Home Advice . Seniors Fall 2023

HOMEADVICE
1

2 HOMEADVICE

Home Advice Is Now
Booking for:
@REALHOMEADVICE
When requiring services, whether it be realtors, builders,
contractors or more, we ask that you remember the businesses
featured in this publication are the best in the industry.
All rights reserved by Home Advice.
Reproduction or transmission of all or any part of this publication
by any means is strictly forbidden without the prior
written consent of Real Home Advice. Although great detail
and attention is taken to avoid any ad copy or editorial errors,
any errors or omissions on the part of the publisher are
limited and dealt with solely by printing a letter of retraction
and/or correction in the following editions.
DESIGNED AND PUBLISHED BY RHAMEDIA
CONTACT:
Phone: 1-780-406-6441
Email: adcopy@realhomeadvice.ca
Read Online:
January Edition Calgary
and Edmonton Dec 15-
2023
February Edition Calgary
and British Columbia Feb
01- 2024
March Edition Edmonton
and Winnipeg March 04
-2024
780.406.6441
adcopy@realhomeadvice.ca
Reach thousands of
Homeowners
and 50+ people with Home Advice
Digital and Print Magazines
Averaging over 60,000 digital readers
a year with Yumpu and Magzter
HOMEADVICE
3

Introducing Home Advice
Seniors: Enriching
Perspectives, Honoring
In the tapestry of life, the threads of experience, insight, and
wisdom woven by our seniors hold a special place. These are
the individuals who have weathered the storms and savored the
sunshine, carrying with them a wealth of knowledge that spans
generations. It is with great anticipation and enthusiasm that we
announce the inception of a new section in our magazine—a
dedicated space for senior advice.In a world often fixated on
the latest trends and the fastest pace, the voices of our elders
can get lost in the shuffle. We tend to overlook the treasure
trove of guidance that can be garnered from their stories and
lessons learned. This senior advice section aims to change that,
bridging the generational gap and fostering a greater sense of
understanding and appreciation.The wisdom that accompanies
age is unparalleled. Lifetimes of experiences, challenges, triumphs,
and growth culminate in a mosaic of insights that cannot be
replicated. From navigating personal relationships to handling
professional endeavors, our seniors have encountered a myriad
of situations that have sculpted them into beacons of sagacity.
Through this dedicated section, we provide them with a platform
to share their pearls of wisdom, offering guidance to younger
generations embarking on similar journeys.Moreover, this senior
advice section is not merely about one-way communication; it is a
testament to the power of intergenerational dialogue. In a society
where rapid technological advancements sometimes threaten
to create divisions, providing a space for seniors to share their
advice fosters a sense of unity. It encourages readers to pause and
listen, to recognize the shared human experience that transcends
age, and to value the contributions of every age group.Imagine
a reader seeking counsel on balancing a demanding career with
family responsibilities. Instead of resorting solely to modern
self-help resources, they can now turn to the words of a senior
who managed a similar feat decades ago. The advice might be
practical, emotional, or a blend of both, offering a perspective that
goes beyond the pages of a textbook or the pixels of a screen. Such
guidance is invaluable, as it combines the lessons of the past with
the aspirations of the present, forming a roadmap for the future.
Our commitment to introducing a senior advice section stems
from a deep respect for the rich tapestry of human experience. As
we embark on this new endeavor, we invite our readers to embrace
the unique opportunity it presents—to learn, to connect, and
to cherish the voices that have traversed the sands of time. The
stories and insights shared within these pages are not just for the
benefit of one generation, but for the enrichment of all who seek to
navigate the complex labyrinth of life.Incorporating a senior advice
section into our magazine is an acknowledgment that age is not a
barrier, but a bridge—one that unites the past, present, and future.
Through these shared narratives, we hope to inspire, educate, and
celebrate the journey of life in all its stages.
4 HOMEADVICE

NOW ACCEPTING
RENTAL APPLICATIONS
Vista Housing for Seniors provides affordable housing options in Edmonton, for low
to modest income Seniors Citizens who are able to live independently in an apartment
setting. Rent is calculated based on 30% of your household income
Applications are available online, through our main office or at our
properties.
South East Edmonton
Central Baptist Manor 9403-95 Avenue
Millbourne Manor 2115 Millbourne Rd W.
Bethel Seniors Residence 7728-82 Avenue
St. Andrews Selo
8025 – 101 Avenue
North East Edmonton
Norwood Golden Manor 11715-95 Street
Casa Romana
13439-97 Street
St. Elia’s Pysanka Manor 11906-66 Street
Tower 1
12840-64 Street
Viselka
114515-86 Street
North West Edmonton
Alliance Villa
12620-109A Avenue
Calder Place
12934119 Street
Chinese Alliance Manor 9312-149 Street
Mary A. Finlay Manor 10209-134 Avenue
Ortona Villa
10421-142 Street
Central Edmonton
Piazza Italia
9521-108A Avenue
Dnipro Seniors Residence 11030 – 107 Street
Independent Living
Apartments for Low Income
Seniors
16 Properties are located in
the City of Edmonton
Bachelor, 1 Bedroom and 2
Bedroom Apartments
All properties certified by
the Edmonton City Police
Crime Free Multi Housing
Program
Well Maintained, Safe,
Secure Buildings.
(780) 476-1470
Vista Housing for Seniors
11622- 119 Street
Edmonton, AB www.
vistahousing.org
HOMEADVICE
5

Home Advice Seniors - Fall 2023
Renovate with confidence!
EMPOWERING HOMEOWNERS GET THROUGH THEIR RENOVATIONS,
STRESS FREE!
Proud Team of Vetted Sub-Contractors
for any renovation project.
Bring Your Vision To Life & Save Thousands
CALL TODAY
For Free In-House Consultation 587-277-9636
6 HOMEADVICE

HOMEADVICE
7

The Power of Practice:
Unveiling the Potential for
Seniors
In the ever-evolving symphony of life,
every note represents an opportunity for
personal growth and transformation. As
the years roll by and we find ourselves in
the embrace of our golden years, the notion
that the power of practice is the exclusive
domain of youthful enthusiasm could not
be further from the truth. Indeed, it holds
an equally vital place in the lives of seniors.
The age-old adage, “practice makes perfect,”
transcends generational boundaries,
warmly embracing seasoned individuals
who persistently flourish through their
unwavering dedication and unwavering
perseverance.
In a world that occasionally overlooks
the remarkable capabilities of seniors,
embracing the power of practice becomes
a profound tribute to the indomitable
spirit that defies age-related stereotypes.
Seniors who commit themselves to
deliberate practice, whether they embark
on the journey of mastering a new musical
instrument or immerse themselves in the
intricacies of digital technology, experience
the thrill of progress and the profound joy
of accomplishment.
The cognitive benefits of continuous
practice are nothing short of extraordinary.
Research consistently underscores the
brain’s remarkable plasticity, which remains
undiminished by the passage of time.
Engaging in regular mental exercises, such
as tackling intricate puzzles or immersing
oneself in the acquisition of a new language,
empowers seniors to enhance memory
retention, sharpen their problem-solving
acumen, and maintain cognitive agility.
8 HOMEADVICE
But the power of practice doesn’t stop
at the realm of intellect; it profoundly
enriches emotional and physical wellbeing.
Engaging in activities that resonate
with personal passions nurtures an
enduring sense of purpose and belonging.
Whether it’s cultivating a flourishing
garden, perfecting culinary skills, or
expressing artistic creativity with fervor,
these practiced endeavors infuse life with
vibrancy, meaning and occasionally a
Championship.
Such was the case in August when after
seven years I finally won the A Event
Championship (6 Wins - 0 Losses) at
the 41st Osoyoos Midsummer Bonspiel.
Although I had not thrown a curling
rock since April, it was the extra training
from last winter that assisted my peak
performance this summer. The symphony
of life, in its infinite wisdom, recognizes
68 as just a number; it is the unwavering
dedication to practice that composes a
legacy of resilience, boundless growth and
the relentless pursuit of excellence.
So how can seniors harness the power of
practice to unlock their full potential?
1. Embrace Lifelong Learning
Seniors should see themselves as perpetual
learners. Whether it’s acquiring a new
talent, perfecting an old skill, exploring a
new subject, or diving into a hobby, the
pursuit of knowledge and mastery should
be ongoing. The joy of learning never
diminishes with age.
2. Rediscover Passions
Many seniors may have set aside their
passions in the hustle and bustle of life.
Now is the time to rekindle those flames.
Whether it’s scriptwriting, playing pickle
ball, gardening, volunteering, trick roping,
inventing a special device or any other
passion, practice and nurture these interests
to experience a renewed sense of purpose
and fulfillment.
3. Stay Physically Active
Physical health is the foundation of a
fulfilling life. Engaging in regular physical
activity not only improves fitness but also
boosts mood and cognitive function. I
invite you to explore activities like yoga,
aquatic fitness, tai chi, gental fitness, stick/
wheelchair curling, or take daily walks
to keep your body resilient, agile and
maintaining wellness.
“Do what keeps you young at heart.”
Dr. Neville Headley, DDS
403.300.3232
info@christiecrossingdental.com

