career resource manual - UC Davis / Internship and Career Center

4-Year Plan of Career DevelopmentFreshman Year - “Self-Discover”CAREER• Register for Aggie Job Link through the ICC website andcomplete your profile.• Take career self-assessment inventories at CAPS shcs.ucdavis.edu/services/groups/uceg.• Talk over career ideas with an ICC Student Advisor orCoordinator, and with parents, friends, instructors, androommates.• Enroll in a Freshman Seminar on Career Exploration.• Attend ICC workshops to learn how to prepare for an internshipor job search.• Become a member of the Student Alumni Association to startbuilding your network.• Attend Internship and Career Fair to explore internships and careers.ACADEMICS• Take a variety of courses to explore majors.• Attend Office Hours to build a relationship with instructors.• Attend study skills and time management workshopssuccess.ucdavis.edu.• See an academic coordinator or peer advisor in the residencehalls to create a four year plan.• Explore undergraduate research opportunities through ICCicc.ucdavis.edu or Undergraduate Research Centerundergraduateresearch.ucdavis.edu/urcConf.• Attend RHAT academic programs in the residence halls.EXTRACURRICULAR• Get involved in residence hall activities, student organizations orcommunity service projects csi.ucdavis.edu.• Apply for a Peer Advisor, Resident Advisor or Student Assistantposition for the next academic year.Sophomore Year - “Expand Your CareerHorizons”CAREER• Pursue internship opportunities.• Talk with ICC Staff about narrowing career interests.• Develop a resume and attend a Resume Writing workshopfor further guidance iccweb.ucdavis.edu/students/CalendarEvents.• Attend ICC workshops, Company Information Sessions andCareer Fairs.• Schedule an informational interview or job shadowing experience.ACADEMICS• Meet with an academic advisor.• Declare major and layout courses for each remaining quarter atUC Davis.• Explore the UC Davis Washington Program, the UC CenterSacramento and UC Davis Study Abroad.EXTRACURRICULAR• Strengthen your involvement on campus through studentorganizations.• Find a summer experience that will help you explore yourinterest and begin to gain transferable skills.Junior Year - “Test Options”CAREER• Complete an internship, see ICC for additional help and resources.• Meet with ICC staff about your career goals and plans.• Update your resume quarterly.• Conduct informational interviews.• Create LinkedIn account to further your network.• Invest in appropriate business attire for interviewing.• Search for a summer job/internship that aligns with your educationaland career goals.ACADEMICS• Supplement major courses with practical skills courses (writing,public speaking, statistics, accounting, computer skills, etc.).• Consider applying to the UC Davis Washington Program, UCCenter Sacramento or UC Davis Study Abroad.• Research graduate or professional schools, and request letters ofrecommendation, if appropriate.• Explore and consider research opportunities.• Develop a relationship with an academic mentor advisor orfaculty member.EXTRACURRICULAR• Continue to strengthen communication and leadership rolesthrough organizations or other activities.• Work at a part-time job to build transferable skills.• Volunteer for campus or community service.Senior Year - “A Time to MakeDecisions”CAREER• Tailor cover letter and resume for the specific industry and positionsyou are interested in.• Begin conducting job search: online, by telephone, and in person.• Use Aggie Job Link, for on-campus interviews with the CareerRecruiting Program (start in September).• Research and develop a target list of potential employers.• Attend employer information sessions and internship and careerfairs.• Develop an active network by joining a professional organization.• Attend workshops and meet with staff at the ICC to develop yourjob search strategy.• Be aware of your online presence and how this may affect yourjob search.ACADEMICS• Research and apply to graduate schools.• Conduct a research project. Consider presenting at theUndergraduate Research Conference in spring.• Confirm your remaining degree requirements.EXTRACURRICULAR• Explore lifelong learning interests.• Prepare for transition from undergraduate experience to professionalor graduate school.• Take a leadership role in a class, project, or club.This page brought to you by the UC Davis Jobs Initiative, a joint project ofthe ICC & ASUCD.Career Developmenticc.ucdavis.edu 3

Career DevelopmentThe model shown is designed to help you makecareer decisions throughout your lifelong careerpath.Self ExplorationCareer Planning: A Lifelong ProcessCome to the ICC to ExploreCareer OptionsMake an appointment withan ICC Coordinator in SouthHall. Or attend ICC Events &Workshops—check the Calendarat icc.ucdavis.edu.Take the Career Decision Making Course (AMS 95)Open to all majors, this 2 unit course will help you understandand apply career development theories and practices.Contact the Internship & Career Center for information aboutthe next term the course will be offered.CAPS (Counseling & Psychological Services)Offers Career Assessments and a six-session Career ExplorationGroup for undergrads and one for graduate students. ContactCAPS for more information shcs.ucdavis.edu.Research Your CareerOptionsInternship and Career CenterLibrary, South Hall Room 215.Browse through hundreds ofup-to-date, career-related books,graduate and professional schoolinformation.Identify Job TitlesLook into the Occupational Outlook Handbookwww.bls.gov for thousands of job titles and informationon education required, job outlook and a job description.Conduct Informational InterviewsFind professionals working in careers or organizations thatinterest you and gain a better understanding of the career orindustry.Job ShadowingOnce you have identified a professional who is willing totalk to you about his or her career, ask if you may “shadow”them to gain a sense of what a typical work day is like.VideosView our online videos atWorld of Work Researchicc.ucdavis.edu.Experiential EducationInternshipsUse your Aggie Job LinkAccount at icc.ucdavis.eduto find internship postings.Choose according to youracademic and career interestsand qualifications; or developyour own internship bynetworking with professionalswho have jobs or work at organizationsthat interest you. See an ICC Student Advisor forassistance or attend an ICC workshop.Gain Practical SkillsThrough academic course work, volunteering and interningyou can gain leadership, communication, interpersonal,teamwork, quantitative and computer skills, all of which areimportant in today’s workplace.Service LearningAn effort to increase citizen involvement in community service,this is a combination of serving and learning which results in changefor both the provider and the recipient. It provides a teachingapproach that integrates community service with academic study toenrich learning, teach responsibility, and strengthen communities.Service learning links academic content and standards to communityneeds. Academic credit may be awarded in some classes.4 University of California, Davis

Decision-MakingThere are several steps totake as you make decisions aboutyour career. One model widelyused in career development andcreated by America’s CareerResource Network, describes itas a cyclical process that can beentered at any point and repeatedover and over until satisfaction isachieved. For examples visit:www.acrnetwork.org/decision.htm.Attend our “Career Exploration” workshop offeredmany times each quarter. Check our Events Calendar forother events to help with your decision making.Job SearchNow that you have narrowedyour focus and set your goals,it’s time to prepare for your jobsearch.The ICC has workshopslisted in our Events Calendarand online webshops aticc.ucdavis.edu.• How to tailor your resumeand cover letter to thespecific position for whichyou apply.• Use a variety of job search methods.• Develop strong interviewing skills.• Network, network, network!• Once you are offered an employment opportunity, evaluateit carefully before accepting.Career ManagementCongratulations, you’re ready tostart your new job! The followingtips will help you successfullymanage your new career.• Be realistic about yourexpectations.• Promotions are earnedthrough diligence, initiativeand hard work.• Arrive early, stay late.• Keep your supervisor informed about your interests andaccomplishments.• Act and speak professionally, offer firm handshakes,respect your co-workers.• Be a team player.• Establish a mentor relationship with a seasoned veteran.• Participate in committees and professional associations.• Benchmark your skills and be a life-long learner!University of California, Davis 5

1-800-588-5260AIRFORCE.COM/HEALTHCARE6 University of California, Davis

Informational Interviews1. What is an “informational interview,” and why is itbeneficial to you? An informational interview is an arrangedmeeting with someone who works in a job, career field or organizationthat interests you.Benefits:• Very effective technique for researching and screeningcareers, jobs or employers.• Answers questions about what it’s like to work in aparticular career field or job or for a specific organization.• Increases your network of contacts (the majority of jobsare obtained through networking).• Talking to industry professionals is a good way offinding out if a field really is a good fit for you.• Helps prepare you for the job search.2. How do I find people who will talk to me? This may beeasier than you think. People typically enjoy talking about theirwork and sharing their experiences. Start with your own network:• ICC and UC Davis faculty and staff• LinkedIn• Friends and family members (don’t forget roommatesand classmates)• Directories, other print resources or through companywebsite links and staff listing• Cal Aggie Alumni Association Career Resource Network• Professional Associations and Events• ICC Events (info meetings, career fairs)3. How do I initiate contact? Be clear about your objectivebefore you initiate contact. Set clear goals about what you wantto gain from the informational interview. Once you have acontact’s name, you may contact this person by letter, email ortelephone. Let this person know how you found out about himor her. When you contact someone, explain why you are doingso and be polite, positive and businesslike. Request a mutuallyconvenient, thirty-minute face-to-face meeting. It’s best toprepare a draft or script. Following is a sample script that canbe used for phone or email introductions.“Hello, my name is Max Mustang. Alex Aggie suggestedI call you. I am a senior majoring in English at UCDavis, and am interested in learning more about careersin technical writing. Alex recommended you as someonewho is well respected in this field. I’m wondering if Imight make a half-hour appointment with you sometimesoon to seek your advice. Thank you!”You can use a similar script for email requests.Remember, you want insight into their job market; you arenot asking them for a job.4. How do I prepare for the informational interview? Doinitial research on the career field or employer using the internetor the print resources in the Internship and Career CenterLibrary, Room 215 South Hall. Once you’ve done the research,develop a 30-second overview of yourself, including yourreasons for contacting this person. Plan open-ended questions tokeep the conversation flowing, instead of questions that require a“Yes” or “No” answer (see sample question section). Dress neatlyand appropriately, just as you would for a job interview. Takemultiple copies of your resume and a notepad and pen, alongwith a list of prioritized questions to ask.5. How should I conduct the informational interview? Startby thanking your contact for taking the time to meet with you,then establish rapport by engaging in a bit of small talk. Afterthat give a short introduction of who you are and why yousought them out, then start with your prioritized questions.As a rule, you should not take more than a half hour of thisperson’s time, so you may not be able to ask all your questions.Remember, this is a conversation, not an interrogation, so let itflow. Following are sample questions you might ask. Pick a fewkey ones.Questions about the career:1. How did you become interested in this career?2. What is a typical workday like? What are your jobresponsibilities?3. What are the rewards, challenges and frustrations ofworking in this career?4. What entry-level jobs are available in this field?5. What experience is necessary to enter this career?6. What advice do you have for someone preparing to enterthis career?Questions about the organization/industry:1. How does your position fit within the organization/industry/career field?2. What is your work environment like?3. What is the economic forecast for this industry?4. What is unique to your organization? Who are yourcompetitors?Questions about future growth/salary information:1. What are the employment prospects for someoneentering this field?2. What are some of the current issues and trends in thisfield?3. What is a typical starting salary or salary range in thisfield?Follow-up questions:1. Would you mind taking a quick look at my resume?How should I target my resume for your industry?2. Are there professional publications I should read orassociations I should join?3. What other professionals in this field would you recommendI speak with for additional information? May I useyour name when I contact them?4. May I keep in touch with you?Don’t be afraid to ask your own questions. This is yourchance to get the information you need from an industryprofessional.Shortly after your interview, send a thank-you note oremail. Let the person know how much you appreciated theirtime and advice. That person might think about alerting youin the future when a job opportunity arises in that organization...orhe or she might refer your resume to colleaguesin other organizations. Also, contact them occasionally tomaintain a relationship..Remember: Always send a thank-you note and don’t askfor a job!The Internship/Job Searchicc.ucdavis.edu 7

How to Research Employers and JobsThe Internship/Job SearchResearch employers and jobs to discover:• Employer histories, missions, products, services,locations, profiles, cultures, expectations, financial status,salaries, benefits and retirement plans• Industry trends• Job titles, responsibilities and duties• Typical career paths in various industries• Location of entry-level jobs, minimum qualifications• Appropriate vocabulary to use in discussing specific jobsYou can approach your research from one or more of thefollowing directions. You can research:• a specific job title• a career industry/field• employment sectors• a specific employerYou can conduct two types of research: primary researchand secondary research. Primary research involves talkingdirectly with people in a specific occupation or people whowork for a specific employer.Secondary research involves gathering information from printmaterials (books, newspapers, directories, etc.) or websites.If you want to conduct primary research, consider one ofthe following two strategies:• Conduct informational interviews with people to learnmore about a job title, a career field, an employmentsector or an employer.• There’s no better way to conduct primary research on acareer or employer than by doing an internship. Researchinternships on Aggie Job Link at icc.ucdavis.edu; searchby keyword or job function. Talk to an ICC staff memberfor more information and learn how to receive transcriptnotation and/or academic credit for an internship.If you want to conduct secondary research, visit theICC Career Library in Room 215 South Hall, where you’ll findnumerous career resources to assist you, or utilize the internet.How can I research a specific job title?• Explore the Occupational Outlook Handbookbls.gov/ooh• Visit the O*NET Occupational Information Networkonline.onetcenter.org• For California-focused information, go tocacareerzone.orgHow can I research a specific industry or career field?• Attend employer information meetings on campus.• Meet employer representatives at career fairs & ICCevents.• Join a career-related, registered, student organization. Visitcsi.ucdavis.edu for a list of organizations.• Read newspapers specific to your geographic area ofinterest. (e.g., sfgate.com/jobs for the Bay Area)• Check out profession-specific organizations and theirlocal chapters.• Go to the following websites to conduct industry research:rileyguide.com weddles.com/associationswetfeet.comEmployment Sectors To Research:• business/the corporate world/the private/for profit sector• the nonprofit sector• local, state or federal government• educationHow can I find out about employment in the corporateworld?• Use Aggie Job Link to research employers that recruit andhire UC Davis students through On-Campus Recruiting.Also learn about employer info meetings and research thecompanies attending career fairs.• Read periodicals (e.g., Sacramento Business Journal, FortuneMagazine, Wall Street Journal, etc.).How can I join the Community Service Resource Center’sListserv?• Visit the Community Service Resource Center in South Hall.• Visit the following websites:- Nonprofit Resource Center in Sacramento:nprcenter.org (select Quick Links)- Young Nonprofit Professionals Network:ynpn.org- CA Association of Nonprofits:canonprofits.org- National website of Nonprofits: idealist.orgHow can I find out about employment in government?• Talk to government employers at career fairs.• Visit icc.ucdavis.edu/students/internships/InternshipsbyInterests.htm, search for Government.• Visit the following websites:- Federal Government: www.usajobs.gov- State of CA: www.jobs.ca.gov• Visit federal, state, and county agency websites to learnabout the agency’s purpose, job listings and requirements,exam information, the hiring process, etc.NOTE: Most career positions in state government require youto take a civil service examination and/or complete an oralinterview. You will achieve a numerical score on the examwhich will then determine your eligibility for positions as theybecome available. This examination process can be lengthy, butworthwhile if you want to pursue a career in government.How can I find out about employment in education?• Go to edjoin.org to search for jobs in schools, K-12.• Use Aggie Job Link to research school districts recruitingat UC Davis.8 University of California, Davis

