Winter 2023/24

HOMEADVICE
1

2 HOMEADVICE

Home Advice Is Now
Booking for:
@REALHOMEADVICE
When requiring services, whether it be realtors, builders,
contractors or more, we ask that you remember the businesses
featured in this publication are the best in the industry.
All rights reserved by Home Advice.
Reproduction or transmission of all or any part of this publication
by any means is strictly forbidden without the prior
written consent of Real Home Advice. Although great detail
and attention is taken to avoid any ad copy or editorial errors,
any errors or omissions on the part of the publisher are
limited and dealt with solely by printing a letter of retraction
and/or correction in the following editions.
DESIGNED AND PUBLISHED BY RHAMEDIA
CONTACT:
February Edition Calgary
and British Columbia
Feb 01- 2024
March Edition Edmonton
and Winnipeg
March 04 -2024
780.406.6441
adcopy@realhomeadvice.ca
Phone: 1-780-406-6441
Email: adcopy@realhomeadvice.ca
HOMEADVICE
3

ÈÉÇÇÅ
ÄÆÃÂÁÃÃÀÈÇ
tohmÃJÀhÈh/hÈÇÇÃ[/PÃmÄÆÃÂohaÅÇC
R@

NOW ACCEPTING
RENTAL APPLICATIONS
Vista Housing for Seniors provides affordable housing options in Edmonton, for low
to modest income Seniors Citizens who are able to live independently in an apartment
setting. Rent is calculated based on 30% of your household income
Applications are available online, through our main office or at our
properties.
South East Edmonton
Central Baptist Manor 9403-95 Avenue
Millbourne Manor 2115 Millbourne Rd W.
Bethel Seniors Residence 7728-82 Avenue
St. Andrews Selo
8025 – 101 Avenue
North East Edmonton
Norwood Golden Manor 11715-95 Street
Casa Romana
13439-97 Street
St. Elia’s Pysanka Manor 11906-66 Street
Tower 1
12840-64 Street
Viselka
114515-86 Street
North West Edmonton
Alliance Villa
12620-109A Avenue
Calder Place
12934119 Street
Chinese Alliance Manor 9312-149 Street
Mary A. Finlay Manor 10209-134 Avenue
Ortona Villa
10421-142 Street
Central Edmonton
Piazza Italia
9521-108A Avenue
Dnipro Seniors Residence 11030 – 107 Street
Independent Living
Apartments for Low Income
Seniors
16 Properties are located in
the City of Edmonton
Bachelor, 1 Bedroom and 2
Bedroom Apartments
All properties certified by
the Edmonton City Police
Crime Free Multi Housing
Program
Well Maintained, Safe,
Secure Buildings.
(780) 476-1470
Vista Housing for Seniors
11622- 119 Street
Edmonton, AB www.
vistahousing.org
HOMEADVICE
5

Introducing Home Advice
Seniors: Enriching
Perspectives, Honoring
Renovate with confidence!
EMPOWERING HOMEOWNERS GET THROUGH THEIR RENOVATIONS,
STRESS FREE!
Proud Team of Vetted Sub-Contractors
for any renovation project.
Bring Your Vision To Life & Save Thousands
CALL TODAY
For Free In-House Consultation 587-277-9636
6 HOMEADVICE

