12/2014 6.17% Quarterly 22/03/2012 199,996 0.90% 52,000 2,333ACES SPC Series 2006-7 Class 1A (Parkes) CCC- 20/06/2015 6.06% Quarterly 20/03/2012 300,000 1.35% 39,000 3,534Total Collateralised Debt Obligation Notes 2,313,768 10.45% 1,605,000 16,023Total Investments 20,121,381 90.85% 19,223,313 153,229Cash at Bank – NAB A-1+ 2,027,301 9.15% 2,027,301 Paid MonthlyTotal Cash and Investments 22,148,682 100.00% 21,250,614 153,229Director Corporate Services ReportInvestments Monthly Repot2 of 2 March 2012 Ordinary Business PaperPage 512 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.3.bMonthly Investment Performance IndicatorsPeriod Investments heldBank BalanceInterest earned Interest earned WaterendingGeneral Fund& SewerJul-11 20,337,854 614,785 55,904 55,211Aug-11 21,661,196 2,933,574 55,550 46,329Sep-11 20,713,782 724,852 54,166 54,195Oct-11 21,163,240 1,234,257 53,962 55,067Nov-11 21,158,113 2,145,597 44,588 50,197Dec-11 21,953,301 314,861 45,114 54,382Jan-12 19,454,892 1,976,498 36,661 45,347Feb-12 20,121,381 2,027,301 41,878 49,524Mar-12Apr-12May-12Jun-12Total of Interest Received for 2011/2012 Financial Year2011/2012 Budgeted InterestInterest Received as a percentage of Total BudgetMonthly Budget Interest 2011/2012$387,823 $410,252$192,050 $562,420202% 73%$16,004 $46,868Director Corporate Services ReportInvestments Monthly Report1 of 1 March 2012 Ordinary Business PaperPage 513 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.3.c !"#$# !"#% & ' (##!"$# (##!"% & ' Director Corporate Services ReportInvestments Monthly Report1 of 1 March 2012 Ordinary Business PaperPage 514 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.3.d !" # $!%&! ' !("!!)*!+ ! ' !("!!)*!+ ! !$!%Director Corporate Services ReportInvestments Monthly Report1 of 1 March 2012 Ordinary Business PaperPage 515 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.2.4 DIRECTOR CORPORATE SERVICE’S REPORTSubject:Author:Conflict of Interest:Toilets/Clubhouse Gwabegar Park(Asset Number: 5076)Senior Finance OfficerNilRECOMMENDATION 1: That Council resolve not to rebuild the Toilets/Clubhouse atGwabegar Park (Asset Number: 5076) that was destroyed by fireRECOMMENDATION 2: That Council authorise the Mayor and the General Managerto sign and affix the Council seal to any documentation related to the settlement of InsuranceClaim NARIS11003, including the Deed of Release.IssuesThe building is very old and was underutilised by the Gwabegar community. It was in thecouncil’s asset management plan to be demolished.Background The building was destroyed by an arson attack on 8 June 2011. The building had been condemned by Council prior to the arson attack.Current SituationThe building has been totally demolished and all assets removed.Council will receive the payout from insurance once they have made a decision on thestatus of the building.Attachments Attachment 10.2.4.a –GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 516 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTAttachment 10.2.4.b – Report from Cunningham Lindsay Loss Assessors.Financial Implications The insurance would not cover the costs associated with a full rebuild if Council decides torebuild. The building has an Insurance value of $52,000. Cunningham Lindsay Loss Assessors, under commission by Council’s insurer, haveassessed the reinstatement cost of rebuilding this facility at $74,109.00 excluding GST. Cunningham Lindsay has proposed settlement of the insurance claim to a value of$52,114.50 less Council’s excess of $50,114.50. This means that if Council were to consider rebuilding this facility, Council would need tofind additional funds of at least $23,994.50 from general revenue.Statutory/Legal ImplicationsA Deed of Release will be required to be signed, if Council decides to accept settlement ofthis matter.Management Plan/Strategic PlanDemolish building in line with council’s Long Term Asset Management Plan.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 517 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.4.bCunningham Lindsey Australia Pty LtdChartered Loss AdjustersABN: 49 003 437 161PO Box 800Tamworth NSW 2340Telephone (02) 6761 2344Facsimile (02) 6761 2444Emailtamworth@cl-au.com15 February 2012Statewide Property Mutualc/o Jardine Lloyd Thompson Pty. LtdSydney NSW 1215Email: Gareth.Edwards@jlta.com.auAttention: Gareth EdwardsSupplementary Progress Report 1 – Proposing settlement & seekinginstructionsCunningham Lindsey Contact:Our Reference:Claim Reference:Insured:Micheal Leonard8096783 MJLNARIS11003Narrabri Shire CouncilABN: 95 717 801 656, 100% ITCEPlace of Loss: Monash Street, Gwabegar, NSW, 2356Policy:Excess:All NAR000659$2,000 - Not DeductedDate of Loss: 17 April 2011Usage of Premises:Loss/Damage:Recovery:Clubhouse for local sporting activities (formerly tennis andcricket)Building totally destroyed by fireWe do not consider there are any prospects of recoveryReservePREVIOUS PAYMENTSDECLARED ORIGINALBALANCE OFPAYMENTS CURRENTLYVALUE RESERVERESERVERECOMMENDED RECOMMENDEDBuilding: $52,000 $60,000 Nil Nil $60,000Director Corporate Services ReportToilet/Clubhouse Gwabegar Park1 of 3 March 2012 Ordinary Business PaperPage 518 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.4.bCunningham Lindsey Australia Pty Ltd - Narrabri Shire Council (8096783 MJL) Page 2Activity Since Last Report:We refer to our previous report dated 2 September 2011. The purpose of this report is to adviseyour office of the present position of this matter, provide information regarding reinstatement value,propose a settlement and seeking your further instructions.Loss/Damage:As discussed in our First Report, the building has been totally destroyed, with only a tank standand corrugated galvanised steel rainwater tank partially surviving the inferno. This wouldnecessitate replacement of the damaged structure.We had been pursuing Council to confirm if a decision has been reached regarding theirreinstating of the building and was advised they wished to hold consultation with the localCommunity prior to making a decision.We closed our file until Council reached a decision regarding reinstatement of the building.As agreed with your Gareth Edwards dated 16 January 2012, we have obtained a square metrecosting for the reinstatement of the building from Sergon Building Consultants in the amount of$81,519.90 incl. GST, which includes $8,204.00 incl. GST for demolition, removal of debris andprofessional fees. A copy of the Quantity Surveyors