How can I find out about employers?After you have identified your preferred employment sector,research and develop a list of potential employers. To start:• Use your search engine (Google, Bing, etc.).• Attend employer info meetings and ICC events.• Talk to employer representatives at career fairs.• Consult the Book of Lists for information about employersin many large cities. Ask the ICC receptionist on thesecond floor, South Hall to view the books.• Contact the Chamber of Commerce in the city you areinterested in for information about local/small/privatelyowned employers: chamberofcommerce.com• Visit the employer’s website.• Generate a list of potential employers in a particularcareer field or industry, try:- Job Star: California Job Search Guide:jobstar.org• For researching large companies, try these sites:- HooversOnline: hoovers.com- WetFeet.com: wetfeet.comWhat job search sites can I use?The first preference of employers is for you to visit theirwebsites. When searching online for a job, keep in mind that,in addition to using Aggie Job Link, you should visit:Monster: monster.comCareer Builder: careerbuilder.comAmerica’s Job Bank: jobbankinfo.orgCraigslist: craigslist.orgLinkedIn: linkedin.comFor a list of the employers who offer the most entry-leveljobs to college graduates, go to: collegegrad.com/topemployers. AND, don’t forget to ask ICC Coordinators fortheir favorite recommendations on other industry-specific joblisting sites.What if I just want a short-term, temporary position?If you want to “find a job for your year off” before graduateschool or while you travel abroad, search online or visit theICC for a list of local temporary employment agencies. Useonly “employer-paid” temporary agencies.I know how to search for a job online. What else do Ineed to know?Remember an effective job search usually requires morethan just Google. Networking, Informational Interviewing,In-Person Visits, and using our on-campus Career RecruitingPrograms, as well as Employment Agencies to help your jobsearch. Watch a Job Search Strategies webshop online aticc.ucdavis.edu.The Internship/Job Searchicc.ucdavis.edu 9

Job Search StrategiesThere are many ways to look for a job, some of which are better than others. Presented below are some of the most popular ways,as well as helpful hints and pros and cons of each.Strategy Tools Pros Cons Helpful HintsNETWORKINGApproximately 80% of jobsare obtained through networking.Talk to everyoneyou know to develop a listof possible contacts; ask forinformation on job/companiesand to circulate your resume.• List of contacts• Resumes• Business attire• Social media sites such asFacebook and LinkedInMay learn of unadvertisedopenings. May result in acourtesy interview. Oftenresults in a closer match ofyour interests to a job.A contact in itself is notenough to get you a job. Youmay exhaust all leads withoutlanding a job. Quite timeconsuming.• Follow through on all leads.• Keep broadening yournetwork of contacts.The Internship/Job SearchCAREER FAIRSAttend job fairs to networkwith recruiters and pass outcopies of your resume.INTERNETSearch online job banks andcompany websites. Submitresume online/post on jobboards.ON-CAMPUSRECRUITINGFollow specific pro cedures tosecure on-campus interviews.• Fair information isavailable aticc.ucdavis.edu• Bulletin boards and emails• Access to the Web• Electronic resume• Aggie Job Link• USAJobs• CA State Personnel Board• Scheduling interviews• Employer literature• Resumes• Business attireSmall amount of time todevelop network of contacts.Guaranteed access to morethan one employer ofinterest. Get pre-selected foron-campus interviews.Actual job openings. Manyemployers use a wide varietyof job listing services. Manylistings have free to low-costaccess. Worldwide geographicreach.One of the primary ways inwhich companies recruit fortechnical and business positions.Student traffic can be heavy.Arrive early to maximizetime.Competition is growing asuse of the Web increases.Pay attention to multiplelistings—one position postedon a few sites —to avoidapplying multiple times.May be less effective fornon-technical/business candidates.• Follow up on leads andnetworking opportunities.• Obtain a list of companiesin advance to create a planof action.• Use the internet frequentlyas information and siteschange quickly.• Use the interview scheduleas a way to identify possibleemployers, even if you don’tget to interview on campuswith those employers.ONLINE NETWORKINGCreate a profile on professionalnetworking sites suchas LinkedIn. Increasingly,recruiters are using onlinenetworking sites to sourcecandidates.• Access to the Web• List of people to invite inas your contactsGood way to find networkingcontacts, as well as professionalgroups for researchingand networking.Takes a small amount oftime to set up profile• Everything you post shouldbe strictly professional intone and content.• You can use socialnetworking sites likeFacebook, too.PRINT/ELECTRONICRESOURCESScan want ads. Mail resumewith cover letter tailored tospecific job qualifications.• Newspapers• Journals• Newsletters• Trade magazines• Cover letters• ResumesInvolves minimal investmentof time in identifyingcompanies. Resume andcover letter are sent foractual job opening.Resume and cover letter willcompete with large numberof others. Ads followjob market; least effectivein times of economicdownturn.• Use as a meter on the jobmarket in a certain careerfield.• Try to get your materialsin as early as possible.IN-PERSON VISITVisit many companies. Askto see someone in a specificdepartment. Submit resumeand application, if possible.• Business attire• Company address list• ResumesResume and application areon file with the company.Requires a great deal of timeto make a relatively smallnumber of contacts.• Research the companiesprior to your visit. Ask fora specific person or askabout a specific type of job.TARGETED MAILINGDevelop a good cover lettertailored to a specific typeof job and the needs ofthe company. Send letterwith resume to selectedcompanies.• List of well-researchedcompanies• Tailored cover letters• Resumes• Email and faxBetter approach than the massmailingmethod. Investmentof time and effort shouldmerit stronger response fromemployers.Requires a significant investmentof time in researchingcompanies and writing coverletters as well as following upwith contacts.• Try to find out who is incharge of the area in whichyou want to work; sendyour materials to thatperson. Great method whenused in conjunction withnetworking.Adapted and reprinted with permission from Career Services, Pennsylvania StateUniversity, University Park, PA.10 University of California, Davis

Social Media and Your CareerThe Internship/Job SearchDid You Know?A recent survey found that 70 percent of U.S. businessmanagers say they decided not to hire a job candidate basedupon something found online about the candidate. Thisstatistic should help inform your strategy when developing aprofessional and visible online presence.Clean UpSocial media sites like Facebook and Twitter should notcontain any material that you would not want a future boss tosee. Remove any inappropriate photographs (use the grandmothertest; if you wouldn’t want her to see it, eliminateit), expletives, complaints about your job or your boss andany potentially controversial material. Consider adjustingyour privacy settings on social media profiles to the highestpossible level. Photo sharing sites should follow the same set ofstandards.Create a Professional Online PresenceIf an employer does an internet search for your name, itis a benefit to you if your name appears. It gives the impressionthat you are involved in recent digital trends and impliesa grasp of digital skills. Additionally, the internet provides anexcellent way to supplement traditional application materialsthat you submit with a more comprehensive view of your qualitiesand interests. Create a LinkedIn profile (more informationbelow) outlining your career goals and past experience. It mayhelp to start a blog covering an area related to your field. It willimpress a potential boss to see your intelligent and well-writtensubmission to a discussion board on the website or LinkedInpage of a related professional organization. If you are lookingfor jobs or internships in a creative field, develop an onlineportfolio showcasing your projects.Keep it PositiveEnsure that all your Twitter, Facebook, and LinkedIn postshave a positive tone. Employers want to hire people with agood attitude. Never air grievances about a boss or coworkeron the internet. Avoid complaining about relationships orschoolwork on a public forum. Make an effort to strategicallypost upbeat and well-worded updates about your job search,interests, and educational or extracurricular pursuits to theappropriate sites.LinkedInLinkedIn is the premier social media site for professionalsand companies looking to connect. It has become an important,if not crucial, part of the career search process. It is an excellentnetworking tool that allows you to expand your connections toprofessionals in your desired field, in ways that are difficult todo in-person or by email networking. Some companies are evenusing LinkedIn as their primary method for recruitment. Youcan also find updates about job openings through followingcompanies on LinkedIn.Create a LinkedIn profile, and be sure it is complete byusing the embedded profile wizard. You may choose to uploadyour resume for a quick way to fill in professional experienceinformation; review and edit the uploaded information forcorrectness. Once you have completed the profile, ask yourcoworkers, professors and supervisors to “recommend” you.If your LinkedIn profile is 100% complete, includingphoto, you are seven times more likely to be viewed.Next Steps1. Review tips and guidance on creating a profile andusing LinkedIn strategically by visiting help.linkedin.com2. Go to linkedin.com, search “Groups” for UCDavis Internship and Career Center, and click Join!12 University of California, Davis

How to Prepare for the FairThe friendly and informal format of a career fair makes iteasy to ask questions, explore internship and career options,develop a network of professional contacts, identify job openingsand even land an interview…in a short amount of time! Hereare some tips to help you make the most of your time at a fair.What to expect at the fair...A typical career fair at UC Davis attracts 1,500-2,500students and alumni and up to 130-170 employers. Allowyourself adequate time. Fairs are typically less crowded in themorning hours and busiest during the lunch hour. Just have afew minutes? Don’t let a limited amount of time keep youfrom attending the fair.Market yourself...A career fair is not the place to be passive or shy. Be readywith a one-minute commercial of the skills and talents that setyou apart from others who are competing for the same jobsee page 11. Rehearsing your “pitch” will help you feel andappear more confident, organized, and focused. For assistancein preparing a persuasive, upbeat and convincing “commercial,”visit the Internship & Career Center for help.Research companies...See ICC’s website icc.ucdavis.edu, click on Internship& Career Fairs for the list of companies, company descriptionsand possible links to company websites and jobs. Update yourknowledge of current events by watching news and businessreports on TV or reading online.Prioritize employers...Use our website to review employers coming to the Fair.Identify your priority companies to meet. Know which 4-6companies are your top choices; that is your “A” list. Also havea “B” list of companies of slightly lesser interest. When youenter the Fair, use a company on your “B” list as your firstcontact to work out your “jitters”. Once you feel confident inyour introduction, work your way through your “A” list. If timepermits, go to the “B” list companies.Bring copies of your resume...Be sure to have your resume reviewed by an ICC studentor staff advisor before distributing it. See pages 18-31 forexample resumes.First impressions last...Greet recruiters with confidence, enthusiasm and a firmhandshake. Smile, make eye contact and don’t forget to expressinterest in their companies and internship, summer or careeropportunities. Remember to ask for a business card for followupwith that company or ask what is the best way to follow up.State your purpose...When job hunting, state the type of position you are seeking.Dress in business casual or professional attire. Get completeinformation on how to apply and/or contact information.After the fair...It is critical to contact those companies in which you aremost interested. Be sure to mention in your email or phone callhow you made contact at the Fair. Attach an updated, tailoredcopy of your resume to the email. See sample letter onpage 40.Career fair etiquette and attire...Always wear “business casual” or “business formal” to thecareer fair.Be polite and courteous to everyone. Don’t interrupt theemployer representatives or other career fair attendees. If you’reunable to speak to the representative immediately,consider visiting another employer and then returning. Don’tdrop off your resume without speaking to the representative.Personal interaction could be key to your success. And finally,feel free to take the “give-aways,” but only if you’ve talked withthe representative—to “grab and go” is a no-no! If a companyrepresentative is busy, move on and return later.Internship and career fairs serve as recruiting toolsfor many employers and are popular events for savvystudents. Following are the fairs you can look forward tothis academic year. Visit our website for dates, times andparticipating employers.Study and Intern Abroad Fair - All Majors(Fall Quarter)Fall Internship and Career Fair - All Majors(Fall Quarter)Community Service Fair - All Majors(Fall Quarter)Engineering and Physical Sciences Internship andCareer Fair(Winter Quarter)Winter Internship and Career Fair - All Majors(Winter Quarter)Spring Internship and Career Fair - All Majors(Spring Quarter)The Internship/Job SearchAttend an ICC “Prepare for the Fair” workshop or webshop.Learn how to prepare, what to wear, what to ask and how to follow up. Visiticc.ucdavis.edu.icc.ucdavis.edu 13

Transferable SkillsBelow is a list of five broadskill areas which are dividedinto specific skill sets. Use acheckmark to indicate which skillsyou’ve developed. Write downexamples of when you used yourstrongest skills and describe whatthe end result was.ExampleIf the only job you have ever had is working at a hamburger restaurant—what skills haveyou gained from this experience that are related to a lab research position?• Following protocol • Cleanliness• Time management • Team workInstead of focusing on the obvious: handling cash, making hamburgers and fries. Showyour reader what skills you have gained that are related to the position you are applying for.The Internship/Job SearchCommunicationThe skillful expression, transmission andinterpretation of knowledge and ideas.__Speaking effectively__Writing effectively__Listening attentively__Expressing ideas__Facilitating discussions__Providing feedback__Negotiating__Persuading__Perceiving non-verbal messages__Presenting information__Describing feelings__Interviewing__EditingResearch & PlanningThe search for specific knowledge and theability to conceptualize future needs andsolutions.__Predicting__Creating theories and ideas__Identifying problems__Imagining alternatives__Identifying resources__Gathering information__Solving problems__Setting goals__Extracting information__Defining needs__Developing evaluations__Creating spreadsheets and databases__Calculating resultsHuman RelationsThe use of interpersonal skills for resolvingconflict, relating to and helping people.__Developing relationships__Being sensitive__Listening__Conveying feelings__Providing support__Motivating__Sharing credit__Counseling__Cooperating__Delegating with respect__Representing others__Perceiving feelings, situations__AssertingOrganizing, Management &LeadershipAbility to supervise and guide individuals andgroups in the completion of goals.__Initiating new ideas__Handling details__Coordinating tasks__Managing groups__Delegating responsibility__Teaching__Coaching__Organizing__Advising__Promoting change__Selling ideas or products__Decision making with others__Managing conflict__Enforcing policiesCharacter TraitsThe daily skills that assist in promoting effectiveproduction and work satisfaction.__Implementing decisions__Cooperating__Being punctual__Managing time__Attending to detail__Meeting goals__Enlisting help__Accepting responsibility__Setting and meeting deadlines__Making decisionsWrite Accomplishment PhrasesSet your resume apart from the competition by listing your experience as accomplishmentsrather than a list of duties. Adapt the S.T.A.R.T. technique described on page 47 tohelp you write key statements about yourself that can be bullets on your resume or part ofyour introduction. Write a few sentences for each category, then reduce to a concise jobfunction description. See Resume Samples on pages 18 to 31 for ideas.14 University of California, Davis