In the tapestry of life, the threads of experience, insight, and
wisdom woven by our seniors hold a special place. These are
the individuals who have weathered the storms and savored the
sunshine, carrying with them a wealth of knowledge that spans
generations. It is with great anticipation and enthusiasm that we
announce the inception of a new section in our magazine—a
dedicated space for senior advice.In a world often fixated on
the latest trends and the fastest pace, the voices of our elders
can get lost in the shuffle. We tend to overlook the treasure
trove of guidance that can be garnered from their stories and
lessons learned. This senior advice section aims to change that,
bridging the generational gap and fostering a greater sense of
understanding and appreciation.The wisdom that accompanies
age is unparalleled. Lifetimes of experiences, challenges, triumphs,
and growth culminate in a mosaic of insights that cannot be
replicated. From navigating personal relationships to handling
professional endeavors, our seniors have encountered a myriad
of situations that have sculpted them into beacons of sagacity.
Through this dedicated section, we provide them with a platform
to share their pearls of wisdom, offering guidance to younger
generations embarking on similar journeys.Moreover, this senior
advice section is not merely about one-way communication; it is a
testament to the power of intergenerational dialogue. In a society
where rapid technological advancements sometimes threaten
to create divisions, providing a space for seniors to share their
advice fosters a sense of unity. It encourages readers to pause and
listen, to recognize the shared human experience that transcends
age, and to value the contributions of every age group.Imagine
a reader seeking counsel on balancing a demanding career with
family responsibilities. Instead of resorting solely to modern
self-help resources, they can now turn to the words of a senior
who managed a similar feat decades ago. The advice might be
practical, emotional, or a blend of both, offering a perspective that
goes beyond the pages of a textbook or the pixels of a screen. Such
guidance is invaluable, as it combines the lessons of the past with
the aspirations of the present, forming a roadmap for the future.
Our commitment to introducing a senior advice section stems
from a deep respect for the rich tapestry of human experience. As
we embark on this new endeavor, we invite our readers to embrace
the unique opportunity it presents—to learn, to connect, and
to cherish the voices that have traversed the sands of time. The
stories and insights shared within these pages are not just for the
benefit of one generation, but for the enrichment of all who seek to
navigate the complex labyrinth of life.Incorporating a senior advice
section into our magazine is an acknowledgment that age is not a
barrier, but a bridge—one that unites the past, present, and future.
Through these shared narratives, we hope to inspire, educate, and
celebrate the journey of life in all its stages.
HOMEADVICE
7

The Power of Practice:
Unveiling the Potential for
Seniors
In the ever-evolving symphony of life,
every note represents an opportunity for
personal growth and transformation. As
the years roll by and we find ourselves in
the embrace of our golden years, the notion
that the power of practice is the exclusive
domain of youthful enthusiasm could not
be further from the truth. Indeed, it holds
an equally vital place in the lives of seniors.
The age-old adage, “practice makes perfect,”
transcends generational boundaries,
warmly embracing seasoned individuals
who persistently flourish through their
unwavering dedication and unwavering
perseverance.
In a world that occasionally overlooks
the remarkable capabilities of seniors,
embracing the power of practice becomes
a profound tribute to the indomitable
spirit that defies age-related stereotypes.
Seniors who commit themselves to
deliberate practice, whether they embark
on the journey of mastering a new musical
instrument or immerse themselves in the
intricacies of digital technology, experience
the thrill of progress and the profound joy
of accomplishment.
The cognitive benefits of continuous
practice are nothing short of extraordinary.
Research consistently underscores the
brain’s remarkable plasticity, which remains
undiminished by the passage of time.
Engaging in regular mental exercises, such
as tackling intricate puzzles or immersing
oneself in the acquisition of a new language,
empowers seniors to enhance memory
retention, sharpen their problem-solving
acumen, and maintain cognitive agility.
8 HOMEADVICE
But the power of practice doesn’t stop
at the realm of intellect; it profoundly
enriches emotional and physical wellbeing.
Engaging in activities that resonate
with personal passions nurtures an
enduring sense of purpose and belonging.
Whether it’s cultivating a flourishing
garden, perfecting culinary skills, or
expressing artistic creativity with fervor,
these practiced endeavors infuse life with
vibrancy, meaning and occasionally a
Championship.
Such was the case in August when after
seven years I finally won the A Event
Championship (6 Wins - 0 Losses) at
the 41st Osoyoos Midsummer Bonspiel.
Although I had not thrown a curling
rock since April, it was the extra training
from last winter that assisted my peak
performance this summer. The symphony
of life, in its infinite wisdom, recognizes
68 as just a number; it is the unwavering
dedication to practice that composes a
legacy of resilience, boundless growth and
the relentless pursuit of excellence.
So how can seniors harness the power of
practice to unlock their full potential?
1. Embrace Lifelong Learning
Seniors should see themselves as perpetual
learners. Whether it’s acquiring a new
talent, perfecting an old skill, exploring a
new subject, or diving into a hobby, the
pursuit of knowledge and mastery should
be ongoing. The joy of learning never
diminishes with age.
2. Rediscover Passions
Many seniors may have set aside their
passions in the hustle and bustle of life.
Now is the time to rekindle those flames.
Whether it’s scriptwriting, playing pickle
ball, gardening, volunteering, trick roping,
inventing a special device or any other
passion, practice and nurture these interests
to experience a renewed sense of purpose
and fulfillment.
3. Stay Physically Active
Physical health is the foundation of a
fulfilling life. Engaging in regular physical
activity not only improves fitness but also
boosts mood and cognitive function. I
invite you to explore activities like yoga,
aquatic fitness, tai chi, gental fitness, stick/
wheelchair curling, or take daily walks
to keep your body resilient, agile and
maintaining wellness.
“Do what keeps you young at heart.”
Dr. Neville Headley, DDS
403.300.3232
info@christiecrossingdental.com