I’M
LIVING
WELL
by not cooking
unless I want to
- and I really
don’t want to.
TM
Calgary’s Best New Active
Aging Retirement Community
Joyful retirement doesn’t just happen – it’s a choice. That’s why at
Trico LivingWell, we chose to put the best of everything into our
new seniors’ residence in south Calgary. From wellness to dining,
and amenities to our spacious suites, the only thing missing is you.
Come join our amazing community – and bring your appetite too.
HURRY IN - NOW LEASING FINAL PHASE!
CHOOSE FROM
Stylish new studio,
1 bedroom,
1 bedroom + den
& 2 bedroom suites
INDEPENDENT
LIVING from
$3,435
/month
ASSISTED
LIVING from
$4,610
/month
Visit us today:
7670 - 4A Street SW
Now open!
Reserve your
suite today!
403.281.2802
tricolivingwell.com
INDEPENDENT LIVING • ASSISTED LIVING • DEMENTIA CARE
HOMEADVICE
9

Peripheral Neuropathy Breakthrough!
“My feet feel like they’re on fire.”
“Each step feels like I’m walking
through wet paint.”
“I live in constant fear that I’ll fall.”
“I can't sleep, my hands and feet tingle
all night.”
What do all of these people have in
common? They suffer from peripheral
neuropathy. It’s estimated that thousands
of people in Canada have peripheral
neuropathy.
Dr. Melanie Morrill Ac. of Accessible
Acupuncture in Edmonton, AB suspects
there are even more. “I’ve been treating
neuropathy, in all its various forms, for
over five years and so often my patients
come to me because of the symptoms,
not because of a diagnosis. They read the
testimonial of another patient and say to
themselves ‘hey, I feel the same thing’.”
Shirley of Downtown Edmonton testified
to this. “I remember my husband driving
me to my consultation and I saw a woman
running just outside our neighbourhood. I
was so envious - I just kept thinking ‘I
would give anything just to walk again’.
My primary care doctor told me my
troubles with pain and balance were just
symptoms of old age. I was so
depressed.”
Fortunately, Shirley would eventually see
Dr. Melanie Morrill Ac. on the local news
talking about similar symptoms and how
she offers a real solution at Accessible
Acupuncture. “I just knew I had to see her.
She was my last hope.”
“Almost all of our patients come to us with
a story similar to Shirley’s. They’ve been
everywhere else. They’ve been told
there’s no hope. They’ve been told ‘it’s
just part of getting older.” shares Kelly, a
Patient Care Coordinator at Accessible
Acupuncture. “It just breaks my heart but I
know how much we can help people like
Shirley so I’m always so happy when they
walk through our door.”
Those diagnosed with peripheral
neuropathy often face a very grim reality;
Western medicine declares that there is
no solution while most alternative
therapies carry large price tags and offer
little to no resolve. Which is why Dr.
Melanie Morrill Ac. and the staff at
Accessible Acupuncture pride
themselves on being ‘the last resort with
the best results".
Peripheral neuropathy is a result of
damage to the nerves and this damage
is commonly caused by a lack of blood
flow in the hands and feet.
Peripheral Neuropathy?
SCHEDULE a consultation TODAY
C A L L 5 8 7 - 8 7 9 - 7 1 2 2
10 HOMEADVICE
A lack of blood flow results in a lack of
nutrients; the nerves then begin to
degenerate and die which causes pain
ranging from discomfort to
debilitating. Because neuropathy is a
degenerative condition, once those
nerves begin to deteriorate they will
continue to do so until they are
completely expired, leaving those
suffering with crippling balance issues.
“In this case, the absence of pain is not
necessarily a good thing.” shares Dr.
Melanie Morrill Ac. “This usually
indicates that your nerves are hanging
on by a fragile thread.”
How exactly is Dr. Melanie Morrill Ac.
able to reverse the effects of this
degenerative disease? “Acupuncture
has been used to increase blood flow
for thousands of years which helps to
get the necessary nutrients to the
affected nerves. But the real magic
happens when I integrate ATP
Resonance BioTherapy. This is a
technology that was originally
developed by NASA to expedite
recovering and healing.”
“I just can’t say enough about
Accessible Acupuncture,” Shirley
shared through tears of joy. “My
husband and I moved here 3 years
ago and he’s gone to the river valley
almost every day to walk. I always
stayed home because of the pain
and discomfort. Yesterday I walked
beside the river with him! And next
week we’re starting square dancing
again! I am truly living life these
days.”
“According to Shirley’s test results, she
has seen a 74% improvement in pain
and functionality, which is on par with
a majority of our patients,” Shares
Kelly.
“But more important than those test
results is the joy she’s expressed
being here and hearing about all the
amazing things she’s able to do
because she feels great!”
By seamlessly blending the ancient
science of acupuncture with modern
medical solutions Dr. Melanie Morrill
Ac. has achieved a 90% success rate in
reversing the effects of neuropathy.
She starts each patient with an initial
consultation during which a sensory
exam is performed.
“This not only aids in making a proper
diagnosis but it helps to define just
how much nerve damage has
occurred,” tells the Doctor of
Acupuncture. “This is important
because if a patient has suffered more
than 95% damage, there is little that I
can do to help them. I’m familiar with
the medical miracle but I know my
limits as a practitioner and the limits of
my medicine.”
When it comes to treating peripheral
neuropathy, regardless of its origin,
early detection greatly improves your
chances of a full recovery.
If you or someone you love are
suffering from chronic pain that
presents as burning, tingling or ‘pins
and needles' or you’ve recently been
diagnosed with peripheral neuropathy,
it’s important to know that there are
options.
There is hope!
Accessible Acupuncture is now
accepting new patients but only for a
limited time. Only 10 new neuropathy
patients will be accepted each month.
Call 587-879-7122 to schedule.
HYS Centre
600, 11010 101 st NW Edmonton, AB
AccessibleAcupuncture.ca