ResumesPurposeYour resume is a concise summary of your education,experience, skills and accomplishments. The resume is amarketing tool to entice your reader to invite you to aninterview! Employers are looking for well-rounded applicantsin these areas: academic, work accomplishments and interests/activities. Incorporating these three categories into your resumewill demonstrate your overall accomplishments. There is no oneperfect resume or resume format.General Resume Guidelines• One page for recent graduates; two pages if you haveextensive work history. Do not include more than 10+ yearson your resume.• Direct the reader’s eye using layout/headings.• Proofread! No typographical, spelling or grammatical errors.Don’t rely on spell-check.• Tailor contents to each job/application.• List information in reverse chronological order.• Sell yourself—be selective about what you include andorganize information logically.• Use consistent verb tense—use either past or present.• Some job boards and employer sites ask you to upload atext version of your resume. see page 27Exceptions• Online resume• Federal resume• International resume (other countries may follow differentformats)• Curriculum Vitae see pages 32-35• Resumes that highlight ample relevant experience or morethan 5-10 years of related experiencePlease seek advice from the ICC staff to help determine theresume format and/or length that is right for you.Let’s Get Started!1. List accomplishments.2. Analyze job description—highlight the most importantskills and qualifications and incorporate these keywordsinto the resume.Resume Tips for Specific FieldsArts and Communication• Portfolios/work samples are often required and should benoted on resume. If you have an online portfolio, include alink in your resume heading.• Graphics are invited in this field and will be seen as ademonstration of your creativity.• It’s OK to translate your internships into job titles that accuratelydescribe your duties, e.g., Public Relations Assistant.• For journalism opportunities, include fluency in other languages.Business• In most cases “management” isn’t a very realistic objective.Focus on a particular area—finance, marketing, humanresources—and express long-term interest in management.• Business employers are interested in results. Be sure yourresume highlights specific achievements, times when youexceeded goals, etc.• Quantify your experience: “Increased sales by 30%.” Showaccomplishments in previous experience.• Stress tangible leadership experience when listingextracurricular involvement.• List transferable skills such as time management, conflictresolution and decision making.Human Services• For many of these occupations, experience as a volunteeris considered a strong measure of knowledge and commitment.List key responsibilities and outcomes.• For teaching jobs, experience you had working with youngpeople and any tutoring/teaching experience are important.Life Sciences/Physical Sciences• Research and lab techniques should be listed for jobs inthese fields. List scientific techniques you are most familiarwith or have recently used.• Since the employer will be looking for certain majors, youreducation should be near the top of your resume.• Healthcare jobs place a strong emphasis upon communicationskills, including bilingual ability.• Include science organization memberships.Technology• Employers in this field prefer objectives that are precise,indicating a particular area of interest or expertise.• Include technical courses/projects to support interest andobjective.• GPA should be included.• Break technical skills into subcategories. This will make iteasier for the reader to pick up the specific skills they arelooking for (i.e., Operating Systems, Hardware, Software,Networking and Programming Languages).• Be sure your resume is loaded with keywords denotingskills. Have a text version of your resume for sitesrequesting this format.• Including both technical and non-technical work experiencedemonstrates experience working in professionalsettings.Adapted from UCSD Career Services CenterResumes and Correspondenceicc.ucdavis.edu 15

Resume ContentContent Essentials HintsThese components are ESSENTIAL for EVERY resume.Contact InformationEducationRelevant ExperienceName, address, phone number, email and webaddress you would like employers to see.Name of school, degree earned, major and minor,expected graduation date and depending on thefield, GPA. Samples starting on page 18.Job title, company name, dates of experience,describe job duties, significant accomplishmentsand contributions. You can include volunteer orleadership experience related to your objective.Make sure email address, phone number andwebpage are “employer appropriate” and typo-free.List your highest degree first followed by otherdegrees you have received. List Education Abroad.Include paid and non-paid positions, internshipsand military duty. Present achievements, contributionsand results.The following categories are usually included on a resume—include the categories that best describe your skills andexperience.ObjectiveA one-line description of position desired. Includejob title and company name only.Should be specific rather than a general statement.Can be omitted in some situations—see ICC stafffor more information.Skills/AbilitiesIdentify skills the employer is looking for. Theymay be grouped by category such as:• language,• laboratory, or• computer skillsList only the skills you can perform with little orno supervision. Think about “Transferable Skills”see page 14.Resumes and CorrespondenceGroup/Class Projects/Relevant CourseworkHonors and AwardsTravelResearch/PublicationsVolunteer Activities/Community Service/LeadershipRelevant classes and/or projects.Current students or recent grads can includehonors and scholarships. Be sure to include adescription.List countries and travel experiences, if relevant tothe position for which you are applying.Project title, where published and when.Undergrads—List roles as Research Assistant,name the lab, project or techniques.List organization, office(s) held and a briefdescription of accomplishments.List the course title, not the course number.Can be listed separately or as asubsection under Education.See pages 31 and 32 for format samples.May want to place internship positions underExperience section.Certifications/LicensesList if applicable to the position for which you areapplying and if current.Add date issued or future expiration date. Writeout abbreviations.ReferencesYou do NOT need to end your resume with “References Available Upon Request”.Employers know you have references for them. Use the extra space to expand on youraccomplishments.Always bring a typed list of your references and their contact information to interviews.See page 41 for specific information.16 University of California, Davis

Verb List for Resumes & LettersUse strong actions verbs to describe your experience and skills. Choose words from the lists below to express yourself.Management SkillsadministeredanalyzedassignedattainedchairedconsolidatedcontractedcoordinateddelegateddevelopeddirectedevaluatedexecutedimprovedincreasedorganizedoversawplannedprioritizedproducedrecommendedreviewedscheduledstrengthenedsupervisedCommunication SkillsaddressedarbitratedauthoredcollaboratedconvincedcorrespondeddraftededitedformulatedinfluencedinterpretedlecturedmediatedmoderatednegotiatedpersuadedpromotedpublicizedspoketranslatedwroteResearch/Analytical SkillsanalyzedclarifiedcollectedcritiqueddiagnosedevaluatedexaminedextractedidentifiedinspectedinterpretedinterviewedinvestigatedorganizedreviewedsummarizedsurveyedsystematizedTechnical SkillsassembledbuiltcalculatedcomputeddesigneddevisedengineeredfabricatedmaintainedoperatedoverhauledprogrammedremodeledrepairedsolvedupgradedTeaching Skillsadaptedadvisedclarifiedcoachedcommunicateddevelopedenabledencouragedevaluatedexplainedfacilitatedguidedinformedinstructedset goalsstimulatedtrainedFinancial SkillsadministeredallocatedanalyzedappraisedauditedbalancedbudgetedcalculatedcomputeddevelopedforecastedmanagedmarketedplannedprojectedresearchedCreative SkillsactedconceptualizedcreatedcustomizeddesigneddevelopeddirectedestablishedfashionedillustratedinitiatedinstitutedintegratedintroducedinventedoriginatedperformedplannedrevitalizedshapedHelping SkillsassessedassistedclarifiedcoachedcounseleddemonstrateddiagnosededucatedfacilitatedfamiliarizedguidedmotivatedreferredrehabilitatedrepresentedvalidatedAdministrative orOrganizational SkillsapprovedarrangedcataloguedclassifiedcollectedcompileddispatchedexecutedgeneratedimplementedinspectedmonitoredoperatedorganizedpreparedprocessedpurchasedrecordedretrievedscreenedspecifiedsystematizedtabulatedLeadershipachievedcoordinateddelegateddevelopeddirectedenlistedexecutedexpandedexpeditedfoundedimprovedinitiatedpioneeredrecruitedreduced (losses)resolved (problems)restoredspearheadedtransformedAdapted from The Damn GoodResume Guide by Yana Parker,Berkeley: Ten Speed Press.Resumes and Correspondenceicc.ucdavis.edu 17

Freshman ResumeEmma DacuyanCampus Address:Permanent Address:My Dorm Room12345 Elm StreetTercero Hall Any Town, CA 94567Davis, CA 95616(555)321-456xEmail: ejdxxxxxan@ucdavis.eduOBJECTIVE Work study job that will combine my interpersonal and writing skillsEDUCATIONUniversity of California, DavisBachelor Degree, Major not yet declared, Expected June 2017Coursework related to position:Beginning Composition, Children in the Garden (Enrolled Spring 2013)Resumes and CorrespondenceSKILLSComputer: Proficient in Word, use of Internet search engines, Outlook and email in bothPC and Mac environmentsLanguage: Fluent in spoken Tagalog (minimal written ability)Character Traits: Punctual, attentive to detail, organized, cooperative, patientEXPERIENCEReceptionist, T & T Electronics, Any Town, CA 6/12-8/12Created a welcoming atmosphere for mid-sized manufacturing firm. Used proactivecommunication to effectively manage Outlook calendars for four busy sales people. Keptoffice clean and organized. Ensured packages were mailed in a timely manner using themost cost effective carrier for the transaction.Child Care Provider, Self Employed, Any Town, CA 6/12-PresentProvide safe, reliable care for children (infant to12 years) in their homes. Effectively adaptcommunication style and planned activities to meet the developmental needs of childrenand create a positive experience. Partnered with parents to ensure consistency and clearboundaries with children. Rapport building and reliability resulted in extensive referrals.ACTIVITIES• Member, UC Davis Intramural Volleyball, 9/13-Present• Member, Any Town High School Marching Band, 8/10-11/13You can use just one address—usually just the address closest to where you are seeking a job. See page 19 or page 24 for samples.18 University of California, Davis

Chronological Format for Internship PositionJamar Jacksonjjackson@ucdavis.edu123 Clover Lane, Any City, California 9XXXX. (555) 421-XXXXOBJECTIVEA laboratory research internship with ABC Company.EDUCATIONBachelor of Science in Biological Sciences, June 20XXUniversity of California, DavisRelated Course Work: General Chemistry (Lab), Microbiology (Lab)Organic Chemistry (Lab), Zoology (Lab), BiologySKILLS• Familiar with buffer preparation, microscopy, pH meter, and analytical balances.• Excellent ability to accurately keep laboratory records.• Experience using Microsoft Word, Excel and Access in PC and Mac platforms.SPECIAL PROJECTIodine Shortage Project, UC Davis, Davis, CA1/XX-presentWorked with a group of seven students raising over $10,000 to help the current iodine shortagein Indonesia. Raised funds for research, iodine distribution and literature. Researched the effectsof iodine deficiency and developed promotional materials including posters and flyers for in-classpresentations. Raised funds through classes, friends and on-campus activities, including numerouspresentations to sororities and fraternities.EXPERIENCEShift Leader, In-N-Out Burger, Davis, CA10/XX-present• Provided outstanding customer service and handled customer complaints.• Acted as cashier; entrusted by supervisor to record and deliver bank deposits.• Trained and supervised ten staff members. Provided input for new hireperformance reviews and identified areas for additional training.• Maintained accurate inventory count of all products.• Ensured proper food sanitation procedures were followedby strictly adhering to all food handling safety protocols.No need to mentionwhether a position is paidor voluntary.Resumes and CorrespondenceACTIVITIESVolunteer, Yolo County SPCA, Davis, CA, 4/XX-6/XXActivities Coordinator, Black Student Union, UC Davis, 9/XX-presentMember, Biological Sciences Club, UC Davis, 9/XX-presenticc.ucdavis.edu 19

Laboratory Research AssistantJob Landis123 Maple Avenue • Davis, CA 95000 • 530-555-5555 • xxxx@ucdavis.eduOBJECTIVEA position as a Laboratory Research AssistantEDUCATIONBachelor of Science in Biological Sciences, University of California, DavisAnticipated Graduation date June 20XXRELEVANT COURSEWORKMolecular and Cellular Biology (Lab) Pathology Organic Chemistry (Lab)Neurobiology Microbiology Chemistry (Lab)LABORATORY SKILLSSDS-PAGE PCR/cloning ELISAGas chromatography UV/VIS Spectrophotometry Computer data analysisMicroscopy DNA extraction/quantification Amino acid analysisResumes and CorrespondenceSUMMARY OF QUALIFICATIONS• Familiar with fundamental lab procedures including pipetting, buffer preparation and SDS-PAGE• Intelligent, analytical and highly motivated; ability to multitask, attentive to details• Excellent communication skills; dedicated to professionalism and high-quality work• PC skills: Word, Excel, PowerPoint, Access• Fully fluent both orally and written in English and SpanishEXPERIENCEClinical Pathology Intern, Department of Clinical Pathology, UC Davis 5/XX-9/XX• Developed a buffer system for liquid chromatographic isolation of pesticide metabolites in urine• Accurately performed gas chromatography on purified samples• Recognized by supervisor for outstanding contributions to successful research project completionTeam Lead, Best Burgers, Davis, CA6/XX-9/XX, 6/XX-9/XX• Placed orders and performed cashiering duties in high-volume fast food establishment• Suggested new method of packaging orders which reduced customer wait time by approximately50%• Promoted to Team Lead after 60 daysACTIVITIES/LEADERSHIPPresident, Biological Sciences Club, UC Davis, 9/XX-presentSwimming, Intramural basketballCOMMUNITY SERVICEMember, Society for Prevention of Cruelty to Animals, 9//XX-6/XXParticipant, Habitat for Humanity, Summer 201220 University of California, Davis

Chronological Format for Career PositionA chronological resume presents your education and work experience in a straightforward, reverse chronological order format,listing your current or most recent job first. If the majority of your work experience is related to your stated job objective, thechronological format is generally preferred.ANH NGUYENSan Francisco, CA 94121 • 530-555-1212 • anguyen@ucdavis.eduOBJECTIVEA career position in sales and marketing at Dream Job International Co.EDUCATIONBachelor of Science in Managerial Economics with a minor in CommunicationUniversity of California, Davis, June 20XXCarlos University, Education Abroad Program, Madrid, Spain, Summer 20XXSKILLSComputer: Proficient in MS Word, Excel, email and Internet Explorer in PC and Macenvironments.Language: Fluent in Vietnamese, Conversational Spanish (spoken).Communication: Able to write clearly and convincingly and give public presentations to largegroups.RELEVANT EXPERIENCEMarketing/Sales Intern, Progressive Microproducts, Sacramento, CA (6/XX–Present)Market personal computer hardware and software. Develop and implement marketing andadvertising strategies. Design and develop educational and entertainment software for Applecomputer system. Participate in numerous computer trade shows hosting more than 3,000 visitorsand more than 150 vendors.Management Trainee/Salesperson, Grand Auto, Inc., Davis, CA (5/XX–9/XX)Performed sales work for auto parts store with annual sales exceeding $35 million. Workedeffectively with customers and employees. Maintained a large store inventory using acomputerized inventory system. Supervised and trained a sales force of 34 representatives.Implemented parts department reorganization for enhanced work flow. Developed effectivein-store and window displays.Salesperson, Consumer Distributing Company, Woodland, CA (9/XX–4/XX)Performed general merchandise sales for large catalog chain store. Processed over $10,000 perweek in cash, checks and credit cards, performed inventory control, and completed clerical tasks.Received quarterly awards for sales performance.Resumes and CorrespondenceLEADERSHIPFundraising Chairperson, Member, Delta Sigma Pi, a business fraternity (dates)Member, Vietnamese Student Association (dates)View Anh Nguyen’s online resume on page 27 and functional resume on page 22.icc.ucdavis.edu 21