I’M
LIVING
WELL
by not cooking
unless I want to
- and I really
don’t want to.
TM
Calgary’s Best New Active
Aging Retirement Community
Joyful retirement doesn’t just happen – it’s a choice. That’s why at
Trico LivingWell, we chose to put the best of everything into our
new seniors’ residence in south Calgary. From wellness to dining,
and amenities to our spacious suites, the only thing missing is you.
Come join our amazing community – and bring your appetite too.
HURRY IN - NOW LEASING FINAL PHASE!
CHOOSE FROM
Stylish new studio,
1 bedroom,
1 bedroom + den
& 2 bedroom suites
INDEPENDENT
LIVING from
$3,435
/month
ASSISTED
LIVING from
$4,610
/month
Visit us today:
7670 - 4A Street SW
Now open!
Reserve your
suite today!
403.281.2802
tricolivingwell.com
INDEPENDENT LIVING • ASSISTED LIVING • DEMENTIA CARE
HOMEADVICE
9

10 HOMEADVICE

Winter Moving Guide: Navigating
Challenges and Embracing the
Unique Advantages
Moving in the winter presents its own
set of challenges, from unpredictable
weather to colder temperatures. However,
with strategic planning and a few extra
considerations, a winter move can be a
successful and even unique experience.
First and foremost, weather-proof your
move. Keep a close eye on the weather
forecast and plan your moving day
accordingly. If possible, choose a day
with clear skies and milder temperatures.
Be prepared for unexpected changes in
weather by having appropriate gear such as
waterproof clothing, gloves, and non-slip
footwear.
Protect your belongings from the cold.
Items that are sensitive to temperature
fluctuations, such as electronics or fragile
items, should be packed with extra care.
Consider using insulated packaging
materials and blankets to shield your
possessions from the cold during transit.
Start early in the day. Winter days are
shorter, and natural light is limited. Begin
your move as early as possible to make the
most of daylight hours. This also allows
you to navigate potential weather-related
challenges with better visibility.
Keep walkways clear and safe. Snow and ice
can create hazardous conditions during a
winter move. Prioritize clearing walkways,
driveways, and entry points to prevent slips
and falls. Have salt or ice melt on hand to
melt icy patches.
Prepare your new home in advance. Ensure
the heating is turned on before you arrive
at your new residence. This helps to create
a comfortable environment for unpacking
and settling in. Also, have a designated area
for wet and snowy items to avoid tracking
snow throughout the house.
Hire professionals for assistance. Winter
moves come with additional challenges,
and professional movers are experienced
in navigating them. Consider hiring
a moving company that specializes in
winter relocations. They often have the
right equipment and knowledge to handle
adverse weather conditions.
Protect yourself and your health. Winter
moves can be physically demanding, so it’s
crucial to take breaks, stay hydrated, and
dress in layers to stay warm. Listen to your
body and prioritize safety throughout the
process.
Celebrate the positives of a winter move.
While it may present challenges, a winter
move can also offer unique advantages.
Moving companies are often less busy,
which may result in more flexible
scheduling and better rates. Additionally,
the colder weather can make the physical
aspects of moving more comfortable.
In conclusion, a winter move requires extra
planning and precautions, but with the
right mindset and preparations, it can be a
successful and even memorable experience.
Embrace the challenges, stay flexible, and
take the opportunity to create a cozy and
welcoming new home despite the winter
chill.
GAIL LABINE
(780) 998-2422
office@fortmoving.ca
http://www.fortmoving.com
HOMEADVICE
11