Moving houses is a
significant undertaking at
any age,
but for seniors, it requires extra
consideration and planning to ensure a
smooth transition. Here are essential tips
to help seniors navigate the process with
minimal stress and maximum ease.
1. Start Early: Time is your ally. Begin the
process well in advance, allowing ample
time for sorting through belongings,
making decisions, and hiring movers if
necessary. Procrastination can lead to
rushed decisions and unnecessary stress.
2. Create a Plan: Craft a detailed moving
plan that outlines tasks, deadlines, and
a checklist of items that need attention.
Having a structured approach will help you
stay organized and reduce the feeling of
being overwhelmed.
3. Downsize Wisely: Over the years,
possessions accumulate. Take this
opportunity to declutter by identifying
items you truly need or cherish. Consider
donating, selling, or gifting items that no
longer serve a purpose, making the move to
a new home more manageable.
4. Prioritize Accessibility: If health or
mobility issues are a concern, prioritize
finding a new house that is accessible and
safe. Single-story homes or properties with
features like ramps, handrails, and wider
doorways can make daily life easier.
5. Seek Professional Help: Enlist the
assistance of professional moving
companies experienced in senior
relocations. They can handle logistics,
packing, and heavy lifting, reducing
physical strain on you.
6. Preserve Memories: While downsizing,
it’s important to keep sentimental items that
hold precious memories. These objects can
provide a sense of familiarity and comfort
in your new environment.
7. Notify Important Parties: Ensure a
seamless transition by updating your
address with the post office, banks,
healthcare providers, and any other relevant
institutions. This will prevent important
mail from being lost.
8. Pack an Essentials Box: Pack a box with
essentials such as medications, toiletries,
important documents, a change of clothes,
and personal items. This will save you from
rummaging through boxes during the first
days in your new home.
9. Embrace the Change: Moving can be
emotionally challenging, but it also marks a
fresh start. Embrace the new opportunities
your new house and neighborhood offer.
Engage in local activities to meet new
people and build a sense of community.
10. Accept Help: Don’t hesitate to ask
friends, family, or neighbors for assistance.
Moving is a team effort, and loved ones are
often more than willing to lend a hand.
In conclusion, moving houses as a senior
necessitates careful planning and a patient
approach. By starting early, downsizing
thoughtfully, seeking professional help, and
embracing the change, the moving process
can be transformed into a positive and
exciting step toward a new chapter in life.
Guest post written by Gail Labine
780.998.2422
office@fortmoving.ca
HOMEADVICE
11

Edmonton: A Vibrant City of
Diversity and Opportunity
Nestled along the banks of the North Saskatchewan River in
Alberta, Canada, lies the dynamic and culturally rich city of
Edmonton. With a population exceeding one million residents,
Edmonton stands as the capital of Alberta and is the province’s
second-largest city. It is a city renowned for its stunning natural
landscapes, thriving economy, and diverse community, making it a
unique and appealing destination for residents and visitors alike.
One of Edmonton’s most distinguishing features is its natural
beauty. The city boasts an array of parks and green spaces that
offer a serene escape from the hustle and bustle of urban life.
Hawrelak Park, situated in the heart of the city, is a popular spot
for picnics, paddle boating, and outdoor concerts in the summer,
while the river valley system provides an extensive network of
trails for hiking and biking throughout the year. Edmonton’s
appreciation for nature is evident in the Muttart Conservatory,
an iconic glass pyramid structure housing a vast collection of
botanical specimens from around the world.
The city’s thriving economy serves as a testament to its resilience
and adaptability. Historically known as the “Oil Capital of Canada,”
Edmonton’s economy has diversified significantly over the years.
It now encompasses industries such as healthcare, education,
technology, and manufacturing. The presence of institutions
like the University of Alberta and the Alberta Research Council
has nurtured a culture of innovation and research, fostering the
growth of cutting-edge technologies and startups.
Edmonton’s commitment to inclusivity and diversity is reflected
in its multicultural communities. People from all corners of the
world have made Edmonton their home, contributing to a vibrant
tapestry of cultures and traditions. The city celebrates this diversity
through numerous cultural festivals and events, such as the
Heritage Festival, which showcases cuisine, art, and performances
from over 100 countries. Sporting enthusiasts find plenty to cheer
for in Edmonton, thanks to the city’s passionate support for its
sports teams. The Edmonton Oilers, an NHL hockey team, and
the Edmonton Eskimos (now known as the Edmonton Elks), a
Canadian Football League team, have loyal fan bases that create an
electric atmosphere during games. Additionally, the city is home
to the Edmonton Oilers’ stunning arena, Rogers Place, which
hosts not only sporting events but also world-class concerts and
entertainment shows.
In conclusion, Edmonton is a city that embraces its natural
beauty, diverse culture, economic vitality, and community spirit.
Whether you’re drawn to its stunning natural landscapes, seeking
career opportunities in a thriving job market, or simply looking
to immerse yourself in a rich tapestry of cultures, Edmonton has
something to offer everyone. It is a city that continually evolves
while staying true to its roots, making it a remarkable place to live.
OUR SERVICES:
Gas Fireplaces
Wood Fireplaces
Fireplace Mantels
Fireplace Surroundings
Wood Stoves
Competitive prices
The
Fireplace
Guy
780.974.7689
Edmonton, AB
12 HOMEADVICE