report is attached for your reference andpermanent record.Sergon Building Consultants have also submitted a tax invoice for their report totalling $462.00incl. GST. As this cost is appropriate, payment is recommended to Sergon Building Consultantslater in this report.Basis of Settlement:At this stage we are not aware of Council’s intention in relation to reinstatement of the subjectbuilding. However we would suggest that the premises will not be reinstated, or if it is, then it isunlikely that such reinstatement will be carried out in a reasonable time.Therefore we consider that any settlement will revert to indemnity conditions in accordance withthe following:“Provisions(i)The work of rebuilding, replacing, repairing or restoring as the case may be (which may becarried out upon any other site(s) and in any manner suitable to the requirements of TheMember, but subject to the liability of Statewide not being thereby increased), must becommenced and carried out with reasonable despatch, failing which Statewide shall not beliable to make any payment greater than the indemnity value of the damaged property atthe time of the happening of the damage.”Therefore we would normally base indemnity calculations on the age (55 – 60 years) of thebuilding at a 1% per annum deduction. However as the property was reportedly well maintained,as is the case with these multi purpose buildings in small rural communities, we have used 33% asa basis of deduction for age, wear and tear and provide the following indemnity calculations:Reinstatement Value$81,519.90 incl. GSTLess GST ($ 7,410.90)Sub total$74,109.00 excl. GSTLess removal of debris ($ 1,460.00)Less professional fees ($ 5,999.00)Sub total$66,650.00 excl. GSTLess deduction for age, wear & tear (33%) ($21,994.50)Director Corporate Services ReportToilet/Clubhouse Gwabegar Park2 of 3 March 2012 Ordinary Business PaperPage 519 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.4.bCunningham Lindsey Australia Pty Ltd - Narrabri Shire Council (8096783 MJL) Page 3Indemnity value$44,655.50 excl. GSTRemoval of debris $1,460.00Professional fees $5,999.00Indemnity calculation total$52,114.50 excl. GSTAdequacy of Insurance:The co-insurance memorandum is noted, however when depreciation is applied to the Value atRisk figure co-insurance will not apply.Proposed Settlement:Therefore in light of the indemnity and co-insurance calculations and the likelihood that the Councilwill not reinstate the damaged building, we propose a cash settlement at the declared valueamount of $52,000 excl. GST as this amount is exceeded based on the indemnity calculations setout earlier in this report. We seek your concurrence and further instructions in regard to settlementproposed.Please note that this has not been discussed or agreed with Council.Payment Recommendation:We recommend a progress payment as follows: -PAYEE SEND TO REF/TAX INV ABN AMOUNT $Sergon Building L5, 156 Pacific Hwy # 618759 60 006 984 292 $462.00ConsultantsGreenwich NSW 2065incl. GSTFuture Action:We look forward to your further instructions in regard to settlement proposed by us in this report.Cunningham LindseyTo speak to Micheal Leonard please phone: (02) 6761 2344 or mobile: +61 429 659 992E-mail address: micheal.leonard@cl-au.comAssistant to Micheal Leonard : Kate CullenEncl. – Report/Tax Invoice – Sergon Building ConsultantsDirector Corporate Services ReportToilet/Clubhouse Gwabegar Park3 of 3 March 2012 Ordinary Business PaperPage 520 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.2.5 DIRECTOR CORPORATE SERVICE’S REPORTSubject: Lions Club Shed LeaseAuthor: Senior Finance OfficerConflict of Interest:NilRECOMMENDATION 1: That Council offer Narrabri Lions Club a five (5) year leasefor the amount of $1,200.00 per annum (GST exclusive) under Council’s standard lease termsand conditions and further, that Council authorise the Mayor and General Manager to signand affix the Common Seal of Council to any necessary documentation regarding this matter.IssuesCouncil received an expression of interest from Lions Club of Narrabri Inc. Narrabri LionsClub wishes to formalise the agreement with Council with a view to further developing theshed by connecting electricity.BackgroundNarrabri Lions Club currently occupies this building.Current SituationThe building is being utilised by Narrabri Lions Club for storage.The club is aware that the area has mostly been cleared of structures but suggest that as thebuilding is on the high side of the riverbank this will reduce the likelihood of the shedbeing inundated by floodwaters.The club wishes to connect electricity to the shed for their storage refrigeration.AttachmentsAttachment 10.2.5.a – Map of PropertyFinancial ImplicationsA commercial lease at the suggested annual rental of $1,200 per annum to the Lions Clubof Narrabri Inc would cover Council’s cost for rates and insurance for this building. Thelease would also reduce Council’s liability for repairs and maintenance expense as thiswould be borne by the Lions Club.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 521 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTStatutory/Legal ImplicationsA commercial lease would be required to be signed and sealed by Council.Management Plan/Strategic PlanManage Council’s assets.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 522 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.5.aDirector Corporate Services ReportLions Club Shed Lease1 of 2 March 2012 Ordinary Business PaperPage 523 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.2.5.aDirector Corporate Services ReportLions Club Shed Lease2 of 2 March 2012 Ordinary Business PaperPage 524 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.3.1 DIRECTOR ENGINEERING SERVICE’S REPORT ROADS/PROCEDURESSubject:Author:Conflict of Interest:Roads Services Monthly UpdateRoad Services ManagerNilRECOMMENDATION: That the Roads and Fleet Committee receive the RoadServices Section March 2012 Monthly Report for Information.IssuesThe purposes of this report is to update Council on the current status of the 2011/12 budget for theRoad Services Section and provide a brief description of the works carried out from 1 February2012 to 12 March 2012.BackgroundThis is a regular monthly report.Current SituationUrban TownsWorks completed in the last month include:-Baan Baa The sealing of the Baan Baa streets has been further delayed by flooding.Narrabri Construction of a concrete footpath in Barwan Street