Functional Format for Career PositionA functional resume concentrates on skills you have demonstrated that relate to your stated objective rather than on the jobs youhave held. This format is particularly effective if your past work experience is not directly related to your job objective, if you arechanging careers or if you are seeking a promotion. Choose broad skill categories appropriate to the desired job and detail how youhave demonstrated those same skills in past positions/jobs.This type ofobjective isexcellent forcareer fairs.ANH NGUYENXXX Green StreetSan Francisco, CA 12345(415) 48X-XXXXanguyen@ucdavis.edulinkedin.com/in/anhnguyenOBJECTIVEA career position in sales and marketingEDUCATION Bachelor of Science in Managerial Economics with a minor in CommunicationsUniversity of California, Davis, June 20XXCarlos University, Education Abroad Program, Madrid, Spain, Summer 20XXSUMMARY OF QUALIFICATIONS• Three years increased responsibility in sales• Extensive and up-to-date knowledge of the computer software industry• Received awards for sales performance• Proficient in Word, Excel, email and Internet Explorer in PC and Mac environments• Fluent in Vietnamese, Conversational Spanish (spoken)Resumes and CorrespondenceMarketing/Sales• Marketed personal computer hardware and software• Developed and implemented marketing and advertising strategies• Performed sales work for auto parts chain store with annual sales exceeding $35 million• Recognized for impressive sales record and received quarterly awards for outstanding performance• Performed general merchandise sales for large catalog sales store• Participated in numerous computer trade showsOrganization/Planning• Designed and developed educational and entertainment software for Apple computer system• Implemented parts department reorganization for enhanced work flow• Developed effective in-store and window displaysCommunication Skills• Communicated effectively with customers and employees• Revised policy manuals and developed curricula for training sessions• Supervised and trained sales team of 34• Gave presentations to groups of 150 or more peopleEMPLOYMENT HISTORYMarketing/Sales Intern, Progressive Microproducts, Sacramento, CA, 6/XX–PresentManagement Trainee/Salesperson, Grand Auto, Inc., Davis, CA, 5/XX–9/XXSalesperson, Consumers Distributing Company, Woodland, CA, 9/XX–4/XXACTIVITIESFundraising Chairperson, Member, Delta Sigma Pi, a business fraternity, 9/XX–PresentMember, Vietnamese Student Association, 9/XX–6/XXView Anh Nguyen’s online resume on page 27 and chronological resume on page 21.22 University of California, Davis

Chronological Format for Entry-Level Career PositionThe resume below uses a chronological format. Your resume should represent you. Be sure to have your resume draft critiqued by anICC staff member.1A specific objective ishighly recommended.However, a moregeneral objective ornone at all can beused at career fairs.AUDREY KIM1122 Aggie Avenue • Apt, # 33 • Davis, CA 95616(530) 757-XXXX • (415) 48X-XXXXakim@ucdavis.edu2This is a sub-categoryof EDUCATION.The title should bebold, lower case, andindented.OBJECTIVEEDUCATIONEnvironmental Planner position with XYZ ConsultingBachelor of Science, Environmental Policy Analysis and PlanningBachelor of Arts, CommunicationUniversity of California Davis, June 20XX13If you have performedthe protocol severaltimes you maylist your ability toperform proceduresused in a lab as“adept at,” “proficientin” or other accurateterms.SKILLS2Related Course Work:Environmental Impact Reporting using GIS, Urban and RegionalPlanning, Environmental Law, Water Policy and Politics, UrbanGeographyFamiliar with CEQA, NEPA and CWAWorking knowledge of environmental impact assessments 3Proficient in applications of Microsoft Office Suite, ERSI and ArcGISExcellent writing and editing skills♦ Double majorsindicate: “DoubleMajor in ___and ___” or state“Bachelor of Artsin ___, Bachelorof Science in___.”EXPERIENCEPlanning Intern, Sacramento County Planning and CommunityDevelopment Department, Sacramento, CA 10/XX - 3/XXCreated database of employment and housing for Sacramento County.Conducted jobs/housing balance study as directed by the General Plan.National Network of Environmental Management Studies Fellow,U.S. Environmental Protection Agency, Philadelphia, PA 6/XX - 9/XXReviewed and provided comments on Environmental Impactstatements. Formulated plan to coordinate Geographic InformationSystem data among different federal agencies. Participated insignificant public outreach efforts.Environmental Education Intern, Student Landowner Education andWatershed Stewardship Program (SLEWS), Davis, CA 1/XX - 4/XXPlanned and led high school students in agricultural and streamcorridor restoration projects. Researched and taught students aboutnative species interaction and local ecosystem sensitivity. Designed,constructed and maintained composting piles for on-site teachingpurposes.Resumes and CorrespondenceACTIVITIESStudent Member, Association of Environmental Professionals, 20XX - presentStudent Member, American Planning Association, 20XX - presentVolunteer, Focus the Nation, UC Davis, January 20XXVolunteer, Whole Earth Festival, May 20XXView Audrey Kim’s cover letter on page 38 and her list of references on page 41.icc.ucdavis.edu 23

Combination Format for Research PositionThe combination chronological/functional resume uses elements of both styles. The qualifications (areas of effectiveness) of thefunctional resume remain within specific job/experience descriptions. The jobs/experiences are then grouped and categorized toshow the strengths in two to four categories. This resume format is effective if at least some of your experience is related to the jobobjective, and also when the job objective has more than one component and you have experience in these different components(e.g., technical and management; sales and organizational).MARIA GARCIAFairfield, CA 95555 • mgarcia@ucdavis.edu530-752-1212 • linkedin.com/in/MarciaGarcia24OBJECTIVEResearch position in biochemistry laboratory.EDUCATIONBachelor of Science in BiochemistryUniversity of California, DavisDegree expected December, 20XXSKILLSProtocol design for proteolytic digestsGas chromatographyHPLCAbility to keep accurate laboratory recordsSDS-PAGEUV/VIS SpectrophotometryComputer data analysisLaboratory animal handlingResumes and CorrespondenceRESEARCH EXPERIENCEProtein Biochemistry Intern, Genentech, Inc., San Francisco, CA. (June to September 20XX)Investigated structure-function relationships of interferon. Experiments included the use of limitedproteolitic digests, SDS-PAGE, and HPLC.Clinical Pathology Intern, Department of Clinical Pathology, University of California, Davis.(March to June 20XX)Developed buffer system for liquid chromatographic isolation of pesticide metabolites in urine.Performed gas chromatography on purified samples.LABORATORY ANIMAL HANDLING EXPERIENCELaboratory Helper, Animal Science Department, University of California, Davis. (May to July 20XX)Maintained murine colony used for transgenic experiments.POSITION HELD TO FINANCE EDUCATIONSalesperson, Macy’s, Sacramento, CA. (May to September 20XX)Provided customer service, engaged in sales transactions, public relations, inventory control andbalanced cash register receipts.ACTIVITIESPresident, Member, Biochemistry ClubMember, Chicanos/Latinos in Health EducationSwimming, intramural basketball24 University of California, Davis

International ExperienceThe skills you gain from going abroad or working internationally can give you a competitive edge. Below is an exmple of how tohighlight your international experience and skills gained.MOHAMED SINGH(530) 555-5555Mohamed.Singh@ucdavis.eduOBJECTIVE: Foreign Service Officer position with U.S. Department of State.EDUCATIONBachelor of Arts, International Relations and French double major, Degrees expected June 20XXUniversity of California, Davis GPA: 3.23/4.00Study Abroad, University of Lyon II and l’Institut d’Etudes Politques—Lyon, France, 9/20XX – 6/20XXYou canuse theskillssectionto alsodescribetraits.SKILLSComputer: Advanced proficiency in Word, Excel, PageMaker, email and Internet applications,Proficiency in PowerPoint, Familiar with PCs and MACs, Experience with LoanQuest loanprocessing software and OMS web-based billing database.Languages: Professional fluency in written and oral French, Conversant in Farsi (limited writtenability), Elementary knowledge of written and oral Spanish.Character Traits: Excellent interpersonal communication skills, strong writing aptitude, confident, workwell in teams, culturally aware, sociable, leadership competent, teachable, and honest.RELEVANT EXPERIENCEIntern, State Senate Office of International Relations, Sacramento, CA (9/20XX – 1/20XX)Attended official meetings weekly between foreign dignitaries and Senators or Senate staff.Communicated with Senate staff and Capitol staff to arrange meetings for incoming internationaldelegates. Performed open source research on foreign countries and summarize pertinentinformation for outgoing delegations. Wrote correspondence (letters, emails, faxes) on behalfof Senators and the Office of International Relations to Consulates, US embassies, and foreigngovernments. Compiled variety of reports and data into Excel and Word applications forpublication in Senate Office of International Relations Annual Report.Billing Manager, CAL Internet Services, Inc., San José, CA (6/20XX – 7/20XX)Used interpersonal communication skills to effectively network at business fairs resulting inincreased contacts and sales. Managed billing using OMS web-based billing database. Patientlyprovided tech support to non-technical clients ensuring customer satisfaction and increased sales.Participated in sales and marketing. Drafted official company correspondences in Word.Caller, UC Davis Annual Fund, Davis, CA (7/20XX – 9/20XX)Contacted UC Davis alumni and parents via telephone to promote continued relationships withuniversity. Fostered positive image of UCD by implementing professional and sincere dialogue.Encouraged and solicited financial support. Conducted campaign for donations between$100-$1,000.Resumes and CorrespondenceCashier, ASUCD Coffee House, Davis, CA (9/20XX – 7/20XX)Worked for on-campus food service venue that serves more than 4,000 meals per day; providedcustomer service during busiest shifts. Effectively communicated with coworkers to ensure smoothoperations and welcoming atmosphere.ACTIVITIES/INTERESTSCaptain, Men’s Novice Curling Team, UC Davis (10/20XX – 6/20XX)icc.ucdavis.edu 25

TechnicalWe use this term to describe a resume that is used to apply for positions in information technology, engineering or consulting.Though the format is similar to other examples in the book we include it to demonstrate ways in which technical skills canbe presented.Victoria Buleonvbuleon@gmail.com2350 Main StreetDavis, CA 95676Mobile: (530) 759-1957OBJECTIVE:A full-time software engineering positionEDUCATION:Bachelor of Science, Computer Science and EngineeringUniversity of California, DavisGPA: 3.2/4.0Expected Graduation June 20XXCOMPUTER SKILLS:Software: BASIC, C, C++, C#, Java, Python, HTML, Perl, Visual Basic, SQL, MATLAB, MicrosoftOffice, Adobe PhotoshopOperating Systems: DOS, Windows, Macintosh, UNIX, LinuxResumes and CorrespondenceEXPERIENCE:Software Development Intern, Hewlett-Packard, Palo Alto, CA, June 20XX-September 20XX• Designed a customized central webpage of web tools using Active Server Pages and DigitalDashboard• Evaluated a virtual collaboration tool used by an engineering division• Built a prototype in Visual Basic of the next-generation instant messaging softwareIT Intern, Caltrans, June 20XX-September 20XX• Tested a web-based application used by the unit• Redesigned departmental Word template pages utilized• Provided phone and email support for a web-based computer training program• Created web pages using Active Server Pages for automating the registrationPROJECT:Microsoft Hackathon, UC Davis, September 20XX-Present• Created a game application on the Windows Phone platform using C#• Learned and built a prototype using Visual Studio and XNA Framework• Worked in a team of two to design and conceptualize ideas and gameplay• Rendered and illustrated character sprites and graphics using Adobe PhotoshopASSOCIATIONS:Filipino Americans in Science and EngineeringPresident (20XX-20XX), Website Programmer (20XX-Present), Secretary (20XX-20XX)Computer Science Club, December 20XX-PresentTau Beta Pi National Engineering Honors Society, July 20XX-Present26 University of California, Davis

Online ResumesHow to Make the CutMany websites will accept Word documents but some request that you cut and paste a text version of your resume (see examplebelow). Resumes submitted online frequently get imported into a database known as an Applicant Tracking System (ATS) orHiring Management System. This includes resumes posted to employer sites and Internet resume banks. Many of these resumesystems require a text version of your resume. The text version is designed to be read by a computer and eventually screened byhuman readers. Your resume will usually not be seen unless it has been retrieved from the database using keyword searching techniques.Format is minimal with no tabs, bold, bullets, etc. All lines are left justified.ANH NGUYENXXX Green StreetSan Francisco, CA 12345(415) 48X-XXXXanguyen@ucdavis.eduOBJECTIVEA career position in sales and marketingKeywordsThe more keywords your resume contains,the better chance of it being extracted fromthe ATS and given a higher ranking to becalled for an interview. Keywords fall intothe following categories: job titles, skills andexperience, industry buzzwords and jargon,work style traits and personal qualities.EDUCATIONBachelor of Science in Managerial Economics with a minor in Communication,University of California, Davis, June 20XXCarlos University, Education Abroad Program, Madrid, Spain, Summer 20XXSKILLSaComputer: Proficient in MS Word, Excel, email and Internet Explorer in PC and Macenvironments.Language: Fluent in Vietnamese, Conversational Spanish (spoken).Communication: Able to write clearly and convincingly and give public presentationsto large groups.RELEVANT EXPERIENCEMarketing/Sales Intern, Progressive Microproducts, Sacramento, CA (6/XX-Present)Market personal computer hardware and software. Develop and implement marketingand advertising strategies. Design and develop educational and entertainmentsoftware for Apple computer system. Participate in numerous computer trade showshosting more than 3,000 visitors and more than 150 vendors.Management Trainee/Salesperson, Grand Auto, Inc., Davis, CA (5/XX-9/XX)Performed sales work for auto parts store with annual sales exceeding $35 million.Worked effectively with customers and employees. Maintained a large store inventoryusing a computerized inventory system. Supervised and trained sales force of 34representatives. Implemented parts department reorganization for enhanced workflow. Developed effective in-store and window displays.Resumes and CorrespondenceSalesperson, Consumer Distributing Company, Woodland, CA (9/XX-4/XX)Performed general merchandise sales for large catalog chain store. Processed over$10,000 per week in cash, checks and credit cards, performed inventory control, andcompleted clerical tasks. Received quarterly awards for sales performance.LEADERSHIPFundraising Chairperson, Member, Delta Sigma Pi, a business fraternity (dates)Member, Vietnamese Student Association (dates)icc.ucdavis.edu 27