HOMEADVICE
13

Ennnneeeeeerrrrrrrggyy---
EF>@iiieeeeeennnn<
Wiiinnnnddddooowss
aaaaannnndddd
Coomppplleeeeeettttteeeeee Wiinnndoow & Doooorrr
Seeeeeerrrviiceeeeeessss
EddddNooonnnnMooonnnn
1111111144444477444444 WWWiiiiiiicnnnnnnnntttttttteeeeeeeerrrrrrrrbbuuuuuuurrrrrrrrnnnnnnnn RRRdddddddd NNWWW
EEddddddddmmmmmmmoooooooonnnnnnnnttttttttoooooooonnnnnnnn,,,,,, AAAAABBBB TTT555555SSS 22222Y33
(777780)
4557777---95577777777
DDoooooorrrrrrrss
Caaaaalggaaaaarrrrrrryy
444444822222444444 55555522222 SSStttttttt. SSSEE
CCaaaaaaaalllllgggggaaaaaaaarrrrrrrryyyyyyy,,,,,, AAAAABBBB TTT22222BBBB 33RRR22222
(40–) 407777--- 4557777
Prrroofeeeeeessssssssiioonnnaaaaa lllly
Innnsssstttttaaaaa lllleeeeeerrrssss
Geeeeeettttt uuppp tttttoo
$5000000000000000
iinnn
Reeeeeebbaaaaattttteeeeeessss!
WWWiiiiiiictttttttthhhhhhhh tttttttthhhhhhhheeeeeeee CCaaaaaaaannnnnnnnaaaaaaaaddddddddaaaaaaaa GGrrrrrrrreeeeeeeeeeeeeeeennnnnnnneeeeeeeerrrrrrrr Hoooooooommmmmmmeeeeeeeessssssss
GGrrrrrrrraaaaaaaannnnnnnntttttttt,,,,,, yyyyyyyoooooooouuuuuuu cccciccaaaaaaaannnnnnnn rrrrrrrreeeeeeeeccccicceeeeeeeeiiiiiiicvvvveeeeeeee uuuuuuupppp ttttttttoooooooo $555555000000000000
iiiiiiicnnnnnnnn rrrrrrrreeeeeeeebbaaaaaaaatttttttteeeeeeeessssssss ttttttttoooooooo uuuuuuuppppgggggrrrrrrrraaaaaaaaddddddddeeeeeeee yyyyyyyoooooooouuuuuuurrrrrrrr hhhhhhhhoooooooommmmmmmeeeeeeee
wwwwiiiiiiictttttttthhhhhhhh nnnnnnnneeeeeeeewwww,,,,,, ssssssssttttttttyyyyyyyllllliiiiiiicsssssssshhhhhhhh,,,,,, eeeeeeeennnnnnnneeeeeeeerrrrrrrrgggggyyyyyyy-eeeeeeeeffccccicciiiiiiiceeeeeeeennnnnnnntttttttt
Trrr aaaaaiinnneeeeee d
Reeeeeedddd
wwwwiiiiiiicnnnnnnnnddddddddoooooooowwwwssssssss aaaaaaaannnnnnnndddddddd ddddddddoooooooooooooooorrrrrrrrssssssss.
DDeeeeeeeeeeeerrrrrrr
55555555555511111111 5555550000 AAAAAvvvveeeeeeee
RRReeeeeeeedddddddd Deeeeeeeeeeeeeeeerrrrrrrr,,,,,, AAAAABBBB TTT444444NN 77AAAAA444444
(40–) 407777---± 55
Ennneeeeeerrrgy ---Stttttaaaaarrr
Liiceeeeeennnsssseeeeee d & Innnssssuu rrreeeeeed 10000000000% Cuusssstttttoomeeeeeerrr Saaaaatttttiissss faaaaactttttiioonnn Waaaaarrrrrraaaaannnttttty
Raaaaattttteeeeee d
Grrrrrrraaaaannnnddddeeeeee
Prrrrrrraaaaaiiirrrrrrriiieeeeee
11111111000022222555555 8Ø AAAAAvvvveeeeeeee Ðnnnnnnnniiiiiiictttttttt Ç111111110000
GGrrrrrrrraaaaaaaannnnnnnnddddddddeeeeeeee Ñrrrrrrrraaaaaaaaiiiiiiicrrrrrrrriiiiiiiceeeeeeee,,,,,, AAAAABBBB TTT8Ê 555555BBBBØ
(5587777)
8±8---5555557777
Wiinnndoow Maaaaa rrrttttt iissss ppp rrroouud tttttoo bbeeeeee ttttt heeeeee
lleeeeeeaaaaa diinnng ppprrrooviideeeeeerrr oof wiinnndoowssss aaaaannn d
doooorrrssss iinnn Allbbeeeeeerrrtttttaaaaa. Weeeeee sssspppeeeeee ciiaaaaalliizeeeeee iinnn
hiigh---quuaaaaalliittttty aaaaannnd eeeeeennneeeeee rrrgy ---eeeeeefciieeeeeennnttttt
wiinnndoowssss , doooo rrrssss, aaaaannn d wiinnn doow
cooveeeeeerrriinnngssss. Ouurrr iinnnsssstttttaaaaa llllaaaaatttttiioonnn ttttteeeeeeaaaaa mssss
aaaaarrreeeeee iinnn duusssstttttrrry---tttttrrraaaaaiinnneeeeee d aaaaannn d weeeeee llll
eeeeeexpppeeeeeerrriieeeeeennnceeeeeed iinnn aaaaa llll tttttypppeeeeeessss oo f wiinnndoow
aaaaannnd doooo rrr rrreeeeeepppllaaaaaceeeeeemeeeeeennnttttt ppp rrroojeeeeeectttttssss.
WWWiiiiiiicnnnnnnnnddddddddoooooooowwww Maaaaaaaarrrrrrrrtttttttt hhhhhhhhaaaaaaaassssssss tttttttthhhhhhhheeeeeeee eeeeeeee xppppeeeeeeeerrrrrrrriiiiiiiceeeeeeeennnnnnnnccccicceeeeeeee aaaaaaaannnnnnnndddddddd eeeeeeee xppppeeeeeeeerrrrrrrrttttttttiiiiiiicsssssssseeeeeeee ttttttttoooooooo ttttttttaaaaaaaa keeeeeeee
oooooooonnnnnnnn eeeeeeeevvvveeeeeeeennnnnnnn tttttttthhhhhhhheeeeeeee mmmmmmmoooooooosssssssstttttttt ccccicchhhhhhhhaaaaaaaalllllllllleeeeeeeennnnnnnngggggiiiiiiicnnnnnnnnggggg wwwwiiiiiiicnnnnnnnnddddddddoooooooowwww oooooooorrrrrrrr ddddddddoooooooooooooooorrrrrrrr
iiiiiiicmmmmmmmpppprrrrrrrroooooooovvvveeeeeeeemmmmmmmeeeeeeeennnnnnnntttttttt pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt wwwwiiiiiiictttttttthhhhhhhh cccciccoooooooonnnnnnnnfddddddddeeeeeeeennnnnnnnccccicceeeeeeee. WWWeeeeeeee ooooooooffeeeeeeeerrrrrrrr
cccciccoooooooommmmmmmppppllllleeeeeeeemmmmmmmeeeeeeeennnnnnnnttttttttaaaaaaaarrrrrrrryyyyyyy eeeeeeeessssssssttttttttiiiiiiicmmmmmmmaaaaaaaattttttttiiiiiiicoooooooonnnnnnnn sssssssseeeeeeeerrrrrrrrvvvviiiiiiicccccicceeeeeeeessssssss ttttttttoooooooo eeeeeeeennnnnnnnssssssssuuuuuuurrrrrrrreeeeeeee yyyyyyyoooooooouuuuuuu aaaaaaaarrrrrrrreeeeeeee
cccciccoooooooommmmmmmfoooooooorrrrrrrrttttttttaaaaaaaabbllllleeeeeeee gggggooooooooiiiiiiicnnnnnnnnggggg aaaaaaaahhhhhhhheeeeeeeeaaaaaaaadddddddd wwwwiiiiiiictttttttthhhhhhhh yyyyyyyoooooooouuuuuuurrrrrrrr pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt.
wwwwwwwwwwwwwww..wwwwwindowwwwwmaart ..caa
14 HOMEADVICE

