Disease cycle of potato late blight - MSpace at the University of ...

More documents

Recommendations

Info

$il\VOLVEMENT OF RETII\OIC ACID II{ - MSpace at the University of ...$

Efactor: Elongation factor StDXS1: 1-deoxy-D-xylulose 5-phosphate synthase DXR: 1-deoxy-D-xylulose 5-phosphate reductoisomerase MCT: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase CMK: 4-(cytidine 50-diphospho)-2-Cmethyl-D-erythritol kinase MDS: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase HDS: (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase SDW: Sterile destilated water Hpi: Hours post inoculation IPP: Isopentenyl diphosphate DMAPP: Dimethylallyl diphosphate MVK: Mevalonate kinase PMK: phosphomevalonate kinase PMD: mevalonate diphosphate decarboxylase XVI
FORWARD This thesis has been written in manuscript style following the guidelines established by the Department of Plant Science at the University of Manitoba. A general introduction and review of the literatures precedes the four manuscripts that comprise the main part of the thesis. Each manuscript consists of an abstract, introduction, materials and methods, results, and discussion. Thereafter, a general summary and conclusions a list of references cited and appendices follow are presented. XVII
Page 1 and 2: Molecular characterization of potat
Page 3 and 4: ABSTRACT Henriquez Maria Antonia. P
Page 5 and 6: ACKNOWLEDGEMENT I would like to tha
Page 7 and 8: CHAPTER 2: IDENTIFICATION AND CLONI
Page 9 and 10: CHAPTER 4: PHYTOPHTHORA INFESTANS E
Page 11 and 12: LIST OF TABLES Table 2.1. Similarit
Page 13 and 14: Figure 4.1. Effect of EPA elicitor
Page 15: SH: subtractive hybridization TDFs:
Page 19 and 20: the use of moderately resistant var
Page 21 and 22: subtropical and temperate environme
Page 23 and 24: FALL Disease Disease cycle cycle of
Page 25 and 26: plant intercellular space (apoplast
Page 27 and 28: signaling cascades, alteration in g
Page 29 and 30: The recent research target in late
Page 31 and 32: (lignin), UV protection (quercetin,
Page 33 and 34: 1.2.5.4.2 Terpenoids pathways Terpe
Page 35 and 36: Isopentenyl diphosphate (IPP) is th
Page 37 and 38: hemiterpenes C5 (1 isoprene unit),
Page 39 and 40: (Tian et al. 2005; Tian et al. 2007
Page 41 and 42: Chapter 4: Phytophthora infestans e
Page 43 and 44: slightly up-regulated in response t
Page 45 and 46: The objective of the current study
Page 47 and 48: days growth in Pea Broth Medium at
Page 49 and 50: 2.3.5. SH- Second Strand synthesis
Page 51 and 52: Second Strand for digestion. Howeve
Page 53 and 54: CAGCTACTTGGGAGGCTGAG-3’ and DL81-
Page 55 and 56: 2.4. RESULTS 2.4.1. Inoculation res
Page 57 and 58: Figure 2.1. Schematic representatio
Page 59 and 60: Figure 2.2. Example of TDFs in a po
Page 61 and 62: espectively. Transcripts DL32 and D
Page 63 and 64: Table 2.1. Similarities between seq
Page 65 and 66: US8 and US11, respectively. qRT-PCR
Page 67 and 68:
and Schmittgen 2001) was used to ca
Page 69 and 70:
Only in RB+US8, the DL21 precursor
Page 71 and 72:
Constitutive gene expression has be
Page 73 and 74:
iosynthesis via the diamino-pimelat
Page 75 and 76:
Further validation of the subtracti
Page 77 and 78:
CHAPTER 3: CLONING AND CHARACTERIZA
Page 79 and 80:
Until recently, it was considered t
Page 81 and 82:
3.3.2. Cloning of DXS cDNA Using th
Page 83 and 84:
3.3.4. Bioinformatic analyses Deduc
Page 85 and 86:
Table 3.1. Primers used for the syn
Page 87 and 88:
StDXS1 has been submitted to the Ge
Page 89 and 90:
Figure 3.2. Alignment of deduced am
Page 91 and 92:
Figure 3.3. Phylogenetic tree of DX
Page 93 and 94:
StDXS1 transcripts in RB+US8 were i
Page 95 and 96:
Fold induction 7 6 5 4 3 2 1 1 0 2
Page 97 and 98:
tentative consensus-TC of Solanum t
Page 99 and 100:
Hevea brasiliensis (HbDXS) two DXS
Page 101 and 102:
This work opens up new perspectives
Page 103 and 104:
4.2 INTRODUCTION Plant pathogens ha
Page 105 and 106:
catalyze the first steps in the bra
Page 107 and 108:
type A2) (kindly provided by Dr. Ad
Page 109 and 110:
synthesis pool from each treatment,
Page 111 and 112:
using a Stratagene Mx3005p cycler,
Page 113 and 114:
with the glucan fraction and then i
Page 115 and 116:
4.4.2. Analysis of variance Data co
Page 117 and 118:
4.4.3 Gene expression analysis in t
Page 119 and 120:
Relative Expression 1.6 1.4 1.2 1 0
Page 121 and 122:
strains D-03 (lineage US11, A1 mati
Page 123 and 124:
Table 4.6. RT-PCR analysis of the r
Page 125 and 126:
There was a down-regulation of StDX
Page 127 and 128:
Figure 4.6. Transcript profiles of
Page 129 and 130:
cultivar Defender (DF+GL+US8). Expl
Page 131 and 132:
(Ac-MVA) pathway, participate in es
Page 133 and 134:
4.5.2.2 Russet Burbank defense resp
Page 135 and 136:
Russet Burbank. With the exception
Page 137 and 138:
CHAPTER 5: ALTERED METABOLIC PROFIL
Page 139 and 140:
pathogen interactions, the cell wal
Page 141 and 142:
at 0, 12, 72, and 120 hours post in
Page 143 and 144:
5.4 RESULTS 5.4.1 Disease developme
Page 145 and 146:
Finally, an early stage of the inte
Page 147 and 148:
Figure 5.3. Chromatograpic profiles
Page 149 and 150:
µg Catechin /g FW µg Catechin /g
Page 151 and 152:
levels of flavonoid (P3) in RB+US11
Page 153 and 154:
Terpenoid (T1) was detected in Russ
Page 155 and 156:
control plant, would be associated
Page 157 and 158:
Flavonoids possess a wide range of
Page 159 and 160:
explanation of such a specific supp
Page 161 and 162:
diaminopimelate aminotransferase wh
Page 163 and 164:
the DOXP-MEP pathway, we detected c
Page 165 and 166:
• Sesquiterpene cyclase (SC) gene
Page 167 and 168:
good disease control strategy. For
Page 169 and 170:
REFERENCES Abramovitch R, Kim Y, Ch
Page 171 and 172:
Chappell J (1995) Biochemistry and
Page 173 and 174:
Daayf F, Platt HW, Peters RD (2000)
Page 175 and 176:
Enyedi AJ, Yalpani N, Silverman P,
Page 177 and 178:
Haas BJ, Kamoun S, Zody MC, Jiang R
Page 179 and 180:
Kamoun S (2005) A catalogue of the
Page 181 and 182:
McGarvey DJ, Croteau R (1995) Terpe
Page 183 and 184:
Pieterse C, de Wit P, Govers F (199
Page 185 and 186:
Sels J, Mathys J, De Coninck BMA, C
Page 187 and 188:
van Loon LC, Rep M, Pieterse CMJ (2
Page 189 and 190:
Yao KN, Deluca V, Brisson N (1995)
Page 191 and 192:
CGCGGCGCGGCGGCCGGGTCATTTGCCCAGCTTTC
Page 193 and 194:
Sequence GGCATGAAATGCATCGGGTGGAGTAA
Page 195 and 196:
TCCCTTGGGCATGGTCCCCTCAGTTATACTTCGTG
Page 197 and 198:
Sequence CTGAGGCGAGTGGCAGAAACTAATAC
Page 199 and 200:
EST#: DL127 Sequence CCTGGGTGGGGCCG
Page 201 and 202:
TCAGTCGCTATTTTAGGTGGCGATGGTAGCGTACT
Page 203 and 204:
MALCAYAFPGILNRTAVVSDSSKTAPLFSEWIHGT
Page 205 and 206:
Appendix 3 (Chapter 3) Defender Eco
show all

Disease cycle of potato late blight - MSpace at the University of ...

Create successful ePaper yourself

Delete template?

Save as template?