Advanced Degree Resume vs.Curriculum Vitae (CV)Resumes and CorrespondenceCurriculum Vitae (CV) is Latin for “course of life”. Incontrast, a Resume (also resumé or résumé) is Frenchand means “summary”. The CV is also often informallycalled a “vita”. Both are used in job applications and tailored tothe specific position.Both CV & Resume:• Represents you as the best qualified candidate• Gets you an interviewCV: presents a full history of your academic credentials solength is variable.Resume: presents a concise picture of your skills and qualificationsfor that specific position so length is prescribed by yearsof experience, but generally no more than two pages.Many European countries use “CV” to describe all job applicationdocuments and do not use the term resume. Graduateschool applications will request a CV, but in general are lookingfor a Resume that includes any publications and descriptions ofresearch projects.In the U.S., CV or Resume may be used interchangeably. Ifyou are not sure which document they want in the applicationpacket, it is best to ask.Resume vs CV• Emphasizes skills• Used when applying fora position in industry,non-profit, and publicsector• Is no longer than 2pages, with an additionalpage for publicationsand/or poster presentationsif highly relevant tothe job• Does not usually includepersonal interests• After 1 year of industryexperience, may leadwith work experienceand position educationsection at or near theend, depending uponqualifications• Emphasizes academicaccomplishments• Used when applying forpositions in academia,fellowships and grants• Length depends uponexperience and includesa complete list of publications,posters, andpresentations• Does not usually includepersonal interests• Always begins witheducation and caninclude name of advisorand dissertation title orsummary (see examples)• Also used for merit/tenure review andsabbatical leaveCurriculum Vitae Tips and SuggestionsA CV is used when applying for:• Academic positions in a four year University, StateUniversity, Community College, or Liberal Arts College• Fellowships & scholarships• Research funding & grantsAlthough largely the same format for all academic positions,there is some variation and a difference on emphasis for a CVdepending on the type of institution applying for (e.g., communitycollege vs. four-year university).A CV for a community college—which emphasizes teachingability, pedagogical training and qualifications as a generalist—will lead with teaching experience and include all the coursestaught, details on the role played as a teaching assistant, andmay include content description, class size, lab set up, etc. Aresearch section may follow, but with limited detail.A CV for a state college, which emphasizes a balanceof teaching and research, will place equal emphasis on theresearch and teaching sections.A CV for a four-year university—which values scholarlyproductivity, research experience, technical expertise, grantwriting and collaboration potential—will emphasize theresearch with a less prominent section on teaching experience.Things to Consider for Both CVs and ResumesTailor either your Resume or CV to fit the mission, focus,goals or guidelines established by the institution, research organizationor job description.If you are applying for both academic as well as industry(public or private sector) positions, prepare both a Resume andCV.Spell check. Note that words with all capital letters do notauto-spell check. Error free is optimal.When applying for a position, unless specifically requestednot to do so, always include a cover letter, even if a coverletter is not requested. If only one document can be uploadedfor an online application, you can combine your cover letterwith your CV or Resume into one PDF and submit them bothtogether as a single document.CVs for undergraduates completing a BS/BA andapplying to graduate school:When applying to graduate school, the applicationinstructions may request that a CV be included in yourapplication packet.Check with your department to be sure, but in generalthis request is not for a full CV, but rather a more comprehensiveResume.The graduate school application CV will still be nolonger than 2 pages.Items to include on the graduate school CV might be, ifapplicable:• Descriptions of projects worked on• Presentations, posters presented or publications• Teaching assistantships• Academic service such as mentoring, leadership oncommittees28 University of California, Davis

Advanced Degree ResumeChronological FormatAdvanced D. Graduate1234 Spring Street Davis, California 95616(530) 555-2230 adgraduate@ucdavis.eduhttp://www.linkedin.com/in/advancedgraduate(OPTIONAL) OBJECTIVE: Project Manger, General Electric Power SystemsMechanical Engineering Ph.D. (June 20XX) with 4 years industry experience in project management, strategic planning,research and development. Expertise in power systems and distributed grid infrastructure. Management and trainingexperience in production and use of technology for engineers and customers. Interested in globalization and internationalissues. Additional skills include:• SolidWorks (CAD)• COMSOL (FEM/FEA)• MS Office Suite and database• Labview• Matlab• Vibration test/analysis• L-edit (CAD)• Mathcad• Extensive analytical skills• Excellent oral & writtencommunication• Speak basic GermanEDUCATIONPh.D. in Mechanical Engineering – University of California, Davis, June 20XXMaster of Business Administration in Finance & International Management – University of California, Davis, June 20XXBachelor of Science in Mechanical Engineering – University of California, Davis, June 20XXPROFESSIONAL EXPERIENCEManager, Business DevelopmentAnuvu, Inc. – Sacramento, CaliforniaSeptember 20XX-present• Managed technological/financial development of PEM hydrogen fuel cell applications in power systems.• Created complex engineering models and financial programs for technology/investment valuation.• Presented grid infrastructure engineering/financial model to domestic and foreign business partners.• Wrote business plan for a $4.5 M OEM hydrogen fuel cell contract.• Negotiated contract for product testing and integration with OEM partner and State Testing Group.• Developed network and relationship with OEM customers.Research and Development EngineerMedtronic Vascular, Inc. – Santa Rosa, CaliforniaJune 20XX-September 20XX• Patented mechanical design of device and led project from inception to successful international clinical use.• Developed processes, equipment, and trained personnel for market release of medical device product lines.• Managed production line and personnel while creating and fabricating support tooling and equipment.• Coordinated joint R&D/Manufacturing efforts to effectively meet company production deadlines.• Wrote procedures for processes and data collection for GMP and ISO-900X quality systems.Total Quality Manager – InternHunter Innovations Inc. – Sacramento, CaliforniaJune 20XX-December 20XX• Organized and led training of Hunter Associates in Quality Control and GMP systems.• Wrote and implemented Good Manufacturing Practice (GMP) System for FDA regulatory approval of artificialhip joint implant sales and manufacturing.• Designed and programmed components of CNC lathe and mill manufacturing resulting in sales estimated at$10,000/month for these components.Resumes and CorrespondenceProject Engineer – InternAmes Co./Fluid Control Systems – Woodland, CaliforniaJune 20XX-September 20XX• Leader of “Introduction to Production” team and responsible for vendor communications.• Created and maintained engineering documentation, bill of materials, and bill of operations.• Researched and designed prototype backflow check valves and led pilot production.PATENTS/PUBLICATIONSList patents and publications herePROFESSIONAL AFFILIATIONS/COMMUNITY SERVICEInstitute of Industrial Engineering - Engineers Without BordersNote: add a footer with your last name, page 2 of Xicc.ucdavis.edu 29

Advanced Degree Resume—Chronological FormatE. S. Bowman Page 2Home Garden Manager, June 20xx-July 20xxCommunity Food Bank, Tucson, Arizona• Management and supervisory roles, involving gardening assistance, budget management,community outreach and program design.• Created and managed database to track department’s activities and identify areas for growth.• Conducted outreach and coordination with other Tucson non-profits on communitydevelopment projects.Erin S. Bowman555 Fifth Street, Davis, CA 95616(555) 555-5555es.bowman@gmail.com • www.linkedin.com/in/es.bowman(OPTIONAL) Objective: Evaluation Coordinator – Research Specialist, Child Care Study (#1234)30 University of California, DavisHome Garden Coordinator, September 20xx-August 20xxCommunity Food Bank, Tucson, Arizona• Taught vegetable gardening skills to fifty low-income families through at-home assistance.• Designed and taught popular education style gardening workshops in English and Spanish.Community Development Master’s Candidate (August 20xx) with six years’ experience innon-profit program management, including evaluation, research and program design. Expertise inqualitative research design and database creation.• Fluent in Spanish• MS Office Suite, including Word, Access and Excel• Excellent writing skills• Courses in qualitative and quantitative research methods• Exceptional project management skills• Clear communicator and collaboratorCommunity Organizer, September 20xx-August 20xxBorder Action Network (BAN), Tucson, Arizona• Led successful outreach campaign on border issues in Latino immigrant neighborhoods inTucson’s south side.• Launched membership drive, resulting in 500 new members.• Initiated campaign on immigration reform geared at key members of the ArizonaCongressional delegation.Awards And CertificationsCommunity Service Award, 20xxUC Davis Community Service Resource Center, Davis, CaliforniaEducationMaster of Science, Community and Regional Development, expected August 20xxUniversity of California, DavisRelevant Coursework: Intermediate Social Statistics, Field Research, Professional Skills forCommunity Development, Qualitative Research Methods, Participatory Action ResearchBachelor of Science, Sociology, June 20xxEastern Mennonite UniversityTravel Grant of $500, 20xxUC Davis Internship & Career Center, Davis, CaliforniaCertificate in Teaching Excellence, 20xxCenter for Excellence in Teaching and Learning, UC Davis…Additional categories could include:Professional ExperienceGraduate Student Researcher, July 20xx-presentUC Sustainable Agriculture Research and Education Program, Davis, California• Conducted evaluation of local non-profit organization’s two-year USDA Community FoodProject grant.• Designed and implemented surveys and interviews of project participants.• Synthesized data and completed annual and final reports of grant progress.• Maintained positive relationship with the grantee organization to ensure expectations werebeing met and evaluation tools were satisfactory.• Edited final report and verified data accuracy for an assessment of San Diego County’s foodsystem.Community ServiceInternational Work ExperienceAffiliationsKey Accomplishments (brief description of 2 or 3, best placedafter skills section and before education)Graduate Student Researcher, August 20xx-June 20xxUC Davis Center for Regional Change, Davis, CaliforniaProject: Healthy Youth/Healthy Regions is a multi-disciplinary research project investigating thelink between youth well-being and prosperity in the Sacramento region.• Researched and wrote first draft of introductory chapter for Healthy Youth/Healthy Regionsfinal report, which set the scene for the final report by highlighting the strengths and inequitiesin the region.

Advanced Degree Resume—Chronological FormatWhen using a resume to apply to a research-based industry position, publications and poster/presentations may be included on a 3rd page. If lengthy, use only those that are relevant tothe position. For additional advanced degree resumes please visit http://iccweb.ucdavis.edu/graduates.PAT A. SAMUELpasamuel@ucdavis.edu • www.linkedin.com/in/pa.samuel2413 Main Street, Davis, California 95616 (530) 555-5555RESEARCH GRANTSCo-authored proposal to National Institutes of Health (NIH). Funded $65,000. With William C. Corbin,UC Davis Medical Center.SUMMARY OF QUALIFICATIONSMicrobiology Ph.D. (Spring, 20xx) with progressive experience in analysis of the regulation of leucinebiosynthesis by ppGpp in Escherichia coli. Additional research includes restriction endonucleaseanalysis of the satellite DNA component from two extremely halophilic bacteria. Highly organized, skilledin translating complex scientific concepts into easily understood terms. Work well independently, as wellas part of a team. Excellent communication skills. Deadline oriented.EDUCATIONPh.D., Microbiology, University of California, Davis. Degree expected Spring 20xxGPA 3.8/4.0Master of Science, Microbiology, California State University, Long Beach, August 19XXGPA 3.9/4.0Bachelor of Science, Biological Sciences, University of California, Davis, June 19xxGPA 4.0/4.0HONORSRecipient, Outstanding Graduate Student Teaching Award, UC Davis, May 20xxPROFESSIONAL AFFILIATIONS / LEADERSHIPAmerican Association for the Advancement of Science (AAAS)American Society for Microbiology (ASM)Chair, Microbiology Graduate Student Association, UC Davis (20xx-20xx)RESEARCH EXPERIENCEUniversity of California, Davis, 6/xx – presentGraduate ResearcherConceived and optimized novel selection procedures using leu::Mud::lac fusions to isolate 1)mutations in the leucine promoter, and 2) unlinked mutations that give rise to decreased expressionof biosynthesis in Escherichia coli. Genetically mapped unlinked mutations. Future work involvesanalysis in an S-30 in vitro system and cloning of the mutants.California State University, Long Beach, 9/xx - 8/xxGraduate ResearcherIsolated and characterized the satellite DNA component from Halobacterium sp. by density gradientcentrifugation and restriction endonuclease analysis.Note, add the following as third page for a research based position only if highly relevantSELECTED PUBLICATIONSSmith, S., and P. A. Samuel. 19xx. Use of M13mp phages to study gene regulation, structure andfunction: cloning and recombinational analysis of genes of the E. coli leucine operon. J. Bact. 26: 147Samuel, P. A. 19xx. Bacteriological Projects for Biological Sciences 1 Students. (In-housepublication)RELEVANT ABSTRACTS AND PRESENTATIONSVeteran’s Administration Medical Center, Long Beach, 9/xx - 9/xxResearch AssistantCollected, maintained and statistically evaluated data for ongoing studies including drugevaluations, immunological studies, iron therapy studies and studies on long-term dialysis patientcare.Samuel, P. A., and S. Smith. Use of leu::lac fusions to isolate leucine operon regulatory mutations inEscherichia coli. Presented at the 19xx Annual Meeting of the American Society for Microbiology.Other Relevant ExperienceBacteriological Techniques Laboratory, UC Davis, 9/xx - 12/xxAssociate InstructorLectured upper division undergraduate class of 45 students; demonstrated new techniques.Evaluated laboratory write-ups.Pat Samuel, page 2 of 3icc.ucdavis.edu 31