Ennnnnnnntttttrrrrrrrryyy DDoooooooooooooooorrrrrrrrsssssss Paaaaatttttiiiiiiiioooooooo DDoooooooooooooooorrrrrrrrsssssss
CCCrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee se eissshcoooooopliylllluuuuuuuutna stttwniiiiiihcooooooaeainnnn ffffffffhcoooooorrrrrrrr ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee wniiiiiise eisss mmllheeea h aaaase eisssntyyyyyy wwwwwwwwniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ndddddddhcoooooohcoooooorrrrrrrrse eisss
ggggggggpliylllla h aaaase eisssse eisss wniiiiiiaeainnnnse eisssmmllheeerrrrrrrrtna stttse eisss,,,,,,,l pliyllllhcooooooccccccckk se eisssmmllheeetna stttse eisss,,,,,,,l ndddddddhcoooooohcoooooorrrrrrrr tshhhhha h aaaaaeainnnnndddddddpliyllllmmllheeese eisss,,,,,,,l mpppppppuuuuuuuupliyllllpliyllll bbbbbbbaa h aaaarrrrrrrrse eisss a h aaaaaeainnnnnddddddd oeommmmma h aaaaaeainnnnntyyyyyy hcooooootna sttttshhhhhmmllheeerrrrrrrr ndddddddhcoooooohcoooooorrrrrrrr hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eissse......y
OOuuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff tshhhhhwniiiiiiggggggggtshhhhh---qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy,,,,,,,l mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnntna sttt,,,,,,,l a h aaaaaeainnnnnddddddd bbbbbbbammllheeea h aaaauuuuuuuutna stttwniiiiiiffffffffuuuuuuuupliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss ccccccchcooooooaeainnnnse eissswniiiiiise eissstna stttse eisss hcooooooffffffff
ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll ndddddddhcoooooohcoooooorrrrrrrrse eissse......y A pliyllllpliyllll hcoooooouuuuuuuurrrrrrrr ndddddddhcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggntyyyyyy a h aaaaaeainnnnnddddddd
oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eissse......y OOuuuuuuuurrrrrrrr mmllheeexxxexcccccccpliylllluuuuuuuuse eissswniiiiiivvvvvvvommllheee ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheeese eisss mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll
mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l nddddddduuuuuuuurrrrrrrra h aaaabbbbbbbawniiiiiipliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd ffffffffuuuuuuuuaeainnnnccccccctna stttwniiiiiihcooooooaeainnnna h aaaapliyllllwniiiiiitna stttntyyyyyye......y WWWW mmllheee hcooooooffffffffffffffffmmllheeerrrrrrrr mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss wniiiiiiaeainnnn tna stttrrrrrrrra h aaaandddddddwniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll,,,,,,,l
tna stttrrrrrrrra h aaaaaeainnnnse eissswniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll a h aaaaaeainnnnnddddddd oeommmmmhcoooooondddddddmmllheeerrrrrrrraeainnnn ndddddddmmllheeese eissswniiiiiiggggggggaeainnnnse eissse......y
BBEEEEEEESSSSTTTTTTT RRRRAAAAATTTTTTTEEEEEEEDDDD CCCCCCOOOMMPAAAAANNYY
Scaaaaannnnnnnn mmeeeeeeee!
Goooooooooooooooogglllleeeeeeee
Reeeeeeeeviiiiiiiieeeeeeeewwsssssss
4.8 Stna sttta h aaaarrrrrrrrse eisss | 17559 rrrrrrrrmmllheeevvvvvvvowniiiiiimmllheeewwwwwwwse eisss
CCCCCCUSSSSTTTTTTTOOOMMEEEEEEERRRR
SSSSAAAAATTTTTTTIIIIISSSSFFAAAAACCCCCCTTTTTTTIIIIIOOONN
Viiiiiiiinnnnnnnnyyyllll
WWWiiiiiiiinnnnnnnnddoooooooowwsssssss
VVwniiiiiiaeainnnnntyyyyyypliyllll tshhhhha h aaaase eisss bbbbbbbammllheeeccccccchcoooooooeommmmmmmllheee hcooooooaeainnnnmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmmhcoooooose eissstna sttt mppppppphcoooooompppppppuuuuuuuupliylllla h aaaarrrrrrrr wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww ffffffffrrrrrrrra h aaaaoeommmmmmmllheee oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff wniiiiiitna stttse eisss uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee
bbbbbbbapliyllllmmllheeeaeainnnnnddddddd hcooooooffffffff se eissstna stttntyyyyyypliyllllmmllheee,,,,,,,l mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee,,,,,,,l a h aaaaaeainnnnnddddddd ccccccchcooooooaeainnnnvvvvvvvommllheeeaeainnnnwniiiiiimmllheeeaeainnnncccccccmmllheeee......y Bhcooooooa h aaaase eissstna stttwniiiiiiaeainnnngggggggg bbbbbbbahcooooootna sttttshhhhh mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd
hcoooooouuuuuuuutna stttse eissstna sttta h aaaaaeainnnnndddddddwniiiiiiaeainnnngggggggg mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ndddddddmmllheeepliyllllwniiiiiivvvvvvvommllheeerrrrrrrr a h aaaa ggggggggrrrrrrrrmmllheeea h aaaatna sttt rrrrrrrrmmllheeetna stttuuuuuuuurrrrrrrraeainnnn hcooooooaeainnnn wniiiiiiaeainnnnvvvvvvvommllheeese eissstna stttoeommmmmmmllheeeaeainnnntna sttte......y
WWWaaaaarrrrrrrrrrrrrrrraaaaannnnnnnntttttyyy
255
Yeeeeeeeeaaaaarrrrrrrr
A pliyllllpliyllll WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheee a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee oeommmmmuuuuuuuupliylllltna stttwniiiiii---ccccccctshhhhha h aaaaoeommmmmbbbbbbbammllheeerrrrrrrr ccccccchcooooooaeainnnnse eissstna stttrrrrrrrruuuuuuuuccccccctna stttwniiiiiihcooooooaeainnnn tna sttttshhhhha h aaaatna sttt oeommmmma h aaaaxxxexwniiiiiioeommmmmwniiiiiizzmmllheeese eisss
wniiiiiiaeainnnnse eisssuuuuuuuupliylllla h aaaatna stttwniiiiiihcooooooaeainnnn,,,,,,,l tna sttttshhhhhmmllheeerrrrrrrroeommmmma h aaaapliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy a h aaaaaeainnnnnddddddd se eissstna stttuuuuuuuurrrrrrrrndddddddwniiiiiiaeainnnnmmllheeese eisssse eissse......y OOuuuuuuuurrrrrrrr pliyllllwniiiiiiaeainnnnmmllheeeuuuuuuuumppppppp hcooooooffffffff vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheeese eisss a h aaaa wwwwwwwwniiiiiindddddddmmllheee
rrrrrrrra h aaaaaeainnnnggggggggmmllheee hcooooooffffffff ccccccchcoooooopliyllllhcoooooorrrrrrrrse eisss,,,,,,,l ffffffaeainnnnwniiiiiise eissstshhhhhmmllheeese eisss a h aaaaaeainnnnnddddddd se eissstna stttntyyyyyypliyllllmmllheeese eisss tna sttttshhhhha h aaaatna sttt wwwwwwwwniiiiiipliyllllpliyllll ccccccchcoooooooeommmmmmppppppppliyllllmmllheeeoeommmmmmmllheeeaeainnnntna sttt a h aaaaaeainnnnntyyyyyy tshhhhhhcoooooooeommmmmmmllheeee......y
VVwniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tshhhhha h aaaavvvvvvvommllheee ndddddddhcoooooooeommmmmwniiiiiiaeainnnna h aaaatna stttmmllheeenddddddd tna sttttshhhhhmmllheee
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww oeommmmma h aaaarrrrrrrrkkmmllheeetna sttt bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmma h aaaaaeainnnnntyyyyyy
a h aaaandddddddvvvvvvvoa h aaaaaeainnnntna sttta h aaaaggggggggmmllheeese eisss tna sttttshhhhhmmllheeentyyyyyy hcooooooffffffffffffffffmmllheeerrrrrrrr hcoooooovvvvvvvommllheeerrrrrrrr hcooooootna sttttshhhhhmmllheeerrrrrrrr
hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l se eisssuuuuuuuuccccccctshhhhh a h aaaase eisss wwwwwwwhcoooooohcoooooonddddddd hcoooooorrrrrrrr a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm
ffffffffrrrrrrrra h aaaaoeommmmmmmllheeenddddddd
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eissse......y
Tmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiiccccccca h aaaapliyllll a h aaaandddddddvvvvvvvoa h aaaaaeainnnncccccccmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss tshhhhha h aaaavvvvvvvommllheee
cccccccrrrrrrrrmmllheeea h aaaatna stttmmllheeenddddddd wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tna sttttshhhhha h aaaatna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmm wwwwwwwmmllheeepliyllllpliyllll mmllheeevvvvvvvommllheeeaeainnnn
wniiiiiiaeainnnn tna sttttshhhhhmmllheee tshhhhha h aaaarrrrrrrrse eissstshhhhhmmllheeese eissstna sttt hcooooooffffffff CCCa h aaaaaeainnnna h aaaandddddddwniiiiiia h aaaaaeainnnn cccccccpliyllllwniiiiiioeommmmma h aaaatna stttmmllheeese eissse......y
WWWW wniiiiiitna sttttshhhhh WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu
ccccccca h aaaaaeainnnn mmllheeeaeainnnnvhcoooooontyyyyyy a h aaaa oeommmmmhcoooooorrrrrrrrmmllheee ccccccchcoooooooeommmmmffffffffhcoooooorrrrrrrrtna sttta h aaaabbbbbbbapliyllllmmllheee tshhhhhhcoooooooeommmmmmmllheee
a h aaaaaeainnnnntyyyyyy tna stttwniiiiiioeommmmmmmllheee hcooooooffffffff ntyyyyyymmllheeea h aaaarrrrrrrre......y
WWWW mmllheee mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt PVVCCC,,,,,,,l a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm a h aaaaaeainnnnnddddddd tshhhhhntyyyyyybbbbbbbarrrrrrrrwniiiiiinddddddd se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt se eisssmmllheeea h aaaaoeommmmmpliyllllmmllheeese eisssse eissspliyllllntyyyyyy fffffftna sttt a h aaaaaeainnnnntyyyyyy
a h aaaarrrrrrrrccccccctshhhhhwniiiiiitna stttmmllheeeccccccctna stttuuuuuuuurrrrrrrra h aaaapliyllll ndddddddmmllheeese eissswniiiiiiggggggggaeainnnne......y WWWW wniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr wwwwwwwwniiiiiindddddddmmllheee se eisssmmllheeepliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff cccccccuuuuuuuuse eissstna sttthcoooooooeommmmmwniiiiiizza h aaaatna stttwniiiiiihcooooooaeainnnn hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu ccccccca h aaaaaeainnnn ccccccctshhhhhhcoooooohcoooooose eisssmmllheee
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg mpppppppa h aaaatna stttwniiiiiihcoooooo ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt oeommmmmmmllheeemmllheeetna sttt tna sttttshhhhhmmllheee mmllheeexxxexa h aaaaccccccctna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee a h aaaaaeainnnnnddddddd a h aaaammllheeese eissstna sttttshhhhhmmllheeetna stttwniiiiiiccccccc rrrrrrrrmmllheeeqqqqquuuuuuuuwniiiiiirrrrrrrrmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss ntyyyyyyhcoooooouuuuuuuu
ndddddddmmllheeese eissswniiiiiirrrrrrrrmmllheeee......y WWWW tshhhhhmmllheeetna sttttshhhhhmmllheeerrrrrrrr ntyyyyyyhcoooooouuuuuuuu a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliyllllndddddddwniiiiiiaeainnnngggggggg a h aaaa aeainnnnmmllheeewwwwwww tshhhhhhcoooooooeommmmmmmllheee hcoooooorrrrrrrr uuuuuuuumpppppppggggggggrrrrrrrra h aaaandddddddwniiiiiiaeainnnngggggggg hcooooooaeainnnnmmllheee ntyyyyyyhcoooooouuuuuuuu a h aaaapliyllllrrrrrrrrmmllheeea h aaaandddddddntyyyyyy pliyllllhcoooooovvvvvvvommllheee,,,,,,,l aeainnnnmmllheeewwwwwww
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss wwwwwwwwniiiiiipliyllllpliyllll wniiiiiioeommmmmmppppppprrrrrrrrhcoooooovvvvvvvommllheee tna sttttshhhhhmmllheee pliyllllhcoooooohcooooookk hcooooooffffffff ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee a h aaaaaeainnnnnddddddd wniiiiiiaeainnnncccccccrrrrrrrrmmllheeea h aaaase eisssmmllheee hcoooooovvvvvvvommllheeerrrrrrrra h aaaapliyllllpliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyya
OOuuuuuuuurrrrrrrr Spliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ?hcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg hcooooooaeainnnnpliyllllntyyyyyy tna sttttshhhhhmmllheee bbbbbbbammllheeese eissstna sttt oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss a h aaaaaeainnnnnddddddd tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt
tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiimmllheeese eisss cccccccrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa se eissstna stttrrrrrrrrhcooooooaeainnnngggggggg a h aaaaaeainnnnnddddddd se eisssmmllheeecccccccuuuuuuuurrrrrrrrmmllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee tna sttthcoooooo ntyyyyyyhcoooooouuuuuuuurrrrrrrr bbbbbbbaa h aaaaccccccckkntyyyyyya h aaaarrrrrrrrnddddddd hcooooooa h aaaase eissswniiiiiise eissse......y
AAAAACCCCCCCCCCCCRRRREEEEEEEDDDDIIIIITTTTTTTEEEEEEEDDDD & CCCCCCEEEEEEERRRRTTTTTTTIIIIIFFIIIIIEEEEEEEDDDD BBYY
10000%
uuuPVC
Leeeeeeeeaaaaadd -FFrrrrrrrreeeeeeeeeeeeeeee
4
1
2
3
Muuulllltttttiiiiiiiiplllleeeeeeee
Seeeeeeeeaaaaalllleeeeeeeedd
Unnnnnnnniiiiiiiittttt
FFuuusssssssiiiiiiiioooooooonnnnnnnn
Coooooooorrrrrrrrnnnnnnnneeeeeeeerrrrrrrrsssssss
Aiiiiiiiirrrrrrrr
Chaaaaammbeeeeeeeerrrrrrrrsssssss
Gllllaaaaassssssssssssss
WWWeeeeeeeellllddiiiiiiiinnnnnnnngg
HOMEADVICE
15