from Doyle Street North has beencompleted.GradingDue to the February flood event, normal routine grading resources have been diverted toemergency flood damage repairs and flood damage restoration works.Flood Damage RestorationFlood damage restoration works have been carried out on the following roads:-SH 29 – Kamillaroi HighwayMR 329 – Cypress WayGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 525 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTMR 357 – Rangari RoadViolet Street Low Level BridgeSR 1 – Millie RoadSR 3 – Mellburra RoadSR 4 – Spring Plains RoadSR 5 – Kaputar RoadSR 7 – Couradda RoadSR 9 – Bald Hill RoadSR 12 – Leards Forest RoadSR 15 – Therribri RoadSR 16 – Browns LaneSR 17 – Old Narrabri RoadSR 18 – Wave Hill RoadSR 27 – Dripping Rock RoadSR 29 – Yarrie Lake RoadSR 30 – Culgoora RoadSR 41 – Mission LaneSR 43 – Merimborough LaneSR 44 – Trindalls LaneSR 45 – Nowley RoadSR 46 – Doreen LaneSR 47 – Middle Route RoadSR 107 – Waiwera LaneSR 111 – Appletrees LaneSR 112 – Ten Mile LaneSR 156 – Wean RoadSR 162 – Yarranabee LaneSR 163 – Delwood RoadSR 203 – Cudgewa LaneSR 204 – Gardens RoadSR 209 – Harris LaneSR 216 – Werah Creek RoadSR 220 – Fairview RoadSR 221 – Poison Gate RoadSR 223 – Eden LaneSR 227 – Pine Creek RoadSR 234 – Warriana LaneThe majority of the work to date on the roads listed above has been for emergency access.Assessment of flood damage from February 2012 is progressing well, with all shire roads beingassessed by Council staff and approximately 25% of the damage being assessed by the Roads &Maritime Services (RMS). RMS staff have been very cooperative on this occasion and arefacilitating a road by road approval process to expedite the repairs. It is expected to have theassessments finalised by April.Gravel Re-SheetingDue to the February flood event, normal gravel re-sheeting resources have been diverted toemergency flood damage repairs and flood damage restoration works.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 526 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTFurther workThe approach to the boat ramp at Yarrie Lake is programmed to be sealed in late March.SR 29 (Yarrie Lake Road) Bohena Creek – Approach roadworks are programmed to besealed in late March.AttachmentsNilFinancial ImplicationsNilStatutory/Legal ImplicationsNilEnvironmental ImplicationsNilManagement Plan/Strategic PlanIn accordance with the 2011/12 Management PlanGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 527 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.3.2 DIRECTOR ENGINEERING SERVICE’S REPORT ROADS/PROCEDURESSubject:Author:Conflict of Interest:Routine Grading of Shire RoadsRoad Services ManagerNilRECOMMENDATION 1: That Council receive the Routine Grading of Shire Roadsreport for information supporting the development of the 2012-2013 Management Plan.RECOMMENDATION 2: That Council adopt in principle the program for routinegrading of roads as attached to this report.RECOMMENDATION 3: That Council consider the allocation of funding in the 2012-2013 Budget sufficient to undertake the routine grading program as attached to this report.IssuesUnsealed Council Roads require regular maintenance grading to allow for safe and efficient travel.In recent years the funding allocated for this work has allowed only minimal grading of the worstsections of roads. The overall condition of these unsealed roads is continuing to deteriorate.BackgroundCouncil’s Engineering Services department has been conscious of the condition of Council’sunsealed roads and in 2011 engaged Ken Wilson & Associates to prepare an unsealed roads routinegrading program to help overcome this issue.Current SituationCouncil’s current financial year allocation for routine grading is $950,000 which is sufficient tocomplete a formation grade on 1,044km of road or a carriageway grade on 1,392km of road. Toput this in some perspective, Narrabri Shire Council is responsible for some 1,667km of unsealedroads.Due to this funding shortfall, grading of unsealed roads is currently undertaken on a priority basiswhereby the most highly trafficked roads are graded first, while many local access roads are notgraded each year. There is no scope within the current funding for maintenance of table drains,mitre drains and roadside vegetation.Historically Council has been able to supplement this funding with flood damage restorationmoney, however this is not a sustainable solution as the lack of routine maintenance increases theeffect of the floods.AttachmentsAttachment 10.3.2.a: Ken Wilson & Associates ReportGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 528 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTAttachment 10.3.2.b: Shire Map – Routine Grading ProgramFinancial ImplicationsThe estimated cost to undertake this program is $4,030,733.Statutory/Legal ImplicationsCouncil has a statutory obligation to maintain it’s road infrastructure in a serviceable condition.Environmental ImplicationsNilManagement Plan/Strategic PlanFor inclusion in the 2012/13 Management PlanGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 529 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.2.aDirector Engineering Services ReportRoutine Grading of Shire Roads1 of 3 March 2012 Ordinary Business PaperPage 530 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.2.aDirector Engineering Services ReportRoutine Grading of Shire Roads2 of 3 March 2012 Ordinary Business PaperPage 531 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.2.aDirector Engineering Services ReportRoutine Grading of Shire Roads3 of 3 March 2012 Ordinary Business PaperPage 532 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.2.bDirector Engineering ServicesRoutine Grading of Shire Roads1 of 1 March 2012 Ordinary Business PaperPage 533 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORT10.3.3. DIRECTOR ENGINEERING SERVICE’S REPORTPLANT EQUIP & STORES/REPORTINGSubject:Author:Conflict of Interest:Fleet & Supply Section’s Monthly ReportFleet & Supply ManagerNil.RECOMMENDATION: That Council receive and note the March 2012 update fromthe Fleet and Supply Section of Council.IssuesThe purpose of this report is to update Council on the current status of projects/tasks performed bythe Fleet and Supply Section.BackgroundThis is a monthly updated report for Council’s information.Current SituationThe following major projects have been or are to be completed by the Fleet and Supply Sectionbefore the end of March 2012;An