Curriculum Vitae for Science PositionA curriculum vitae (CV) is used by individuals applying for grants or fellowships, or when seeking an academic teaching or research position in a college or university. A “CV” may alsobe requested in application to graduate school, but undergraduate students will want to follow a resume format for application. For more examples of CVs, please visit http://iccweb.ucdavis.edu/graduates.RESEARCH GRANTSCo-authored proposal for National Institutes of Health (NIH). Funded $65,000. (PrincipalInvestigator: Don Pruitt, Ph.D.)PAT A. SAMUELpasamuel@ucdavis.edu • www.linkedin.com/in/pa.samuel32 University of California, DavisPUBLICATIONSSmith, S., and P. A. Samuel. 19xx. Use of M13mp phages to study gene regulation, structure andfunction: cloning and recombinational analysis of genes of the E. coli leucine operon. J. Bact. 26:147Department of Bacteriology 2413 Main StreetUniversity of California, Davis Davis, California 95616(530) 55x-xxxxSamuel, P. A. 19xx. Bacteriological Projects for Biological Sciences 1 Students. (In-housepublication)EDUCATIONPh.D., Microbiology, University of California, Davis. Degree expected Spring 20xxDissertation: Analysis of the regulation of leucine biosynthesis by ppGpp in Escherichia coliAdvisor: Dr. Sara SmithABSTRACTS AND PRESENTATIONSSamuel, P. A., and S. Smith. Use of leu::lac fusions to isolate leucine operon regulatory mutationsin Escherichia coli. Presented at the 19xx Annual Meeting of the American Society for Microbiology.Master of Science, Microbiology, California State University, Long Beach, August 19xxThesis: Restriction endonuclease analysis of the satellite DNA component from two extremelyhalophilic bacteriaAdvisor: Dr. Paul JonesACADEMIC SERVICEChairperson, Microbiology Graduate Student Association, UC Davis (20xx - present)Student Representative, Board of Admissions and Relations with Schools, Subcommittee onResearch (20xx – 20xx)Bachelor of Science, Biological Sciences, University of California, Davis, June 19xxAREAS OF SPECIALIZATION(Optional)PROFESSIONAL AFFILIATIONSAmerican Association for the Advancement of Science (AAAS)American Society for Microbiology (ASM)HONORSRecipient, Outstanding Graduate Student Teaching Award, UC Davis, May 20xx.RESEARCH EXPERIENCEDoctoral Research, UC Davis, 6/xx - presentConceived and optimized novel selection procedures using leu::Mud::lac fusions to isolate1) Mutations in the leucine promoter, and 2) unlinked mutations that give rise to decreasedexpression of biosynthesis in Escherichia coli. Genetically mapped unlinked mutations. Future workinvolves analysis in an S-30 in vitro system and cloning of the mutants.PI: Dr. Sara Smith, Department of BacteriologyREFERENCESSara Smith, Ph.D. ssmith@ucdavis.eduDepartment of Microbiology, University of California, One Shields Ave.,Davis, CA 95616 530-75x-xxxxMasters Research, CSU Long Beach, 9/xx - 8/xxIsolated and characterized the satellite DNA component from Halobacterium sp. by density gradientcentrifugation and restriction endonuclease analysis.PI: Dr. Paul Jones, Department of MicrobiologyDon Pruitt, Ph.D. dpruitt@ucdavis.eduDepartment of Microbiology, University of California, One Shields Ave.,Davis, CA 95616 530-75x-xxxxPaul Jones, Ph.D. pjones@ucdavis.eduDepartment of Biology, California State University, 123 University Ave.,Long Beach, CA 92222 530-75x-xxxxResearch Assistant, Veteran’s Administration Medical Center, Long Beach, 9/xx - 9/xxCollected, maintained and statistically evaluated data for ongoing studies including drug evaluations,immunological studies, iron therapy studies and studies on long-term dialysis patient care.PI: Dr. Khosrow Mirahmadi, Medical HemodialysisP.A. Samuel, page 2 of 5TEACHING EXPERIENCEAssociate Instructor, Bacteriological Techniques Laboratory, UC Davis, 9/xx - 12/xxLectured on and demonstrated new techniques. Graded laboratory write-ups.Dr. William Wolff, Department of Microbiology

Curriculum Vitae for Humanities PositionThe curriculum vitae can vary according to standards within a discipline. The humanities curriculum vitae is similar to Sample 1 butoffers a different approach on the first page. Pay particular attention to the list of common support documents below. They may beexpected even if they are not specifically requested. If in doubt, contact the hiring institution.Morgan A. Smith2020 Sunrise CourtDavis, CA 95616(530) 756-XXXXmsmith@ucdavis.edulinkedin.com/in/MorganSmithEDUCATIONPh.D. Comparative Literature, University of California, Davis, expected June 20xxMajor Field of Study: 17th Century British literatureM.A. Comparative Literature with honors, Michigan State University, East Lansing, MI,June 20xxB.A. English, magna cum laude, San José State University, June 20xxDISSERTATIONTitle: “Three British Poets: A Comparative Study of the Conventions Used by Chaucer,Beaumont and Fletcher.” The dissertation examines a comparative study of prominentBritish poets tracing the development of mock-heroic and mock-epic conventions in Englishpoetry. Dissertation Advisor: Suzanne Takahashi, Department of English, UC DavisDISTINCTIONSOutstanding Graduate Teacher AwardPh.D. Qualifying Exam passed with distinctionRhodes Scholar finalistJastro Shields FellowshipTEACHING AND RESEARCH INTERESTS• Areas of research specialization include Renaissance and 17 th century literature andmetaphysical poetry.• Teaching interests include...(Visit the website of the prospective employer and provide alist of courses you want to teach, including those in the listing.)TEACHING EXPERIENCEAssociate Instructor, Department of Comparative Literature, UC Davis, January 20XXpresent.Interpretation of Literature. Developed course syllabus and lectures. Wrote andevaluated examinations. Held weekly office hours.Resumes and CorrespondenceTeaching Assistant, Department of English, UC Davis, September 20XX-January 20XX.Solely responsible for lectures and exam evaluations. Held weekly office hours. Coursesincluded:Narrative Literature (3 quarters)Freshman Composition (4 quarters)Lyric Poetry (upper division, 1 quarter)RESEARCH EXPERIENCE(Note: From here, follow format provided on page 32, Curriculum Vitae for Science Position.)A footer should be included on your CV with last name and page X of X starting on page 2+icc.ucdavis.edu 33

Curriculum Vitae for Community College PositionROBIN A. COMMUNITYrcommunity@ucdavis.edu1260 Lake Blvd.Davis, CA 96616(530) 75X-XXXXwww.linkedin.com/in/RobinCommunityEDUCATIONMaster of Science, Animal Biology, University of California, Davis, June 20xxBachelor of Science, Biological Sciences, University of California, Davis, June 20xxAssociate of Arts, Sacramento City College, June 20xxCalifornia Community College Credential, Biological and Zoological Sciences, 20xxLife Science Credential, University of California, Davis, June 20xxResumes and CorrespondenceQUALIFICATIONS AND SKILLS (Note: this is an optional section)Five years teaching experience at the postsecondary and secondary levels with studentsdiverse in age, ability and cultural background.• Areas of teaching competence include Biology, Advanced Placement Biology,Evolution, Human Physiology, Marine Biology, Family Life and Human Sexuality,among others.• Experienced in developing course curricula as well as executing field trips, laboratoryexercises, and other activities beyond traditional lectures.TEACHING EXPERIENCEInstructor, Ohlone Community College, September 20xx-presentGeneral Biology: Prepared curricula and lectured on the principles of cell biology, animaland plant structure and function. Wrote manual on biological sciences projects. Arrangedfield trip to Klamath Wildlife Refuge.Heredity, Evolution and Society: Taught contemporary issues in evolution and geneticsto non-science majors. Revised curriculum and prepared lab manual.Teacher/Department Head, Sacramento Country Day School, September 20xx-August 20xxTaught advanced placement courses in Biology and Human Physiology to 95% collegeboundstudent body. Developed laboratory resources and participated in design ofteacher training and evaluation program.Teaching Assistant, University of California, DavisSole responsibility for lectures, course syllabi, examinations, and final evaluations.Courses: Principles of Biology (Fall, 20xx and Winter, 20xx)General Zoology and Laboratory (Spring, 20xx)RESEARCH EXPERIENCE(Note: From here, follow format provided on page 32, Curriculum Vitae for SciencePosition).A footer should be included on your CV with last name and page X of X starting on page 2+34 University of California, Davis

CV Categories and Grad Skills ListMore Categories and ClarificationsPUBLICATIONS: If lengthy, include subheadings such asrefereed, non-refereed, textbooks, chapters, technicalpapers, etc. Distinguish between those in press,submitted, under review, limited distribution and inpreparation. Use bibliographic style appropriate for yourdiscipline.PROFESSIONAL DEVELOPMENT: List workshops,conferences or courses related to training. For example,the seminar on college teaching or workshops related toteaching or research methods.General Skills Particular to Graduate StudentsCommunication SkillsAbility to:write clearly and conciselylisten wellspeak publiclyinterpret the dynamics of interpersonal relationsdistinguish fine shades of meaningdistinguish verbal and non-verbal messagesteach and traincounsel and adviseserve as resource/referral personOTHER RELEVANT EXPERIENCE: Could containnon-academic position related to current field or field ofstudy.GRANTS AND CONTRACTS: Include only if you haveauthored or co-authored the proposal and receivedfunding. Indicate the funding source and the name of theprincipal investigator.SHOWS/EXHIBITS/PERFORMANCES: Cite workscomposed, conducted or performed.CERTIFICATIONS/LICENSURE: Follows Education.LANGUAGES: Indicate fluency: reading, writing, speaking.RELEVANT COURSEWORK: Use only if requested or ifit serves to clarify preparation. If more than 2-3 lines,substitute “See Addendum I” and attach the addendum.SUPPORT DOCUMENTS FOR ACADEMIC POSITIONS:Cover Letter/Statement of Interest (Alwaysincluded; length varies depending upon numberand type of other supporting documents requested.In other words, if none of the following additionaldocuments listed below are requested, then thecover letter should be more comprehensive and willthus be longer in length, but no more than threepages.)Research Statement/AgendaStatement of Teaching InterestsTeaching Philosophy StatementEvidence of Teaching EffectivenessGeneral Research SkillsAbility to:retrieve dataacquire dataanalyze datamanipulate datause methodologyproduce survey work, e.g., develop questionnaires,interviewobserveclassifytest hypotheses for acceptance orrejection against known evidenceidentify and use resourcesTechnical SkillsAbility to:program computerseditField Research SkillsProblem-Solving/Analytical/Conceptual SkillsAbility to:analyzereason logicallyidentify problemsanalyze problemsperceive parts in relation to wholesee patternsdevelop theories out of patternsynthesizecondense material to its important componentsmanipulate abstract conceptsformulate hypothesesthink flexiblyimpose structure—create order out of “chaos”evaluate programsResumes and CorrespondenceDiversity StatementSample Course SyllabiWriting Sample/ReprintsDissertation AbstractLetters of RecommendationTranscripts (Only if requested)Managerial SkillsAbility to:superviseevaluate performance of othersassume authoritydelegate authoritymanage timeestablish goalsset objectivesmotivate peopletolerate ambiguityicc.ucdavis.edu 35

Cover LettersCover Letter BasicsA cover letter or letter of intent should go with most resumessubmitted for consideration for jobs or internships. If you can onlyupload one document, you can make your letter/resume into a twopagedocument with a page break in-between the two sections.A cover letter is important because:➔ It introduces you and your resume.➔ It explains why you are a good fit for this opportunity.➔ It bridges the gap between your resume and the reader/employer.➔ It supplements and expands on projects, education andexperiences directly related to the opening.➔ It can make the difference between having your resumeread or ignored.Cover Letter DOsUse the same font, format and paper as your resume.Limit a cover letter to one page.Personalize each cover letter to the specific position.Check for typos, proper grammar and accuracy. UseSPELLCHECK first, but do not rely on it to catch all errors.Have an ICC Advisor review it before you send it.Use “standard business letter” format even if it is an email.When emailing, also attach a pdf version of your cover letter.Standard salutations are: Dear Mr. Smith, or Dear Ms. Grey.If no specific name, use: Dear Hiring Manager, Dear GraphicsDepartment Hiring Team, Dear Recruiter, and To Whom ItMay Concern: (this last one takes a “:” not a “,”)Cover Letter DON’TsDon’t try to say everything in your cover letter.Do not repeat or summarize your resume.Don’t use a generic, “one size fits all” cover letter.Don’t write long, wordy letters.Don’t overuse adjectives, especially subjective ones. (example:You are the best X company in the world. I am the most hardworkingstudent intern you will ever meet.)Do not exaggerate your skills or experience.Don’t focus on what you want, but on what you bring to theemployer.Resumes and CorrespondenceCover LetterFormat andContentDescriptionReturn Address (yours, the sender)City, State ZipTelephone with area codeEmail addressDateName, Title (who is it going to ….format: First Name Last Name, Title)Company NameStreet AddressCity, State ZipDear Ms., /Mr., /Dr., (or Hiring Manager, or To Whom It May Concern: )Avoid overuse of adjectives and adverbs. Strive to be objective.Avoid: I am an incredibly hard worker. Better: My past supervisornoted that I am able to complete projects earlier than deadlines.Explain in the cover letter how your experiencerelates to this opening using one or two key examples.Do not summarize your whole resume.In the FIRST PARAGRAPH, tell how you heard about the job and, if appropriate, name the person who told you about it.Mention the specific job title. Express your interest in the company or position. Say you are enclosing/attaching a resume thatshows how you are qualified for this job. (optional)In the SECOND PARAGRAPH (AND MAYBE IN A 3 RD PARAGRAPH), analyze your background and skills in relationshipto the specific job description. Show how you make a ‘good fit’ with this job/organization and how you can contribute.It is about what you can do for them, not what they can do for you. Give one or two examples of related experience. Keep thejob description in mind and do NOT restate your resume. This letter shows brief highlights of your ‘fit’ with a specific jobusing specific skills, qualities, knowledge, interests you have that relate to the opening. (Break big paragraphs up, using oneparagraph for each skill set is one way to organize them. Smaller paragraphs are more readable.)In the LAST PARAGRAPH, tell how you will follow through with this application. For example, “I am eager to meet withyou to discuss this opportunity. I am available for an interview at a mutually convenient time. And remind the reader how toreach you best.” For example, “I will be in the Bay area during the week of March 25.” or “I am able to drive to Roseville anyday except Tuesdays and Thursdays.” And “I can best be reached at 530-555-1212 or james.stewart@ucdavis.edu.” I lookforward to hearing from you.Sincerely,(typically leave 4 spaces for your signature)James Stewart (if emailing, use a script-like font to simulate your signature in this space)James Stewart (Just type your name here—2 spaces below signature)Attachments (if email) referring to your resumeOr…Enclosures (if paper mail)Use SPELLCHECK often, but do not rely on it tocatch all errors. Then copy and paste your letter asthe text of your email and attach it in pdf format.36 University of California, Davis

Cover Letter for Internship Position555 A StreetDavis, CA 95616(520) 867-XXXXjbeech@gmail.comNovember 10, 20XXHuman Resources Department – Internship ProgramNational Public Radio123 Government StreetWashington, DC 20301Dear Internship Coordinator,I am very interested in the internship with the Communications/Public and Media RelationsDepartment during the Winter Quarter. I am a Junior at the University of California, Davis,pursuing a bachelor’s degree in American Studies with a minor in Communication. My researchexperience has sparked my interest in the way that media is delivered through marketing andadvertising. I believe in the mission of National Public Radio and would be excited to be anintern with your organization.This summer while studying abroad I was able to look at American culture from a differentperspective. This has increased my interest in news delivery and how it helps to inform citizens.I was the only freshman to be elected to the position of Senator for the Associated Studentsof UC Davis, and rose to the challenge of representing first-year students while collaboratingon larger university issues. Through these experiences I learned the value of effectivecommunication through all forms of media.I am confident that my experiences, skills and strong interests in the goals of NPR have preparedme to be a strong intern for your program. I have attached my resume and look forward todiscussing my qualifications with you. Thank you for your time and consideration.Sincerely,Josie BeechJosie BeechResumes and CorrespondenceAttachmenticc.ucdavis.edu 37