Outdoor and Holiday
Lighting
External and holiday lighting play a
significant role in enhancing the aesthetics
of our homes and surroundings, especially
during festive seasons and special occasions.
These forms of lighting not only create a
welcoming atmosphere but also offer an
opportunity for creativity and expression.
Let’s delve into the world of external and
holiday lighting to explore their various
aspects and how they contribute to our
lives.
External lighting, often used in architectural
and landscape design, serves both
functional and aesthetic purposes. It
illuminates outdoor spaces such as gardens,
pathways, and building exteriors, ensuring
safety and security during the night.
Adequately designed outdoor lighting can
also accentuate the beauty of your property,
highlighting architectural features and
landscaping elements.
One of the key trends in external lighting
is the use of energy-efficient LED (Light
Emitting Diode) technology. LED lights are
not only environmentally friendly but also
cost-effective, as they consume significantly
less electricity compared to traditional
incandescent or fluorescent bulbs. This
shift towards LED lighting has enabled
homeowners to enjoy beautiful outdoor
lighting while reducing energy consumption
and electricity bills.
Moreover, smart technology has made
16 HOMEADVICE
its way into external lighting, offering
homeowners greater control and
convenience. Smart outdoor lighting
systems can be controlled remotely via
smartphone apps, allowing users to
adjust brightness levels, colors, and even
schedules. This not only adds a layer of
security by giving the appearance of an
occupied home but also creates stunning
visual effects for special occasions.
Holiday lighting, in particular, is a beloved
tradition worldwide. It brings joy and festive
spirit to neighborhoods and communities
during holidays like Christmas, Hanukkah,
and Diwali. String lights, colorful displays,
and elaborate decorations transform homes
and streets into dazzling wonderlands.
Holiday lighting often symbolizes unity,
celebration, and the joy of the season.
In recent years, LED technology has become
the standard for holiday lighting as well.
LED holiday lights are not only more
energy-efficient but also cooler to the touch,
making them safer for decorating both
indoors and outdoors. They come in a wide
variety of shapes, sizes, and colors, allowing
for endless creative possibilities when
designing holiday displays.
Holiday lighting has also evolved with the
introduction of smart lighting systems.
Smart holiday lights can be programmed
and synchronized to music, creating
captivating light shows that draw crowds
and inspire awe. These systems can be
controlled remotely, making it easy to turn
your holiday display on or off with a simple
tap on your smartphone.
However, it’s essential to consider safety
when using external and holiday lighting.
Outdoor lighting should be weatherproof
and installed correctly to prevent electrical
hazards and damage. For holiday lighting,
it’s crucial to follow manufacturer
recommendations and take precautions to
prevent overloading circuits and causing
fires.
In conclusion, external and holiday lighting
are more than just a source of illumination;
they are expressions of creativity, joy, and
celebration. They enhance the beauty of our
homes and communities, provide a sense of
security, and bring people together during
special occasions. With the advent of LED
technology and smart lighting systems, we
have not only made these traditions more
energy-efficient and convenient but also
opened up new realms of artistic expression
and spectacle. Whether it’s lighting up your
garden year-round or creating a stunning
holiday display, these forms of lighting
continue to brighten our lives in more ways
than one.
Duane Klapstein
780.818.7608
At Your Service Group