order for the Road Maintenance Machine was placed on the 11 January 2012, withAusroads Pty Ltd, through LGP Contract 707. It is expected that the machine will bedelivered May/June, there is a delay as the manufacturing company has 4 machines tocomplete before the Council order.Acquisition and disposal of council vehicles and plant as per the attached Fleet Capital andRenewal Works Program 2011/2012 (as per council management plan).Four Nissan Navaras have been ordered for the SES, these vehicles are to be fitted out byCapital Body Works in Tamworth with specially built trays. A Nissan Patrol Wagon wasalso ordered for the SES. It is expected that these will be completed by May.The Fleet & Supply Manager and Plant Co-ordinator held a meeting with Nick Wardlefrom NJ Contracting to discuss the possibility of engaging his services to assist the NSCMechanic in the workshop. It is anticipated that his services will be required when ourMechanic is on leave in April.The cleaning up of the Narrabri Depot yard is continuing, the replacement of the backfence has been put on hold until the bridge decks can be removed.Reports have been presented to the Director Engineering Services for the replacement ofthe Excavator, Sign Truck, and Tractors, and are awaiting direction.GENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 534 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 GENERAL MANAGER’S REPORTSince January there has been a number of safety inspections carried out on the craneequipment, lifting gear, confined spaces equipment and swimming pool emergencyequipment in accordance with legislation requirements.A Tornado Vacuum Trailer has been purchased for the purpose of litter collection,primarily at the Waste Facilities.The Workshop staff have been extremely busy with repairs to plant, associated with therecent flooding.Fleet is currently undertaking a comparison of lease to buy prices form several suppliers,for two Graders and a Road Stabilizer.AttachmentsAttachment 10.3.3.a: The Fleet, Capital and Renewal Works Program 2011/2012.Financial ImplicationsAll purchases are within the 2011/2012 Fleet and Supply Budget.Statutory/Legal ImplicationsThere are no statutory / legal implications resulting from this report.Environmental ImplicationsThere are no environmental impacts resulting from this report.Management Plan/Strategic PlanAcquisitions and disposals in accordance with the Management PlanGENERAL MANAGER’S REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 20 TH MARCH2012.GENERAL MANAGERMAYORPage 535 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.3.aBreakup of Budget Completed 6 month review of programType ID Project BudgetMajor PlantReplacementsBreak downof budgetGST NOT INCLUDEDActualPurchasePriceActual TradeIn/AuctionPriceCommDate$ 375,00019.7.11Fleet & Supply Capital & Renewal Works Program 2011/2012Completedate Comments Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Junsee plant below forbreakupPlant Ren Excavator $ 220,000 To be tenderedassessmentforms withDESPlant Ren Truck $ 120,000To be tendered. Specsdrafted for sign truck,waiting on final draftReceivedQuotesDraftSpecs withDESPlant New Mini Dingo $ 35,000 $ 43,590 N/A 14.6.11 27.9.11Plant Ren Low Loader Pl 217 $ 35,000.00Plant Ren 2 Tractors $ 120,000Demo of Toro on19.7.11budget to bereallocated to truckPlant Ren 2 Multi tyre Rollers $ 300,000$ 298,100 $ 10,000 1.6.11 29.9.11 PurchasedPlant Ren Backhoe $ 150,000$ 144,668 $ 50,000 1.6.11 30.09.11 PurchasedobtainquotesCnclMeetgCnclMeetgPurchasedsourcespecsPurchase/deliverPurchase/deliverLGP tenderTenderPanelDraftSpecs withDESPlant Ren 2 Graders $ 700,000$ 702,898 $ 189,545 Feb011 18.10.11 PurchasedCnclMeetgPurch1/tradeinPurchase2nd graderMajor PlantAcquisitionJetpatcher $ 400,000N/A 19.7.11specs for road mtcemachine and prices foremulsion and tanksoughtspecssourcedLGP tendertenderpanelCncl Mtg Ordered Expected deliveryMedium PlantReplacements2 Mowers P&G $ 100,000$ 100,00001.7.11(5) Trailers $ 20,000(2) Mowers $ 40,000Waiting on mowingcontractsee plant below forbreakupWaiting on mowingcontractWaiting on mowingcontractTornadoTrailerpurchasePump $ 10,000Dynapac FootpathRoller$20,000Slasher $ 8,000to be auctioned nolonger required budgetreallocation todepending on mowingcontractWaiting on mowingcontractobtainquotesPurchaseDirector Engineering Services ReportFleet & Supply Section's Monthly Report1 of 2 March 2012 Ordinary Business PaperPage 536 of 555 of the March 2012 Ordinary Business Paper

Attachment 10.3.3.aLeasebackVehicleReplacement(12 monthreplacement foradmin vehicleSupervise/Managerup to 60,000km)$1,335,000*Subarus$26425 ea*Toyotas$37,500ea*Caprice$47,400*Kluger$41,300*Subarus$25,360ea*Toyotas$30,000ea*Calais$22,500*Berlina$21,00001.7.11ongoing through outthe year. Figures andvehicles only shown forOctober onwards.Todate--22 vehiclessold (4 Utes/18 Cars);10 vehicles to sell(7Utes/3 Cars) PlusSES (4 utes/1wagon)2 SubaruForesters*2ToyotaHilux*1HoldenCaprice*1ToyotaKlugerquotesfor 5 SESvehiclespurchase5 SESvehiclesorderedSESvehiclesandassociatedequipmentLease back Vehicle budget to betransferred to Corperate ServicesOperationalVehicleReplacements$ 176,00001.7.11to purchase as at1/11/11: approx (5)Utes -(2)for P&G (3)for Roads1 Surveyvehiclepuchased2 twincabsRoadsSmall PlantReplacements$20,000Hedgecutter; 4xGenerato2 x airconpressors3 xFertilizerSpreader4 xPressureCleanerDirector Engineering Services ReportFleet & Supply Section's Monthly Report2 of 2 March 2012 Ordinary Business PaperPage 537 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL11NOTICES OF MOTIONORDINARY MEETING OF COUNCIL HELD ONTUESDAY, 20 TH MARCH 2012.Page 538 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11 NOTICES OF MOTION11.1 NOTICES OF MOTIONREVIEW OF PROJECTS IN EXCESS OF $100,000(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That a review of all projects completed in the last three years with a final costs inexcess of $100,000 be carried out with the following information being madeavailable to the Council:Initial cost estimate;Final actual cost; andAn explanation where the variance exceeds an increase of 20 percent.”SupportNil.