Cover LetterSample Job DescriptionResumes and CorrespondencePosted Date: 2/23/2011Job Category:GIS/MappingPosition Title: Environmental Scientist – Entry to Mid LevelSalary Range:Location: Baltimore-Towson, Maryland, USADesired Skills:Description:Environmental Scientist – Entry to Mid LevelWould you like to work with a premier environmental services organization?Do you have a strong work ethic combined with personalintegrity? Do you have GIS experience?Our client specializes in environmental, applied engineering, industrialhygiene and information technology services. Their strengthsinclude remediation, compliance and pollution prevention. They havea friendly and teamfocused corporate culture. Grow your career withthe best and brightest in the field!We have an exciting opportunity for an Environmental Scientist insouthern Maryland. The successful candidate will gain a breadthof experience and perform and support environmental compliance,planning, and remediation work for public agencies. Projectsinclude preparing/reviewing NEPA Phase I and II ESA’s; conductingfield investigations to characterize soils, groundwater, and otherenvironmental media; using GIS to prepare various graphical and dataproducts; conducting planning studies and assisting with businessproposal development projects.If you have 1-7 years of experience, and academic, internship, orwork experience in one of more of the following, this may be theposition for you.- Knowledge of environmental science and policy- Knowledge of principles and practice of environmental engineeringand analysis and ability to apply it to federal, state, and otherpublic programs and activities- Ability to use GIS to support environmental analysis and generatepublication-quality maps and work products- Knowledge of federal and state environmental laws and regulationsand skill in applying this knowledge to guide projects- Excellent written and verbal communication skills are requiredTo apply, simply select Apply to job or you can email your resume toeticareer@careers.com.ETI Professionals provides technical support services and projectsupport personnel to our government and industry partners. Ourhighly skilled experts support and supplement the mission,expertise, and skill sets of our clients. Utilizing our customerintimateapproach, we partner with our clients to provide strategicsolutions that maximize the use of human and financial resourcesto ensure that mission-critical projects are completed on time andwithin budget.Our website can be found at ETI PROS, where you will learn moreabout our company as well as an updated list of positions availablenationwide.ETI is proud to be an Equal Opportunity and Affirmative Actionemployer.It is often not possible to identify a specific person toaddress the letter to especially when submitting yourcover letter to a website. Choose your formal greetingfrom the box below.Select the most personal greeting possible. Some ideas:Dear Ms. Lastname, or Dear Mr. Lastname, or DearSelection Committee, or Dear Hiring Manager. Use “ToWhom It May Concern:” as a last resort with a colon,not a comma, at the right.Show your enthusiasm for the job or the organizationin your cover letter. State why you are interested inthis job or this organization. Be specific. Refer to somethingyou learned from the company website or otherresearch.Sample Matching Cover Letter1122 Aggie Avenue, Apt. #33Davis, CA 95616(530) 757-XXXXakim@ucdavis.eduMarch 21, 20XXMs. Sally BlackABC Company456 Main StreetAnytown, CA 95XXXDear Ms. Black:I am applying for the Environmental Scientist position you have listed inthe Aggie Job Link database. I believe I am a strong candidate for thisposition as I have the qualifications and experience you are seeking.I am a recent graduate from the University of California, Davis with aBachelor of Science in Environmental Policy Analysis and Planning anda Bachelor of Arts in Communication. These degrees have prepared mewell by developing my working knowledge of environmental impactassessments, CEQA, NEPA and other environmental regulations aswell as honed my report writing and verbal communication skills. Inaddition to my coursework, I have experience in the field. As a fellowwith the US EPA in Philadelphia, I reviewed and provided commentson Environmental Impact statements, used GIS to update publicationquality maps, and interfaced with numerous federal and privateagencies. As a planning intern with Sacramento County, I conducteda jobs/housing balance study where I incorporated input from thepublic with County needs. At the Student Landowner Education andWatershed Stewardship Program (SLEWSS), I honed my communicationand organizational skills through weekly presentations about nativespecies, ecosystems and soil characterization.I feel I would make an excellent Environmental Scientist with ABCCompany. I have a strong work ethic, I work well with teams, and Iwant to be part of a company that develops strategic solutions to makethe world a better place. I look forward to an interview with you tofurther discuss my qualifications.Sincerely,Audrey KimAudrey KimWrite about what skills you canbring to the company, not what theorganization can do for you.Match your cover letter to the jobdescription. Avoid using a generic,“one size fits all” cover letter.38 University of California, Davis

Additional Letter Samples1234 Raleigh CourtDavis, CA 95616(530) 758-XXXXMarch 12, 20XXMs. Karen Smith, CoordinatorThe Internship and Career CenterUniversity of California, DavisOne Shields AvenueDavis, CA 95616Dear Ms. Smith,Thank you for the opportunity to interview this afternoon. After ourmeeting I am even more interested in being a student advisor at theInternship and Career Center. I would like to add that in addition tomy Resident Advisor experience I gained excellent computer skills andused Access to generate many reports during my internship at PG&E.So, not only do I offer the interpersonal skills acquired as a ResidentAdvisor but I also have strong technical skills as well.I would like to add Maggie Thompson, Customer Records, PG&E,mthompson@pge.com, as one of my references.I am excited about the Student Advisor position and greatly appreciatebeing considered for the position. I look forward to hearing from youand can be reached at (530) 758-XXXX during Spring Break (March25 through March 30) or at saggie@ucdavis.edu.Thank-You LetterThank-you letters can also be used to reinforce replies tointerview questions or give alternate responses. If you thinkof a better example/response to a particular question afterthe interview, you can use the thank-you letter to give thatresponse. Here’s an example:“During the interview you asked about my experienceworking in unpredictable situations. As a Resident Advisorat UC Davis, I managed a community of 110 new students.The position involved being prepared for unpredictablesituations such as loud and unruly parties, policy enforcement,peer advising, and emergencies pertaining to individuals,groups and threats to the residence hall.”123 D StreetDavis, CA 95616(530) 758-XXXXjgreen@ucdavis.eduThank you again for your time and consideration.Sincerely,Stephanie AggieStephanie AggieApology LetterAn apology letter is a personalized note apologizing for alast-minute interview cancellation or no-show. The noteis an effort to remain in good standing with the company.March 21, 20XXMs. Sally BrownABC Company123 Main StreetAnytown, CA 95XXXDear Ms. Brown:Please accept my apology for missing the interview scheduledwith ABC Company on Thursday, March 20 at 2:15 p.m.I experienced an unforeseen emergency that kept me frommeeting with you. Your company offers an invaluableopportunity, and I appreciate any consideration you can giveme in rescheduling my interview.My internships with Look Public Relations and Real Marketinghave provided me with the experience and qualifications youdesire in the Marketing Assistant position. This experience, incombination with my Managerial Economics major, make me astrong candidate for this position.Thank you for your understanding. I hope we can meet inthe near future to discuss my qualifications for the MarketingAssistant position you are offering.Resumes and CorrespondenceSincerely,Joe GreenJoe Greenicc.ucdavis.edu 39

Additional Letter Samples192 Beta DriveDavis, CA 95616(530) 75X-XXXXMarch 28, 20XXMr. Kevin JonesPersonnel ManagerABC Corporation3 Wallaby PlaceSan Francisco, CA 10XXXDear Mr. Jones:Letter to Accept a Job OfferNotify the employer as soon as you decide to accept a joboffer. Confirm your acceptance in writing even if you’vealready accepted the offer by telephone. Restate the date of theoffer, the position, the salary and the starting date. Expressenthusiasm for the company and your position and futurewith it.If you are relocating, let the employer know your travel plansand expected date of arrival. Inform the employer of your new(or interim) address and telephone number.Resumes and CorrespondenceThank you for your letter of March 25, 20XX and yourinvitation to become a member of your organization followinggraduation. I am pleased to accept your offer of employment.I understand this is a 12-month career position, and I willbegin employment on (date). I have read and understand theinformation contained in the benefits package and agree to mysalary offer of($ _____). If any of this information is in error, please let meknow as soon as possible. I can be reached at (530) 756-XXXXor rjryan@ucdavis.edu.I look forward to a satisfying and mutually productive careerwith ABC Corporation.Sincerely,Robyn RyanRobyn RyanFollow Up to Fair orInformational Interview Letter7777 Hollywood RoadDavis, CA 95616(530) XXX-XXXXpmraidt@ucdavis.eduMarch 12, 20XXMr. David William ArpHiring MangerEGP Laboratories123 Street NameSometown, ST 00000Dear Mr. Arp,Thank you for discussing the various laboratory positionsavailable within your company at the UC Davis Career Fair onFebruary 8, 20XX. I am excited about both the manufacturingand quality control divisions of your organization and wouldlike to work for EGP Laboratories after I graduate in June.My background as a Biotechnology major has prepared me tounderstand the theory behind the work at your company andhas supplied me with a number of the skills you describedas necessary including PCR, gel electrophoresis and aseptictechnique. You emphasized the value of teamwork withinyour organization. I believe my participation in the StudentLeadership Development Series and as a Student Advisorin the Human Corps office attest to my ability to work asa team member while being independently responsible forprioritizing my work and meeting deadlines.I’m including an updated copy of my resume for your reviewand would welcome an opportunity to speak with you further.Please let me know if I can answer additional questions aboutmy experience or to schedule an interview.Sincerely,Patricia M. RaidtPatricia M. Raidt40 University of California, Davis

Creating an Employment Reference ListReferences• Your future supervisor will need to contact your referencesbefore offering you a position. To fulfill this last stepbetween you and the job, follow the process below.Selecting People• References, a list of 3-5 people you have worked, volunteeredor interned for such as faculty, current or formersupervisors and/or campus staff that includes all necessarycontact information. (See sample format below.)• You can include advisors, coaches, mentors or anyone in aprofessional position who can speak about your character,skills and work ethic.• References should NOT be family, friends or peers.• Choose people who have known you for a minimum ofthree months. The longer they have known you the better;however, try to choose someone with whom you haveinteracted in the past year.• Do not choose people who are not well versed on yourbackground and accomplishments. (Make sure they haveyour current resume.)REFERENCESAUDREY KIM1122 Aggie Avenue • Apt. #33 • Davis, CA 95616(530) 757-XXXX • (415) 48X-XXXXakim@ucdavis.eduAnne RobertsonAssociate DirectorSacramento County Planning and Community DevelopmentDepartment361 Capitol Mall, Sacramento, CA 95XXX(916) 82X-XXXXarobertson@scpccd.ca.govRobert Wood Ph.D.DirectorU.S. Environmental Protection Agency121 Green Avenue, Philadelphia, PA 19XXX(215) 71X-XXXX ext. XXXrwood@epa.govJanet CollierGeneral ManagerStudent Landowner Education and Watershed Stewardship Program(SLEWS)Formerly: Assistant Director, Sacramento River Watershed ProgramUniversity of California, Davis, One Shields Avenue, Davis, CA 95616(530) 75X-XXXXjxcollier@ucdavis.edu• Create a consistent and professional application packet;your font, format and paper choices should be the same asthose used for your resume and cover letter.• If you must choose between several people who know youwell, select those who witnessed you in positions morerelated to your objective.Ask Permission• Always ask permission from your references BEFORE youuse their names. Ask your recommenders if they are willingto provide a strong, supportive recommendation.• Make sure that you collect current contact information.Ascertain if they are available via phone or email duringyour critical search time.Help Your References• Provide your references with a copy of your resume andinformation about the position you are seeking.• Remember—a reference should attest to your skill andability level. They may speak to your interpersonal, leadership,communication, conflict resolution, decision-makingskills and grasp of your field of study.• Any inconsistencies between what you say about yourselfin an interview and a reference’s responses could eliminateyou from consideration for a position.• Thank your references after the selection process iscomplete; maintain a strong, ongoing, professionalrelationship.When to Submit References• You will need to bring at least one copy of your referencelist to your interview. Some employers may ask for it beforethe interview.• If an employer does not ask by the end of the interview,you should ask them if they would like reference informationnow.When a Reference Letter is Requested• There are some applications that may require a letterof recommendation (i.e., fellowships, scholarships,jobs and/or internship programs like WashingtonProgram and UC Center Sacramento).• Follow the aforementioned process to identify, helpand thank your references.• Formally ask your references via phone, email orin-person meeting with ample time to allow them towrite a letter.• Use ICC services to address specific questions.Resumes and Correspondenceicc.ucdavis.edu 41

InterviewingInterviewing for EmploymentGetting StartedKnow YourselfThe interview is your opportunity to promote yourself. It isabout your ability to tell a story about yourself and articulateyour:• Values • Skills • Interests • Abilities • Long term plansSpecifically discuss:• How your professional goals match with the job and howyour skills and experiences will contribute to the job.• Your skills with an example of a time when you demonstratedthose skills. It isn’t enough to say you have greatcommunication skills; support that statement with anexample.Page 14 offers a “transferable skills” check list.How to Prepare and PracticeKnow the OrganizationResearch the organization’s website and understand themission of the company. Note any important details (newproducts or services, news, acquisitions, etc.) as they could bementioned in the interview.Read the annual report and company literature, attendon-campus information sessions and meet representatives atinternship and career fairs. Read newspapers, industry tradejournals, and relevant websites, and listen to the news to keepinformed about trends.Know the Interview DetailsCall HR or the recruiter to ask about interview details:• The type of interview: “Is it a panel interview? ShouldI bring writing samples to the interview?” or “Are tests acomponent of the interview?”See page 45.• The length of the interview: “How much time should Iallow for the interview?” If considering scheduling multipleinterviews in one day, this will be important to know.• Accurate directions to the interview location. Checkthe directions using multiple sources.ReviewReview the responsibilities in the job description anddetermine specific examples of success for each responsibilitybased on your past experiences.Review your resume to prepare for questions about itscontent.Additional Tips:• Bring multiple copies of your resume, references, and anyother materials requested.• Prepare questions to ask at the end of the interview ifrequested. See page 48.RehearsePractice answering questions before the interview Seepage 48. Here are suggestions:• Practice with an audio recorder, video camera or mirror.• Use your computer or phone to record yourself and thenplay it back!• Eliminate filler words such as “um,” “like” and “youknow.” Practice speaking slowly and clearly.• If an employer asks a question you aren’t prepared for,repeat the question aloud, allowing you some time toformulate your answer. If you need more time to think,say “That’s a good question; I’ll have to think about it.”• Hold a mock interview and ask for feedback about yourperformance.Practice Your Interview Online!Check out the Mock Interview module in Aggie Job Link• find it in the “Resources’ pulldown menu• choose from a variety of recommended interviews orcreate your own.• Review your interview from all the little things youhaven’t noticed about yourself.• Keep it private or share your interview with a friend oran ICC staff to get valuable feedback.What to WearWhat you wear to an interview makes a lasting impression.Wear clothing that is clean, pressed and businesslike. In mostcases, “businesslike” translates to a suit. Women can weara suit with either skirt or slacks. If you are uncertain aboutwhat to wear to an interview, look at the company’s website tolearn more about the company culture or watch the “Dress forSuccess” webshop found at icc.ucdavis.edu/webshops orget ideas from pinterest.com/ucdavisicc.Tips• Pressed clothes, no wrinkles• Clean and polished business shoes• Minimal jewelry, no facial piercings and cover your tattoos• No sleeveless clothing, spaghetti straps, bare midriffs orlow-cut blouses• Skirts should be just above the knee when seated and nottoo tight• Men should wear a plain undershirt under their dress shirt• Go light on the cologne/perfume or do not use fragrance atall since some people have allergies• No gum chewing• Before the interview, turn off cell phone—not vibrate• Have a couple of interview outfits so you’ll have options ifasked back for a second interview• Simple classic outfits win over “fashion”44 University of California, Davis