The Vital Importance of
Fireplace Maintenance for a
Safe and Cozy Home
As winter’s chill descends upon us, the allure of a crackling
fireplace becomes irresistible. The warm glow and comforting
ambiance make fireplaces a focal point of many homes during
the colder months. However, with great coziness comes great
responsibility – the responsibility to ensure proper fireplace
maintenance. The importance of regular upkeep goes far beyond
mere aesthetics; it is a matter of safety, efficiency, and longevity.
First and foremost, fireplace maintenance is crucial for safety
reasons. Over time, soot and creosote, by-products of burning
wood, can accumulate in the chimney. This accumulation poses
a serious fire hazard, as these substances are highly flammable.
Regular chimney cleaning helps prevent chimney fires, protecting
your home and loved ones from potential disasters. Neglecting
maintenance can lead to a build-up of dangerous gases, such as
carbon monoxide, which, when released into your home, can have
life-threatening consequences.
Moreover, a well-maintained fireplace operates more efficiently.
A clean chimney allows for better air circulation, ensuring that
smoke is properly vented. This not only contributes to a healthier
indoor air quality but also prevents the buildup of unpleasant
odors and potential respiratory issues. An efficient fireplace
also burns fuel more effectively, reducing fuel consumption
and, consequently, lowering energy costs. In an era where
environmental consciousness is paramount, ensuring that your
fireplace operates efficiently aligns with the broader goal of
sustainable living.
Fireplace maintenance is an investment in the longevity of your
heating system. Neglecting to clean and inspect the components
can lead to the deterioration of the firebox, chimney, and other
essential parts. Regular inspections help identify and address
issues early on, preventing costly repairs or the need for a
complete replacement down the line. A well-maintained fireplace
can provide reliable warmth for years, making it a valuable asset to
any home.
In conclusion, the importance of fireplace maintenance extends
beyond the desire for a picturesque hearth. It is a matter of
safety, efficiency, and protecting your home investment. Regular
chimney cleaning, inspections, and proper care not only prevent
potential hazards but also contribute to a cozy and cost-effective
home environment. As winter settles in, let us not only enjoy the
warmth of our fireplaces but also ensure that they remain a source
of comfort and joy without compromising on safety and efficiency.
SCOTT CAMPBELL
(780) 974-7689
fireplaceguy@live.com
OUR SERVICES:
Gas Fireplaces
Wood Fireplaces
Fireplace Mantels
Fireplace Surroundings
Wood Stoves
Competitive prices
The
Fireplace
Guy
780.974.7689
Edmonton, AB
12 HOMEADVICE