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 539 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.2 NOTICES OF MOTIONREVIEW OF NARRABRI SHIRE COUNCIL FINANCIAL POSITION(CMB:EL)Cr Bolton has advised that at the next meeting of Council he intends moving the following Noticeof Motion:“That Council engage a forensic accountant or other suitably qualified person toreview the financial position of Narrabri Shire Council, with such review to identifythe following –1. A general overview of Councils current financial position.2. A comparison of Council’s financial position as against industry standardbenchmarks.3. A report as to any vote of expenditure contained in the 2009/10, 2010/11 or2011/12 budgets where such vote has been exceeded by 10% or more, such reportto includea) The name of the department head responsible for that vote,b) If and when the over-expenditure was reported to Council,c) The projected final over-expenditure in any case where a current budgetvote contains an over-expenditure.4. A detailed report as to Council’s current loan position5. An opinion as to the relative strength or otherwise of Council’s financial position.6. That we formally notify the Department of Local Government as to the actiontaken.”Support1. In the year 2010/11 Council projected an operating budget surplus of $5.6 million butrecorded an actual deficit of $ 800,000.2. This means that Council overspent its budget by $6.4 million.3. The 2010/11 roads budget had a projected original expenditure of $7.5 million but anactual expenditure of $20.8 million. Of the $13.3 million increase, it would appear thatonly $4.5 million was flood grant works and $2 million was increased depreciation leaving$7 million unexplained increase in roads expenditure. This is equivalent to half of ourannual rate levee.4. The extraordinary difference in the budgeted expenditure for Administration of $5.8million with a reported result of $2.8 million.NOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 540 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION5. In view of the massive variations of budget to actual in the 10/11 budget and the fact thatthere was insufficient reporting to Council in the Quarterly Reviews, how then canCouncillors have any faith in the 2nd quarter review 2011/12 that says that there is a 23thousand dollar improved variance to the budget. Why should Councillors think that the2nd Quarter financial report for 2012 be any more accurate than the 2nd Quarter report of2011.6. The Capital budget report of the 2nd quarter 2011/12 shows that there is a $6.6 Millionincrease in Capital expenditure, it is proposed to mostly fund this by an increase in transferfrom internal reserves of $4.8 million, this could be referred to as the ‘Black Hole” Itshould be further noted that audited internal restrictions statements of 30/06/11 were $7.7million, Council is proposing to reduce this to $1.4 million by June 2012.As of June 2011 Plant reserve, quarry and CDO loss reserve were cumulatively worth $3.9million.In short if Council satisfies its budgeted Capital works it will have used up almost allof available cash reserves and as of end of June 2012 and not be able to cover the basicfinancial requirement of its Employee leave Entitlements should an unbudgetedcontingency require funding.Because the 2010/11 Council finances have been audited, it is clear that what was budgetedto be achieved and what actually happened were completely different.The evidence seems to indicate that there was no-one minding the shop with the end resultprogrammed improvements for the Community will have to be dramatically slashed tokeep Narrabri Shire Council with satisfactory cash reserves.Any objective study of the evidence above can only lead to the conclusion that the integrityof the financial reporting to Council has been of a standard not adequate to allow thisCouncil to commit future generations to the burden of a massive proposed increase inCouncil's borrowings from 8 to 25 million dollars this year.Cr C BoltonCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 541 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.3 NOTICES OF MOTIONPUBLIC MEETING TO ADDRESS DANGERS OF COAL DUST(BOR:EL)Cr O’Regan has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That Council fund the costs of air fares from England and return plusaccommodation in Australia for Dr. van Steenis M.B.B.S. to address a PublicMeeting in the Crossing Theatre on the dangers of coal dust to adults and unbornchildren with particular reference to asthma in adults and autism in children.”SupportI acknowledge this is a big ask to put to Council but Dr. van Steenis has a worldwide reputation inthe field of coal dust particularly in the field of asthma and autism problems in children.I will include all the information I have on the problems of coal dust and also the backgroundrelated to Dr. van Steenis (Attachment 11.3.a).I will expand on this motion when I move it at the March meeting.Cr B O’ReganCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 542 of 555 of the March 2012 Ordinary Business Paper

Page 1 of 4Attachment 11.3.aCoal opencasting and healthDr Dick van SteenisMy work has been peer reviewed by professors in the UK and USA anddescribes just a small portion of the health damage and cumulative effectscaused by opencast mining. For 16 years I have researched industrial airpollution (including opencasting) with its consequential health damage namelyillness and premature deaths. Published research confirms that both PM1 &PM2.5 particulates produced by opencasting of coal, especially if toxic waste ispresent due to known or unknown tipping, CAUSE new cases of asthma todevelop in children and adults as well as exacerbating those who already haveit. There will also result increased incidence of chronic pulmonary obstructivedisease, heart attacks, generalised premature deaths, strokes, type 2 diabetes,clinical depression and in addition other conditions resulting from any toxicwaste and machinery emission ingredients contaminating the area which wouldinclude cancers, hormone disorders, birth defects, low birth-weight babies, skinrashes, behaviour disorders, infections (including eye) and immune systemdisruption etc. due to pollutants such as organic compounds (including PAHs),heavy metals, dioxins (rife in North East Derbyshire), and even radio-activematter. Fuel quality used by equipment & vehicles is also critical as fuel used isnormally of inferior quality compared to city diesel.Studies in NE Derbyshire (1994-2000) comprising school medical records,school asthma inhaler use, microscopy of dust outside and within buildings, andPM 2.5 monitor readings with filter analysis at 5 schools covering a 3 yearperiod, all confirm a rise in asthma to affect 