HOMEADVICE
17

18 HOMEADVICE

HOMEADVICE
19

20 HOMEADVICE

HOMEADVICE
21

Home Advice Fall 2023
780-439-5254
Ride Farther
Ride Faster
Explore More
Ebikes
Starting
Below
$2000
Spend Less.
At Gateway we know our ebikes inside and out, so you don’t have to.
Check out our expansive lineup at edmontonatvpros.com/electric-bikes/
22 HOMEADVICE

Now Booking January 2024
HOMEADVICE
23

Calgary: The Ultimate City to
Call Home
Calgary, often dubbed the “Heart of the New West,” stands as
a shining gem in Canada’s landscape, and there are compelling
reasons why many consider it the best city to live in. With
its strong economy, stunning natural beauty, vibrant cultural
scene, and quality of life, Calgary offers a unique blend of urban
convenience and outdoor adventure that makes it an ideal place to
call home.
Economic Prosperity:
One of Calgary’s most significant draws is its robust economy.
The city has a long history tied to the energy sector, serving as
the headquarters for numerous oil and gas companies. However,
Calgary has also successfully diversified its economy, expanding
into sectors like technology, finance, and healthcare. This
diversification ensures a stable job market and opportunities for
professionals from various backgrounds.
Calgary consistently ranks as one of the highest-income cities in
Canada, with a strong job market that attracts talent from across
the country and around the world. The city’s low unemployment
rate and high average income provide residents with a comfortable
standard of living.
Natural Beauty and Outdoor Recreation:
Calgary’s proximity to the Canadian Rockies and its stunning
natural surroundings make it a paradise for outdoor enthusiasts.
Within a short drive, you can find yourself in Banff or Kananaskis
Country, offering world-class hiking, skiing, and breathtaking
mountain vistas. Whether you’re a seasoned mountaineer or a
casual nature lover, Calgary’s proximity to these outdoor wonders
ensures a rich and fulfilling recreational lifestyle.
Additionally, the Bow River runs through the heart of the city,
providing opportunities for fishing, kayaking, and leisurely walks
along its picturesque pathways. In the winter, residents can enjoy
ice skating on the frozen lagoon at Prince’s Island Park, creating a
winter wonderland in the heart of the city.
Quality of Life:
Calgary consistently ranks high in terms of quality of life. The
city boasts an excellent healthcare system, top-notch education
options, and a low crime rate. Calgary’s clean streets, efficient
public transportation, and well-maintained parks contribute to a
high standard of living.
The city’s commitment to sustainability is evident in its efforts to
reduce greenhouse gas emissions, promote recycling, and expand
its network of cycling lanes. This eco-conscious approach aligns
with the desires of environmentally conscious residents.
Community Spirit:
Calgary is known for its welcoming and friendly community spirit.
Neighbourhoods like Kensington, Inglewood, and Mission offer
unique character and charm, with a plethora of local shops, cafes,
and restaurants. These communities foster a sense of belonging,
making it easy for newcomers to integrate and feel at home.
The city’s sports culture is another point of pride, with the
Calgary Flames representing the city in the NHL and the Calgary
Stampeders in the CFL. Fans come together to cheer on their
teams, creating a sense of unity and shared excitement.
Conclusion:
In conclusion, Calgary’s blend of economic opportunity, natural
beauty, cultural richness, quality of life, and community spirit
make it a compelling choice for those seeking an ideal place
to live. Whether you’re captivated by the breathtaking Rocky
Mountains, drawn to the vibrant cultural scene, or enticed by the
city’s strong job market, Calgary offers something for everyone.
It’s a city where modernity meets nature, and where residents
enjoy a high quality of life in one of Canada’s most dynamic and
welcoming communities. All these factors combined make Calgary
undoubtedly one of the best cities to call home.
24 HOMEADVICE

Navigating Legal Rental Suits
in Calgary: Striking a Balance
Calgary, like many other cities, has
witnessed a surge in legal rental suits in
recent years. The confluence of factors
such as an increasing population, economic
fluctuations, and evolving landlordtenant
dynamics has created a challenging
landscape for both renters and landlords. In
this editorial, we delve into the intricacies
of legal rental suits in Calgary and the
importance of striking a fair balance
between the rights and responsibilities of
both parties.
The Rising Tide of Rental Suits
Calgary’s booming population, driven by
economic opportunities and a high quality
of life, has led to a growing demand for
housing. This increased demand, however,
has not been met with a commensurate
supply of affordable rental properties. As a
result, the rental market has become highly
competitive, leaving many tenants feeling
vulnerable to unscrupulous landlords.
The influx of rental suits in Calgary is
a reflection of this imbalance. Issues
such as wrongful evictions, subpar living
conditions, illegal rent hikes, and disputes
over security deposits have become all too
common. While tenants have a right to safe
and habitable living spaces, landlords also
have legitimate concerns about protecting
their investments and ensuring that rent is
paid on time.
The Legal Landscape
Calgary’s legal framework governing
landlord-tenant relationships is designed
to protect both parties’ rights and interests.
The Residential Tenancies Act sets out the
rules and regulations for renting in the city.
It provides guidance on issues like rent
increases, maintenance standards, eviction
procedures, and the return of security
deposits.
One of the key aspects of this legislation is
dispute resolution through the Residential
Tenancy Dispute Resolution Service
(RTDRS). The RTDRS offers a streamlined
process for resolving disputes outside of
court, saving time and resources for all
parties involved.
Striking a Balance
Balancing the rights and responsibilities of
tenants and landlords is crucial to fostering
a healthy rental market in Calgary. Here
are some steps that can help achieve this
balance:
Education: Both landlords and tenants
should be well-informed about their rights
and obligations. Education can prevent
misunderstandings and disputes from
arising in the first place.
Fair Rent Control: Striking a balance
between affordable rents and the
profitability of rental properties is
challenging. Calgary should consider a fair
rent control policy that prevents arbitrary
rent hikes while allowing landlords to
maintain their properties adequately.
Regular Maintenance: Landlords must fulfill
their duty to maintain safe and habitable
living conditions for tenants. Timely repairs
and upkeep can prevent disputes over
property conditions.
Transparent Lease Agreements: Clear, welldrafted
lease agreements can help avoid
misunderstandings. All terms, including
rent, security deposit, and responsibilities,
should be explicitly stated.
Mediation and RTDRS: Encourage tenants
and landlords to use dispute resolution
services like the RTDRS before heading
to court. These services can save time and
resources for everyone involved.
Affordable Housing Initiatives: Address the
root cause of rental disputes by investing in
affordable housing initiatives that increase
the supply of reasonably priced rental units.
Conclusion
Legal rental suits in Calgary are
symptomatic of a complex housing market
with diverse interests and needs. Striking
a balance between tenant rights and
landlord responsibilities is essential for
a healthy rental market that benefits all
stakeholders. Education, fair regulations,
and dispute resolution mechanisms can
help foster a more harmonious landlordtenant
relationship in Calgary, ensuring
that everyone has access to safe, affordable,
and secure housing. By addressing these
challenges, Calgary can continue to thrive
as a vibrant and inclusive city for all of its
residents.
Dennis Begin
(403) 803-1596
begininspections.com
begininspections@telus.net
Begin Inspections Ltd.
232 Manora Rd. N.E. Calgary, AB T2A 4R6
HOMEADVICE
25