ReferencesYou will need to bring contact information for 3-5 employmentreferences to your interview. See page 41 forinstructions.Types of Interviews• Screening. This interview usually lasts 30-45 minutesand can take place in person or on the phone. It is usedto determine whether the company will invite you tocontinue in the selection process.• Video screening. One-way process where company asksyou to video record you answering questions that yousend to them to screen.• On-site interview. This interview is conducted at acompany facility. If travel is involved, the company mayoffer to pay for your expenses; do not assume this is thecase. Keep receipts and carefully follow the guidelinesprovided by the company.• Interview over a meal. This interview is not a social function,it is part of the formal process. Manners count! Noalcohol—ever!• Phone or Skype interview. Make sure you are in a quietlocation, able to focus on the call and speak clearly. Haveyour resume, job description, references and notes bythe phone. If using a cell phone, make sure it is chargedand you are in a location where you have good reception.Have a backup plan in case of a dropped call.The interview may also vary in size:• One-on-one interview. One interviewer and one inter vieweeis the most common experience. You may have individualinterviews with several members of an organization.• Panel interview. You will be interviewed by a committee,usually between 2-6 people. When you enter the room,shake each interviewers’ hand while introducing yourself.It is important to make eye contact with all interviewers.At the end, shake their hands again while thanking them.• Group interview. You will be interviewed simultaneouslywith others. The interviewers will take turns asking questionswhile the other group members observe. Show yourlistening skills by paying attention to what others say andtry not to repeat their responses. Also be prepared forgroup projects. If your group is assigned a project, use thisopportunity to show your leadership skills by keeping thegroup on track and completing the project.• Group Panel. You and other interviewees are interviewedby a panel. Participate using the same skills as thoseneeded for a group interview.Other PossibilitiesSome employers are using methods other than (or in additionto) a standard interview in making hiring decisions.You may be asked to:• submit or evaluate a writing sample• make a presentation to the interview committee (oftenusing electronic media)• take a personality assessment to evaluate potential fit• engage in an active simulation or assessment todemonstrate problem-solving capabilities• communicate with employers via phone, Skype, etc.Day of the InterviewIt is likely you will be nervous before your interview.Here are some tips:• Personal hygiene. Shower and be well groomed.• Leave time for mishaps. Traffic, road construction, flattire—leave time in the event that something happens.• Eat prior to the interview.• To reduce sweaty palms, keep a tissue in your pocketto wipe your hands before shaking hands.• Be courteous to everyone at the interview location. Youdon’t know who will be interviewing you, so be polite andpleasant to everyone. If you are rude to anyone, that informationwill, more than likely, get back to the interviewer.• Arrive early. Arrive at the interview site approximately15 minutes before your interview. Do not be late! If youknow you will be late, call and let the interviewer know.The Interview ProcessThe Beginning• Casual conversation. The interview begins with lightconversation meant to put you at ease. Use this time tobuild rapport.The Middle• Down to business. The actual interview begins when theinterviewer describes the position and organization. Listenfor any recent changes and how the interviewer refers tothe position.• Employer will ask questions about skills, education, trainingand work history. Many standard or behavioral-based interviewquestions will be asked. See pages 47 and 48.• Be selective about the experiences you present. Alwaysemphasize the positive, but NEVER exaggerate or falsifyinformation.• Show confidence in your responses even if they ask abouta skill or experience you don’t possess (example: “I havenot worked with that particular software package buthave worked with similar packages such as _____ and feelconfident I can learn this program in minimal time”).• When asked about your weaknesses, do not reveal a majorflaw and be cautious about revealing a personal problem.Talk about an area you would like to improve and mentionthe steps you’ve taken to improve it as well as the results.• Be truthful about your willingness to travel or relocate.The End• The end of the interview usually includes the interviewerasking if YOU have any questions. The interviewer mayalso provide you with details of the next steps in the selectionprocess. If not, this is a great question for you to ask.(“Can you tell me what your next steps are in selectingsomeone for this position?”).Interviewing for Employmenticc.ucdavis.edu 45

Types of Interview QuestionsRecruiters often draw from various sets of questionsincluding traditional, behavioral and case interview questions.Traditional Interview Questions. These questions seek insightinto who you are, your experience (educational, work and leadership)and how you would fit into the job and organization.See page 48 for examples.Behavioral Interview Questions. These questions are basedon the theory that your past behavior is a key indicator of yourfuture performance. Review your background for examples ofclass projects, work experience, community service, and leadershipactivities illustrating your talents, problem solving abilities,communication and leadership skills. Think of past situationsthat did not go well, how you resolved them, and what youlearned. See box on page 47 for more information.Case Study Interview Questions. These questions giverecruiters an opportunity to observe how well you think onyour feet. You will be presented a complex question and askedto find a solution. For example, “How many people are usingthe internet right now?” or “How many airplanes are currentlyin the air?” In this type of question, the recruiter is looking forinsights about your analytical and problem solving skills. Youare expected to think out loud, walk the recruiter through yourthought process.• Send a thank-you letter or email within 24 hours.Refer to the interview, the knowledge you gained aboutthe position and organization and your qualifications andinterest. An email thank-you is appropriate. See page39.Don’t• Exaggerate or lie.• Apologize if you think you interviewed poorly.• Ask for feedback on your interviewing style.Follow-up LetterIf you don’t hear from a company within two or three weeksof submitting your resume or interviewing with them,follow up with a phone call or email (see sample below).Interviewing for EmploymentAt the End of the InterviewAt the close of an interview you will have an opportunity toask questions. Remember, interviews go both ways.They will interview you to see if you are a right fitfor the company, but you should take the sameopportunity to see if the company is a good fit foryou. Ask strategic questions that help you assess thejob or highlight your knowledge about the companyor position. See page 48 for a list of possiblequestions. Questions related to salary, benefits,vacation time and schedule should wait until theemployer initiates those topics or you are offeredthe position. Leave knowing when decisions will bemade and what you need to do.Do• Re-emphasize your interest in the position.• Ask for a business card—make sure you havethe interviewer’s name (or ask the receptionist).• Ask the recruiter when you can expect to becontacted.• Shake the recruiter’s hand and sincerely thankher/him for considering you.• Ask, “What comes next?” or “What is the nextstep in your hiring process?”• Leave the interviewer with a positive imageof you being confident, enthusiastic andcourteous.Quality Control Laboratory Assistant Positiondwarp@egplab.comQuality Control Laboratory Assistant PositionDear Mr. Arp,Sample Follow-Up Email After InterviewThank you again for the time you spent with me on Friday, January 3rd todiscuss the Quality Control Laboratory Assistant Position. Since our interview,I have remained very excited about this excellent opportunity. I know that mybackground as a Biotechnology major and my past experience as a StudentAdvisor in the Community Resource Center will make me an incredible asset toEGP Laboratories.I wanted to follow up to determine if there are any updates regarding the statusof the position. Please let me know if I can provide any additional information toassist in the process.I look forward to hearing from you.Best Regards,Patricia M. Raidtpmraidt@ucdavis.edu(530) XXX-XXXX46 University of California, Davis

Tips for the Behavioral InterviewBehavioral interview questions assess how you have acted in past situations,with the idea that past performance is a key indicator of yourfuture efforts.How to Prepare✓ Review and select some challenging experience that reflects positivelyon your behavior including work situations, project-based orteam work, campus activities, community service and leadershipexperience. Employers are investigating how you deal with problems,failures, difficult teams or supervisors.✓ Focus on your strengths and positive attributes, withoutcomplaining or criticizing others.✓ Jot down ideas about each experience and examine your role. Howdid you handle problems, show initiative and contribute to theoutcome?✓ Use the S.T.A.R.T. method to help you form an example:• Situation • Task/Problem • Action • Result • Tie to Job✓ Expect the employer to ask an open-ended question about a pastexperience and then continue to ask questions that reveal any of thefollowing:• communication skills, leadership and organizational ability• analytical and problem solving skills• your decision-making process• cooperative and/or competitive nature• initiative • flexibility • creativity✓ Be honest. Don’t exaggerate. Your answers will be reviewed forconsistency.✓ Practice. Draw from several types of experiences to show depth.✓ Turn any interview question into a behavioral answer with anexample.✓ Examples of behavioral interview questions can be found aticc.ucdavis.edu/students/careers/interviewtips.htm.Example of a Behavioral Interview Question and Response:Question: “Give me an example of a time when you took the initiative toimprove a project.”Response Using the S.T.A.R.T. Method: “As a peer advisor at theInternship and Career Center (Situation), students often asked me howto find job opportunities in business (Task/Problem). Since I was alsocurious about my future in this industry and had taken a Web-authoringclass, I asked my supervisor if I could create a website linked to ourhome page discussing many of the different business options (Action).After developing the site, I shared the online resource with the professionalstaff at the ICC. They were so pleased with the resource that theynow refer students to the site during their advising sessions (Result). IfI’m hired, I’ll work to make information accessible at this job. (Tied tojob).”Expect additional questions such as: “How did you prioritize this additionalwork load? How did you decide what options to include? Wherecan I see this webpage?” Be prepared to back up your statements.Salary• Wait for the interviewer to bring up the topicof salary, benefits and sick/vacation time.• You can ask about salary if you have beenoffered a job without the salary packagebeing disclosed.• If asked how much you expect to earn,state the market range, not a single figure.Visit Salary.com, glassdoor.com orcacareerzone.com to find this information.When researching, take into account differentaspects such as location and years of experience.You can also discuss salary questionswith the ICC staff.• If you are offered a salary that is unacceptable,respond with a counter offer andsupport it with market salary figures and yourqualifications. Know in advance if you arewilling to walk away from the job offer if yourcounter is not accepted.• Always approach negotiation with tact andintegrity.See examples of thank-you and apologyletters on page 39.Illegal Interview QuestionsIt is illegal to ask questions regardingrace, gender, sexual orientation and identity,religion, marital or family status, age,disabilities, ethnic background and countryof origin. Visit the U.S. Equal EmploymentOpportunity Commission website ateeoc.gov for more information. Please discussany illegal questions to an ICC Staff Member.Interviewing for Employmenticc.ucdavis.edu 47

Interview QuestionsEmployers May Ask You...• Tell me about yourself. (This question gets asked themajority of the time—expect it.)• Why did you choose to interview with our organization?• Describe your ideal job.• Define success. Failure.• Of which three accomplishments are you most proud?• Tell me about a time when you were in a leadershipposition.• What skills or ideas do you bring to a job that anothercandidate may not be able to offer?• Where do you want to be in five years?• Why did you choose your major?• Why did you choose to attend UC Davis?• In which campus activities did you participate?• Which classes did you like most? Least? Why?• What job-related skills have you developed?• What did you enjoy most about your most recentemployment?Behavioral Interview Questions• Give me an example of a time in which you provided asolution to an employer.• How do you think a former supervisor would describeyour work?• Tell me about a time when you have persuaded others toadopt your ideas.• What kind of supervisor do you prefer?• Describe your experience working in a team.• How do you organize and plan major projects?• Describe your communication style.• Tell us about your experience working in diverse workenvironments.You May Ask Employers...• What types of assignments might I expect in the firstsix months on the job?• What will the first three weeks be like? Is trainingprovided?• What do you like best about your job/company?• What products (or services) are in the development stageright now?• Do you have plans for expansion?• What characteristics do the achievers in this companyseem to share?• Is there a lot of team/project work?• What are your growth expectations for the next year?• How do you feel about creativity and individuality?• In what ways is a career with your company better thanone with your competitors?• What is the largest single challenge facing your staff(department) right now?• Where does this position fit into the organizationalstructure?• What is the next step? When should I expect to hear fromyou or should I contact you?• How would you describe the management style in thiscompany/department?• Where might a person who has been in this positionexpect to be in five years?Remember that this is a time to show what you knowabout the company. Ask questions that highlight yourknowledge e.g.:“I noticed on your website that teamwork is a core value ofyour company. How often do employees work in teams versusindependently?”Interviewing for EmploymentSecond Interviews, Interviews over Meals,and More...The information presented here will assist you insuccessfully completing your initial/screening interview.For more detailed information on interviewing topicssuch as second interviews, interviews over meals, anddressing for success; talk to an ICC staff member or goto the ICC website at icc.ucdavis.edu/students/career/interviewtips.htm.Interview TipWhile you will need to rehearse answers for an interview,remember: An interview is a business conversation.Avoid answering an interview question with a memorizedresponse! Share information and detail beyond what yousummarized in your resume.Review books on “interview questions” in ourInternship and Career Center Library, 215 SouthHall, UC Davis:There are many resources to help you with tough interviewquestions, and other tips on preparing for the interview.48 University of California, Davis

We Have Over 11,000Success Stories.Yours Should Be Next.At St. George’s University School of Medicine, it’s all about success. TheUniversity’s strong curriculum and award-winning academic support servicesare focused on your success from day one—and the proof is in our results:Speak to a newly matchedgraduate to learn more98%Exceptional USMLE ScoresA 98 percent pass rate for first-time test takers of the USMLEStep 1 in 2013. 1#1770+Scholarship OpportunitiesConsistently Successful Residency Placement RatesSGU is the number one provider of doctors into first-year USresidencies for the last three years combined. 2Competitive Residency SpecializationsMore than 770 graduates obtained residencies in the USand Canada in 2014, many in highly competitive residencyprograms, with graduates specializing in everything fromneurology and diagnostic radiology to surgery and pathology. 3We don’t just encourage excellence—we reward it.Last year, St. George’s University awarded more than $4 million to incomingstudents through an array of academic scholarships.SGU is authorized by the US Department of Education to administer studentloans for qualified US students—one of few international schools permitted todo so.Apply Now at www.sgu.edu/applyTo learn more about St. George’s University, visit sgu.edu/md, or contactJoseph Franza, Assistant Director of Admission, Western Region, atjfranza@sgu.edu or 1 (800) 899-6337 ext. 9 1297.MATCHED!KiMbERLy LALLy, MD ’14PathologyCedars-Sinai Medical CenterLos Angeles, CA“I immediately felt that Cedars-Sinai was the perfect fit forme in terms of training andwork/life balance, and of allthe hospitals I interviewed atin California, it was the onlyprogram where I had that gutfeeling, I was ecstatic whenI found out I matched there.I was with my family and wewere jumping up and down andhugging and celebrating. It wasa beautiful moment knowing Iwas coming home for good.”1 Data as of March 20142 According to published information as of April 20143 Data as of May 2014Grenada, West Indies

630.938.0200 • CRMpubs.comSouth Hall, 2nd & 3rd Floors(530) 752-2855icc.ucdavis.edu