33% of primary school children livingwithin one mile, a cumulative rise to 21 % at two miles and even 12% at threemiles. Welsh Office studies at Gwaun Cae Gurwen also discovered 33% ofchildren in three schools to have developed asthma at one mile, based on peakflow readings. West Glamorgan studies found coal particles plus diesel particlesin the filters partly upwind of the opencast, over the top of a large mountain.Peakflow measurements and asthma inhaler use worsened as particulate levelsrose in direct proportion, and this happened irrespective of home conditions andsocial factors. A Lanarkshire study (1998) proved that hospital admissions forasthma rose with opencasting of coal, again within three miles or so, withcumulative rises year after year, falling when the opencasting ceased. ALiverpool University study even showed a rise in asthma in schools within 2kmof moving coal at the docks, irrespective of smoking habits and unemployment.Coal dust from moving coal can be reduced by some 80% by foaming with GEDusTreat DC9112E used in USA.Hospital admissions for asthma in the Tinsley area, since opencasting began atOrgreave, rose to 11 per 1000 population as against 3 per 1000 at Sheffield CityCentre and 1 per 1000 in Worcestershire. All three areas have motorways. GPdoctors in the area of SE Sheffield, namely Handsworth area etc., have noted alarge rise in asthma incidence in their area since Orgreave opencasting began.They are clear of the M1. The rise at Tinsley is not confined only to asthma, alsodiabetes, due to possible dioxin or arsenic contamination contained in PM2.5particulates (which produce oxidative radicals). In London 0.5 miles away fromthe millennium dome site, the asthma incidence rose from 11.9% of schoolchildren in early 1996 to some 50% in November 1998, with the only changebeing the “opencasting” of that waste site development at Greenwich, containingno doubt nickel, phenols etc.Findings of microscopy and particle analysis, presented at the RoyalNotices of MotionPublic Meeting to Address Dangers of Coal Dust1 of 5 March 2012 Ordinary Business PaperPage 543 of 555 of the March 2012 Ordinary Business Paper

Page 2 of 4Attachment 11.3.aMicroscopical Society in London in July 1998, revealed that asthma caused byopencasting involves:(A). Cut quartz particles of which 36% were found to be smaller than PM 0.3,which are second to asbestos in terms of serious effects on the lungs. The bodywalls off these particles, causing fibrosis (called silicosis). These PM1 sizedsilica particles also enhance peripheral thrombosis.(B). Coal particles around PM 1 in size cause an inflammation in thelungs. Repeated doses then lead to fibrosis, called pneumoconiosis inminers. Macrophages can only cope with a small amount of PM1 &PM2.5 particles at a time. The immune system T-lymphocytes have toassist the macrophages leaving the immune system unprotected fromvaccines and infections. Excess particles become walled off causingCOPD, even at age 10 years. A recent study in Austria using lungspirometry proved PM1 inhalation was even worse than PM2.5,probably due to greater surface area. PM1 particulate has beenshown to promote early atherosclerosis and oxidative stress.It only needs an increase of 14.3ug/m3 of PM2.5s for 3 hours to cause aheart attack in a vulnerable patient. Peak levels of PM2.5 in Derbyshireexceeded 150ug/m3 in 2000. Peak levels of PM1 measured atHollingdean (Brighton) brown field site development by 4 bulldozersJune 2007 reached 1100ug/m3 of PM1 (safe level around 6ug/m3) and375 ug/m3 of PM2.5 (safe level around 7ug/m3). Remember onlyparticles smaller than PM3 (3 microns) get into the depths of your lungs.The UK measures PM10 with monitors checking PM4 to PM10, NONEof which get into the lungs. TEOM instruments can be adjusteddownwards. It must be stated that readings of PM2.5s rise and fallentirely separately from PM10s. PM10 monitors are thus totally uselessin the UK for commenting on health damage, confirmed in the Austrianstudy. At Hollingdean (Brighton) the week average readings amountedto PM10s=116ug/m3, PM2.5s=163ug/m3 & PM1s =253ug/m3DEFRA’s few PM2.5 monitors are inappropriately sited and readings arebeing “adjusted” and do not cover all the time.Fuel emission particles of acidic carbon may include heavy metal and/orPAH contaminants. These particles cause inflammation within the lungsand beyond lasting several days (maximum effects on the heart arisingsecond day) plus heart attacks, strokes, cancers years later from theany metals or PAHs . Analysis of PM2.5s in Derbyshire discovered highcadmium levels plus substantial levels of arsenic and mercury from abrown field site, mixed in with coal dust. PAHs (polycyclic aromatichydrocarbons) emitted in the vehicle exhaust fumes are carcinogenic,and cause mutation of a gene leading to asthma.(Perera). Dr.Perera also proved that IQ of young children fell in directproportion to PAH exposure. NSW (Australia) primary schoolperformance rankings published by smh.com.au on 14 March 2011revealed 11 schools affected by opencast mining had socioeconomicrating av. 952/1000 with ranking av. 1547/2076 but 11other schools of socio-economic av. 955/1000 had performanceranking of 447/2076 confirming expected drop in IQ from mining.Perera has also proven PAH/DNA adducts causing depression &attention deficit in children.Just 8.5 ug/m3 of PM2.5s lead to a drop of 60ml in peak flow.Even healthy human volunteers revealed significant increases in whiteNotices of MotionPublic Meeting to Address Dangers of Coal Dust2 of 5 March 2012 Ordinary Business PaperPage 544 of 555 of the March 2012 Ordinary Business Paper