RadonCare: Mitigation
and Testing for a
Healthier Home
When we think about the potential hazards lurking in our homes, States, responsible for approximately 21,000 deaths each year.
we often consider visible threats like mold, lead paint, or faulty The World Health Organization (WHO) similarly recognizes
wiring. However, there’s an insidious and silent danger that can radon as a significant global health risk. These sobering statistics
infiltrate our living spaces, often going unnoticed until it’s too late: underscore the importance of addressing radon exposure in our
radon gas. Radon, a naturally occurring radioactive gas, poses homes.
a significant health risk when it accumulates in enclosed areas.
Fortunately, RadonCare offers mitigation and testing solutions that The Role of RadonCare
can make our homes safer and our families healthier.
RadonCare plays a crucial role in combating the radon threat
The Radon Threat
by providing comprehensive mitigation and testing services.
Mitigation involves the installation of systems that prevent radon
Radon is a colorless, odorless, and tasteless gas that is formed from entering our living spaces or vent it safely outdoors. Testing,
naturally from the decay of uranium in soil and rock. It can seep on the other hand, allows homeowners to assess their radon levels
into buildings through cracks in the foundation, gaps around and take appropriate action if necessary.
pipes, or even through the water supply. Once inside, radon can
accumulate to dangerous levels, increasing the risk of lung cancer, Mitigation Solutions
particularly among those who smoke.
Mitigation is a proactive approach to radon control that focuses on
According to the U.S. Environmental Protection Agency (EPA), preventing radon from entering homes or reducing its levels to safe
radon is the second leading cause of lung cancer in the United concentrations. RadonCare professionals are trained to assess the
26 HOMEADVICE

unique characteristics of each home and tailor mitigation systems
to its specific needs.
One common mitigation method is sub-slab depressurization.
This involves creating a vacuum beneath the building’s foundation,
which effectively sucks radon gas from the soil and directs it
safely outside, away from occupants. Other techniques, such as
sealing foundation cracks and installing air exchangers, can also be
employed to mitigate radon infiltration.
By employing these mitigation strategies, RadonCare ensures that
homeowners can enjoy peace of mind, knowing their living spaces
are protected from the silent menace of radon.
Testing for Radon Levels
Testing is the first step in addressing radon exposure. RadonCare
offers a range of testing options, from short-term to long-term
testing, depending on the homeowner’s needs and preferences.
Short-term tests typically last between two to seven days, while
long-term tests can extend over three months or more. Continuous
monitoring devices are also available for more accurate and realtime
assessments of radon levels.
Regular testing is essential, as radon concentrations can vary over
time and in different areas of the same house. It’s not uncommon
for homes to have safe levels of radon in some rooms while
posing a risk in others. By consistently monitoring radon levels,
homeowners can take informed action if mitigation is necessary.
The Importance of Public Awareness
While RadonCare provides invaluable services, it’s equally crucial
to raise public awareness about the dangers of radon and the need
for testing and mitigation. Many homeowners remain unaware of
the radon threat, and without proper education, they may overlook
this invisible menace.
Government agencies and organizations dedicated to public
health can play a significant role in this regard by disseminating
information, conducting radon awareness campaigns, and offering
incentives for radon testing and mitigation. By fostering a culture
of radon awareness, we can protect more families from the
potential risks associated with radon exposure.
In conclusion, RadonCare is a beacon of hope in the fight against
radon, a silent and potentially deadly intruder in our homes.
Through their mitigation and testing services, RadonCare
empowers homeowners to take control of their indoor air quality,
ensuring a safer and healthier environment for their families.
However, the battle against radon doesn’t end with professional
services. It also requires a collective effort to raise awareness,
educate the public, and encourage regular testing and mitigation.
Together, we can make our homes radon-free, providing our loved
ones with the peace of mind they deserve.
HOMEADVICE
27

28 HOMEADVICE

HOMEADVICE
29

The Timeless Importance of the Print Industry
in a Digital Age
In an era dominated by digital technologies and screens that fit
in the palm of our hands, the print industry often finds itself at
the crossroads of relevance. Some have prematurely sounded the
death knell for print, heralding the digital age as its harbinger. Yet,
the print industry remains not only resilient but indispensable.
Its enduring importance transcends mere nostalgia, for it is a
testament to the enduring power of tangible, physical media in our
lives.
The first thing that comes to mind when we think of print is
probably books. In an age of e-readers and audiobooks, the printed
book continues to hold a special place in the hearts of many. There
is something profoundly tactile about holding a book in one’s
hands, flipping through its pages, and smelling the ink and paper.
The print industry is the guardian of this treasured tradition,
preserving centuries of human knowledge and culture in libraries,
bookstores, and personal collections worldwide.
Moreover, the print industry has played a pivotal role in education.
From textbooks to academic journals, printed materials have been
instrumental in the dissemination of knowledge. While digital
platforms offer convenience and accessibility, they can never
fully replicate the immersive learning experience of holding a
physical textbook, taking notes in its margins, and highlighting
key passages. The print industry continues to support students,
educators, and researchers, fostering a deeper connection to the
subjects they study.
Printed newspapers and magazines, although facing challenges
in the digital age, remain vital sources of information and
commentary. The tactile nature of print publications engages
the reader in a way that online articles cannot replicate. Turning
the pages of a newspaper or magazine allows for serendipitous
discoveries and a more deliberate reading experience. The print
industry preserves diverse voices and viewpoints, promoting a
balanced and informed society.
Furthermore, the print industry is a cornerstone of the creative
arts. From posters and brochures to packaging and art prints, print
is a canvas for artistic expression. Graphic designers, illustrators,
and photographers rely on the print industry to bring their
creations to life in tangible form. The beauty of a well-designed
print piece lies in its ability to evoke emotions and convey
messages with a level of craftsmanship that digital media often
struggles to achieve.
Print also serves as a symbol of permanence in a digital world
characterized by ephemeral content. In a landscape where
tweets are deleted, Facebook posts are archived, and websites go
offline, printed materials endure. Family photo albums, wedding
invitations, and personal letters are treasured keepsakes that tell
the stories of our lives. The print industry continues to facilitate
the creation of lasting memories and connections.
Moreover, the print industry contributes significantly to the global
economy. It encompasses a wide range of businesses, from printing
presses and publishing houses to paper manufacturers and
distributors. It provides jobs and sustains livelihoods for countless
individuals, supporting local economies and communities.
Additionally, the print industry has embraced innovation,
incorporating sustainable practices and eco-friendly materials to
reduce its environmental footprint.
In conclusion, the print industry remains a vital and enduring
force in our lives. It is not a relic of the past but a cornerstone of
our cultural, educational, and creative landscape. While digital
technologies have reshaped the way we consume information,
they have not replaced the profound and lasting impact of print.
The print industry embodies the human desire for tangible, tactile
experiences in an increasingly virtual world.
30 HOMEADVICE

HOMEADVICE
31

32 HOMEADVICE