- Page 1 and 2: Molecular characterization of potat
- Page 3 and 4: ABSTRACT Henriquez Maria Antonia. P
- Page 5: ACKNOWLEDGEMENT I would like to tha
- Page 9 and 10: CHAPTER 4: PHYTOPHTHORA INFESTANS E
- Page 11 and 12: LIST OF TABLES Table 2.1. Similarit
- Page 13 and 14: Figure 4.1. Effect of EPA elicitor
- Page 15 and 16: SH: subtractive hybridization TDFs:
- Page 17 and 18: FORWARD This thesis has been writte
- Page 19 and 20: the use of moderately resistant var
- Page 21 and 22: subtropical and temperate environme
- Page 23 and 24: FALL Disease Disease cycle cycle of
- Page 25 and 26: plant intercellular space (apoplast
- Page 27 and 28: signaling cascades, alteration in g
- Page 29 and 30: The recent research target in late
- Page 31 and 32: (lignin), UV protection (quercetin,
- Page 33 and 34: 1.2.5.4.2 Terpenoids pathways Terpe
- Page 35 and 36: Isopentenyl diphosphate (IPP) is th
- Page 37 and 38: hemiterpenes C5 (1 isoprene unit),
- Page 39 and 40: (Tian et al. 2005; Tian et al. 2007
- Page 41 and 42: Chapter 4: Phytophthora infestans e
- Page 43 and 44: slightly up-regulated in response t
- Page 45 and 46: The objective of the current study
- Page 47 and 48: days growth in Pea Broth Medium at
- Page 49 and 50: 2.3.5. SH- Second Strand synthesis
- Page 51 and 52: Second Strand for digestion. Howeve
- Page 53 and 54: CAGCTACTTGGGAGGCTGAG-3’ and DL81-
- Page 55 and 56: 2.4. RESULTS 2.4.1. Inoculation res
- Page 57 and 58:
Figure 2.1. Schematic representatio
- Page 59 and 60:
Figure 2.2. Example of TDFs in a po
- Page 61 and 62:
espectively. Transcripts DL32 and D
- Page 63 and 64:
Table 2.1. Similarities between seq
- Page 65 and 66:
US8 and US11, respectively. qRT-PCR
- Page 67 and 68:
and Schmittgen 2001) was used to ca
- Page 69 and 70:
Only in RB+US8, the DL21 precursor
- Page 71 and 72:
Constitutive gene expression has be
- Page 73 and 74:
iosynthesis via the diamino-pimelat
- Page 75 and 76:
Further validation of the subtracti
- Page 77 and 78:
CHAPTER 3: CLONING AND CHARACTERIZA
- Page 79 and 80:
Until recently, it was considered t
- Page 81 and 82:
3.3.2. Cloning of DXS cDNA Using th
- Page 83 and 84:
3.3.4. Bioinformatic analyses Deduc
- Page 85 and 86:
Table 3.1. Primers used for the syn
- Page 87 and 88:
StDXS1 has been submitted to the Ge
- Page 89 and 90:
Figure 3.2. Alignment of deduced am
- Page 91 and 92:
Figure 3.3. Phylogenetic tree of DX
- Page 93 and 94:
StDXS1 transcripts in RB+US8 were i
- Page 95 and 96:
Fold induction 7 6 5 4 3 2 1 1 0 2
- Page 97 and 98:
tentative consensus-TC of Solanum t
- Page 99 and 100:
Hevea brasiliensis (HbDXS) two DXS
- Page 101 and 102:
This work opens up new perspectives
- Page 103 and 104:
4.2 INTRODUCTION Plant pathogens ha
- Page 105 and 106:
catalyze the first steps in the bra
- Page 107 and 108:
type A2) (kindly provided by Dr. Ad
- Page 109 and 110:
synthesis pool from each treatment,
- Page 111 and 112:
using a Stratagene Mx3005p cycler,
- Page 113 and 114:
with the glucan fraction and then i
- Page 115 and 116:
4.4.2. Analysis of variance Data co
- Page 117 and 118:
4.4.3 Gene expression analysis in t
- Page 119 and 120:
Relative Expression 1.6 1.4 1.2 1 0
- Page 121 and 122:
strains D-03 (lineage US11, A1 mati
- Page 123 and 124:
Table 4.6. RT-PCR analysis of the r
- Page 125 and 126:
There was a down-regulation of StDX
- Page 127 and 128:
Figure 4.6. Transcript profiles of
- Page 129 and 130:
cultivar Defender (DF+GL+US8). Expl
- Page 131 and 132:
(Ac-MVA) pathway, participate in es
- Page 133 and 134:
4.5.2.2 Russet Burbank defense resp
- Page 135 and 136:
Russet Burbank. With the exception
- Page 137 and 138:
CHAPTER 5: ALTERED METABOLIC PROFIL
- Page 139 and 140:
pathogen interactions, the cell wal
- Page 141 and 142:
at 0, 12, 72, and 120 hours post in
- Page 143 and 144:
5.4 RESULTS 5.4.1 Disease developme
- Page 145 and 146:
Finally, an early stage of the inte
- Page 147 and 148:
Figure 5.3. Chromatograpic profiles
- Page 149 and 150:
µg Catechin /g FW µg Catechin /g
- Page 151 and 152:
levels of flavonoid (P3) in RB+US11
- Page 153 and 154:
Terpenoid (T1) was detected in Russ
- Page 155 and 156:
control plant, would be associated
- Page 157 and 158:
Flavonoids possess a wide range of
- Page 159 and 160:
explanation of such a specific supp
- Page 161 and 162:
diaminopimelate aminotransferase wh
- Page 163 and 164:
the DOXP-MEP pathway, we detected c
- Page 165 and 166:
• Sesquiterpene cyclase (SC) gene
- Page 167 and 168:
good disease control strategy. For
- Page 169 and 170:
REFERENCES Abramovitch R, Kim Y, Ch
- Page 171 and 172:
Chappell J (1995) Biochemistry and
- Page 173 and 174:
Daayf F, Platt HW, Peters RD (2000)
- Page 175 and 176:
Enyedi AJ, Yalpani N, Silverman P,
- Page 177 and 178:
Haas BJ, Kamoun S, Zody MC, Jiang R
- Page 179 and 180:
Kamoun S (2005) A catalogue of the
- Page 181 and 182:
McGarvey DJ, Croteau R (1995) Terpe
- Page 183 and 184:
Pieterse C, de Wit P, Govers F (199
- Page 185 and 186:
Sels J, Mathys J, De Coninck BMA, C
- Page 187 and 188:
van Loon LC, Rep M, Pieterse CMJ (2
- Page 189 and 190:
Yao KN, Deluca V, Brisson N (1995)
- Page 191 and 192:
CGCGGCGCGGCGGCCGGGTCATTTGCCCAGCTTTC
- Page 193 and 194:
Sequence GGCATGAAATGCATCGGGTGGAGTAA
- Page 195 and 196:
TCCCTTGGGCATGGTCCCCTCAGTTATACTTCGTG
- Page 197 and 198:
Sequence CTGAGGCGAGTGGCAGAAACTAATAC
- Page 199 and 200:
EST#: DL127 Sequence CCTGGGTGGGGCCG
- Page 201 and 202:
TCAGTCGCTATTTTAGGTGGCGATGGTAGCGTACT
- Page 203 and 204:
MALCAYAFPGILNRTAVVSDSSKTAPLFSEWIHGT
- Page 205 and 206:
Appendix 3 (Chapter 3) Defender Eco