Page 3 of 4Attachment 11.3.acells, histamine etc, in the lungs just 6 hours after inhaling road dieselexhaust, with increased white cells and platelets in the peripheral bloodA rise of just 14.3ug/m3 of PM2.5s for 3 hours has been proved toincrease heart attacks (p=0006). The fuel used by heavy equipment inthe UK is normally industrial diesel, which is toxic. A single earthmovingmachine could release as many as 145 million billion ultra fineparticles per minute, equivalent to some 900,000 Volvo V70 petrol cars.An American study involving x-rays annually for twenty years, showed55% of opencast workers had developed lung damage, proven by x-rayby year twenty. In USA, train drivers have been paid compensation forasthma or COPD caused by inhalation of emissions from diesel fuels.The USEPA brought in laws to improve this off-road diesel qualityincluding reducing sulphur content by 99%.In the Dolk Report in the Lancet 1998, the graph confirmed a criticaldistance of 3 miles radius around waste sites for a rise in birth defects.In Wales in February 2008 the Minerals Planning Policy Draft MineralsTechnical Advice No. 2:Coal was published for consultation withresponses closing 23 May 2008. They insist on a health impactassessment (done by Cardiff University for Kenfig Hill proposal whichled to refusal) and a 350m buffer zone (now 500m). But a true bufferzone to protect public health should really be 4.8km (3 miles). In NSW(Australia) 2010 a study revealed illness rates at 2 miles from anopencast coalmine were double rates at 3 miles.My medical evidence concerns PM2.5 particles and below. These are manmade,and are the culprits that enter the lung. PM10 printouts in the UK cannotbe relied upon. The DETR has admitted that the figures are massaged downand are hence not accurate or reliable. The same applies to the few PM2.5TEOM machines. This is confirmed by the Environment Agency who also hasadmitted that their data is not always "accurate, complete, up-to-date or valid."The highest PM 2.5 figures in the UK have been not from highways, but fromsites such as the opencasting of brownfield land in Brighton shifting a burningcoal tip in Standish, around the Castle Cement plant at Clitheroe (recordings ofup to 250ug/M3 were found in a hospital and 600ug/m3 of PM2.5s downwindoutside in the open) and from the UK junk quality incinerators.Experience gained at Arkwright proves that the alleged ability to control dust byopencasters is a complete fallacy. I was present when BBCTV filmed emissionsat Arkwright with separate clouds of coal-dust and vehicle emissions. PM2.5sand PM1s rise, and can stay suspended in the air for up to one week, totallydependent on the weather as to where and when they ground. Maximumgrounding takes place at l l pm and 4am, confirmed by monitoring at Standish &Clay Cross. Civil Engineering Feb.2012 exposes fake company air modellingnot checked & amended by measured data, producing false low predictions.PM2.5 measurements in the latter half of September 1998 have revealed higherlevels at Grassmoor and Hasland, Derbyshire some 2.1 miles from Arkwrightopencast than at Tupton and Wingerworth at about 3.1 miles from Arkwright.Levels at Grassmoor were as high as 42.5ug/m3. Peaks of PM2.5s in Oct. 1998reached 80ug/M3 in the Hasland area and 150ug/m3 in 2000. This confirms thecause of the higher asthma incidence at Grassmoor.The NHS is paying the bill.With cost limited frozen budgets now affecting both hospitals and PCTs, whichpatients will be denied treatment to pay for those made ill or who die, throughopencasting? Costs of illness & death in Virginia USA by Hendryx 2008revealed the scale of health damage, confirmed in a report by Epstein et al. inNotices of MotionPublic Meeting to Address Dangers of Coal Dust3 of 5 March 2012 Ordinary Business PaperPage 545 of 555 of the March 2012 Ordinary Business Paper

Page 4 of 4Attachment 11.3.a2011 (Ann.N.Y.Acad, Sci.1219. pp73-98).The Douglasdale (Scotland) 2009 Coal Health Study proved COPD incidencehad risen 60% between 2004-2008 while other areas had no rise. A 2003 profilerevealed 52% rise in disability living allowance claimants compared with a cleararea, 27% rise in those too ill to work cf. Scottish average, 19% rise in lowbirthweight babies and a 23% rise in cancer. In the Hunter Valley, NSW(Australia) death rates by 2009 were 37% higher than the Australian average. Ilectured there in Dec 2009 and found opencast mines, 2 coal-fired powerstations and 1 power station/incinerator. Lung tests on 700 children revealedlung damage in 20%. Heart attack rates at A&E and inpatient hospital levelswere very high. Horses at one stud were infected with retroviruses as the T-lymphocytes of the immune system handle the inhaled PM2.5/PM1s leaving theimmune system unable to cope with infections.What knowledge of medicine and toxicology has a Mineral Planning Authoritygot? What training has an environmental services department in medicine andtoxicology? What postgraduate tuition in toxicology have public health directorsreceived and from whom? COMEAP have conflicts of interest while theirreferences are dated. Dr. Pless-Mulloli admitted 1997 at CwmBran that herNewcastle report was "all fraud" and "political" and proves nothing due to afraudulent protocol and methodology. There was no before-during-after data.There were no peak flow measurements. Ages 1 to 11 were supposed to fill informs. Figures were “adjusted” and “cleaned” and discarded to suit. The controlswere chosen with equally bad pollution. GPs were not involved. In one area GPdata revealed 28 children were asthmatic but the report stated none. A PM10reading of MINUS 4.9ug/m3 was rewritten as PLUS 0.5ug/m3 etc. There wasallegedly no coal or diesel in PM10 particulates collected though Dr. Tim Jonesdid find these in Welsh opencast emissions . Article 8 of the Human RightsConvention should be used in the courts to force disclosure of relevant healthauthority data, in consideration of public health risks of imposition bygovernment agencies. Article 16 states that use of one's rights (to opencast etc)must never ruin somebody else's rights. Article 2 provides for right to life. TheWHO 1997 report insists on mapping out health data to form public healthpolicy, which only I have done in the UK in this opencasting of coal issue.Copyright - Dr D Van Steenis M.B.B.S. updated 4 February,2012.References and data were obtained from Dr D Williams, Mr P Ordidge, RoyalMicroscopical Society Conference July 1998, Epidemiology July 1995, WestGlamorgan HA, Lanarkshire HA, Ken Coates MEP, English Partnerships (andCPL data), USEPA Research & Harvard School of Public Health, RespiratoryMorbidity in Merseyside School Children exposed to coal dust and air pollution,in Archives of Disease in Childhood 1994;70:305-312 & Doctor Salvi et al AM JRESPIR CRIT CARE MED 1999; 159: 702-709. Also Proc R Coll PhysiciansEdinb 1999; 29;1115- "Health Effects of Respirable Dust from Opencast CoalMining" by Doctors Munro and Crompton. This article backs up my research.What Car magazine of June 1999 contains an article analysing vehicle particleemissions from PM0.01 to PM 1. The PM 0.01 to PM0.1 particles tend to rise upinto the atmosphere causing dimming. I append 360 references.Notices of MotionPublic Meeting to Address Dangers of Coal Dust4 of 5 March 2012 Ordinary Business PaperPage 546 of 555 of the March 2012 Ordinary Business Paper

Page 5 of 4Attachment 11.3.aNotices of MotionPublic Meeting to Address Dangers of Coal Dust5 of 5 March 2012 Ordinary Business PaperPage 547 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.4 NOTICES OF MOTIONMAINTENANCE PROGRAM – NARRABRI OLD CEMETERY(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That Narrabri Shire Council implement within one month a maintenanceprogram for the old cemetery that as a minimum includes having an employeeallocated a fixed day each week to attend the cemetery to mow, whipper snip andpick up debris as required in the grave lines as well as the general area. A reportis to be offered to council each month confirming that a fixed day has beenchosen and that an employee is attending to this task. A review to be carried outafter six months to allow discussion of the issue again.”SupportThe cemetery is regularly in an unmaintained state and this is offensive to the relatives of thoseinterred in the old cemetery. Since being on council I have seen several attempts at resolving thisproblem that focus on the big quick fix and then the need is forgotten and the maintenance isneglected again. A program with one staff member responsible and a monthly report should allowthis task to receive the attention that is required.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 548 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.5 NOTICES OF MOTIONGRAVESITE ACCESS ROADS – NARRABRI OLD CEMETERY(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That all grave site access roads in the Old Narrabri cemetery be formed up and gravelledwithin one year with a plan including gravel type to be before council within threemonths.”SupportThe access roads are unformed and cut up and are generally unsightly.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 549 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.6 NOTICES OF MOTIONWEEKLY CLEANING PROGRAM – COOMA OVAL TOILETS(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That the public toilets at Cooma Oval be placed in a weekly cleaning programwithin one month and that soap dispensers and paper towel rolls be placed in boththe boys and girls toilets within two months of the successful resolution of thismotion with a specific report to be offered to council each month for a period of sixmonths showing this cleaning is being carried out.”SupportAgain this issue is unresolved despite the attempts of the junior league and cricket committees anda site inspection involving myself and senior council staff many months ago. I was offeredassurances that the matter would be sorted quickly and I have followed up once. As is routine withthese issues staff claim they are ‘gunna do something soon’ this includes all manner of expensiveplans; all too grand when what is required is a weekly cleaning.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 550 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.7 NOTICES OF MOTIONOPENING OF COOMA OVAL TOILETS(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That the Cooma Oval toilets be open at times suitable to parents and childrenusing the play equipment adjacent to these toilets, Shire staff should discuss thiswith parents and present a proposal to a Council meeting within two months.”SupportThe play equipment is used at times other than those associated with coaching and games and ifmotions are not structured with a report to return to a Council meeting within a defined time periodstaff thumb their noses at these instructions arising from community requests and nothing happensyet again.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 551 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.8 NOTICES OF MOTIONINVESTIGATION OF RAIL CROSSING(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That an investigation into reopening the rail crossing that extends from theOld Newell Highway to the Old Turrawan road with a view to stopping allheavy vehicle transport past the Narrabri West Public School. That the Grainfacilities along Old Turrawan road as well as residents and parents andteachers be involved in these discussions.”SupportThe operation of the grain facilities along Old Turrawan road are being hindered by the sensiblerestriction paced on truck movements past the public school. Reopening the rail crossing will be awin / win for grain businesses, truck drivers and the parents and children of the Narrabri WestPublic School.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 552 of 555 of the March 2012 Ordinary Business Paper

–NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.9 NOTICES OF MOTIONACCESS OPTIONS FOR RESIDENTS(JC:EL)Cr Clements has advised that at the next meeting of Council he intends moving the followingNotice of Motion:“That the investigation requested by motion 11.8 include a report into accessoptions for residents of Fraser and other streets isolated from emergencyservices when trains are standing on the Moree track while being loaded.”SupportWith the increasing usage of grain facilities residents south of the rail crossing on Fraser and otherstreets are cut off from Narrabri and all necessary emergency services for hours at a time.Cr J ClementsCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 553 of 555 of the March 2012 Ordinary Business Paper

NARRABRI SHIRE COUNCIL MARCH 2012 NOTICES OF MOTION11.10 NOTICES OF MOTIONBARWON LOCAL AREA COMMAND 150 TH ANNIVERSARY CELEBRATIONS(RL:EL)Cr Lowder has advised that at the next meeting of Council he intends moving the following Noticeof Motion:“That the Narrabri Shire Council support the Barwon Local Area Command150 th Anniversary celebrations in Narrabri on Saturday 21 st April, 2012 with agrant of $2,500.00 to assist them with this very important community event.”SupportPlease refer to attached letter (Attachment 11.10.a) from Sergeant Ken Anderson which fullyexplains the significance of this event.Cr R LowderCOUNCILLORNOTICES OF MOTION REPORT PRESENTED TO THE ORDINARY MEETING OF COUNCIL THAT WAS HELD INTHE NARRABRI SHIRE COUNCIL CHAMBERS, 46-48 MAITLAND STREET, NARRABRI, ON TUESDAY, 21 STFEBRUARY 2012.GENERAL MANAGERMAYORPage 554 of 555 of the March 2012 Ordinary Business Paper

Attachment 11.10.aNotices of MotionBarwon Local Area Command 150th Anniversary1 of 1 March 2012 Ordinary Business PaperPage 555 of 555 of the March 2012 Ordinary Business Paper