HOMEADVICE
13

Ennnneeeeeerrrrrrrggyy---
EF>@iiieeeeeennnn<
Wiiinnnnddddooowss
aaaaannnndddd
Coomppplleeeeeettttteeeeee Wiinnndoow & Doooorrr
Seeeeeerrrviiceeeeeessss
EddddNooonnnnMooonnnn
1111111144444477444444 WWWiiiiiiicnnnnnnnntttttttteeeeeeeerrrrrrrrbbuuuuuuurrrrrrrrnnnnnnnn RRRdddddddd NNWWW
EEddddddddmmmmmmmoooooooonnnnnnnnttttttttoooooooonnnnnnnn,,,,,, AAAAABBBB TTT555555SSS 22222Y33
(777780)
4557777---95577777777
DDoooooorrrrrrrss
Caaaaalggaaaaarrrrrrryy
444444822222444444 55555522222 SSStttttttt. SSSEE
CCaaaaaaaalllllgggggaaaaaaaarrrrrrrryyyyyyy,,,,,, AAAAABBBB TTT22222BBBB 33RRR22222
(40–) 407777--- 4557777
Prrroofeeeeeessssssssiioonnnaaaaa lllly
Innnsssstttttaaaaa lllleeeeeerrrssss
Geeeeeettttt uuppp tttttoo
$5000000000000000
iinnn
Reeeeeebbaaaaattttteeeeeessss!
WWWiiiiiiictttttttthhhhhhhh tttttttthhhhhhhheeeeeeee CCaaaaaaaannnnnnnnaaaaaaaaddddddddaaaaaaaa GGrrrrrrrreeeeeeeeeeeeeeeennnnnnnneeeeeeeerrrrrrrr Hoooooooommmmmmmeeeeeeeessssssss
GGrrrrrrrraaaaaaaannnnnnnntttttttt,,,,,, yyyyyyyoooooooouuuuuuu cccciccaaaaaaaannnnnnnn rrrrrrrreeeeeeeeccccicceeeeeeeeiiiiiiicvvvveeeeeeee uuuuuuupppp ttttttttoooooooo $555555000000000000
iiiiiiicnnnnnnnn rrrrrrrreeeeeeeebbaaaaaaaatttttttteeeeeeeessssssss ttttttttoooooooo uuuuuuuppppgggggrrrrrrrraaaaaaaaddddddddeeeeeeee yyyyyyyoooooooouuuuuuurrrrrrrr hhhhhhhhoooooooommmmmmmeeeeeeee
wwwwiiiiiiictttttttthhhhhhhh nnnnnnnneeeeeeeewwww,,,,,, ssssssssttttttttyyyyyyyllllliiiiiiicsssssssshhhhhhhh,,,,,, eeeeeeeennnnnnnneeeeeeeerrrrrrrrgggggyyyyyyy-eeeeeeeeffccccicciiiiiiiceeeeeeeennnnnnnntttttttt
Trrr aaaaaiinnneeeeee d
Reeeeeedddd
wwwwiiiiiiicnnnnnnnnddddddddoooooooowwwwssssssss aaaaaaaannnnnnnndddddddd ddddddddoooooooooooooooorrrrrrrrssssssss.
DDeeeeeeeeeeeerrrrrrr
55555555555511111111 5555550000 AAAAAvvvveeeeeeee
RRReeeeeeeedddddddd Deeeeeeeeeeeeeeeerrrrrrrr,,,,,, AAAAABBBB TTT444444NN 77AAAAA444444
(40–) 407777---± 55
Ennneeeeeerrrgy ---Stttttaaaaarrr
Liiceeeeeennnsssseeeeee d & Innnssssuu rrreeeeeed 10000000000% Cuusssstttttoomeeeeeerrr Saaaaatttttiissss faaaaactttttiioonnn Waaaaarrrrrraaaaannnttttty
Raaaaattttteeeeee d
Grrrrrrraaaaannnnddddeeeeee
Prrrrrrraaaaaiiirrrrrrriiieeeeee
11111111000022222555555 8Ø AAAAAvvvveeeeeeee Ðnnnnnnnniiiiiiictttttttt Ç111111110000
GGrrrrrrrraaaaaaaannnnnnnnddddddddeeeeeeee Ñrrrrrrrraaaaaaaaiiiiiiicrrrrrrrriiiiiiiceeeeeeee,,,,,, AAAAABBBB TTT8Ê 555555BBBBØ
(5587777)
8±8---5555557777
Wiinnndoow Maaaaa rrrttttt iissss ppp rrroouud tttttoo bbeeeeee ttttt heeeeee
lleeeeeeaaaaa diinnng ppprrrooviideeeeeerrr oof wiinnndoowssss aaaaannn d
doooorrrssss iinnn Allbbeeeeeerrrtttttaaaaa. Weeeeee sssspppeeeeee ciiaaaaalliizeeeeee iinnn
hiigh---quuaaaaalliittttty aaaaannnd eeeeeennneeeeee rrrgy ---eeeeeefciieeeeeennnttttt
wiinnndoowssss , doooo rrrssss, aaaaannn d wiinnn doow
cooveeeeeerrriinnngssss. Ouurrr iinnnsssstttttaaaaa llllaaaaatttttiioonnn ttttteeeeeeaaaaa mssss
aaaaarrreeeeee iinnn duusssstttttrrry---tttttrrraaaaaiinnneeeeee d aaaaannn d weeeeee llll
eeeeeexpppeeeeeerrriieeeeeennnceeeeeed iinnn aaaaa llll tttttypppeeeeeessss oo f wiinnndoow
aaaaannnd doooo rrr rrreeeeeepppllaaaaaceeeeeemeeeeeennnttttt ppp rrroojeeeeeectttttssss.
WWWiiiiiiicnnnnnnnnddddddddoooooooowwww Maaaaaaaarrrrrrrrtttttttt hhhhhhhhaaaaaaaassssssss tttttttthhhhhhhheeeeeeee eeeeeeee xppppeeeeeeeerrrrrrrriiiiiiiceeeeeeeennnnnnnnccccicceeeeeeee aaaaaaaannnnnnnndddddddd eeeeeeee xppppeeeeeeeerrrrrrrrttttttttiiiiiiicsssssssseeeeeeee ttttttttoooooooo ttttttttaaaaaaaa keeeeeeee
oooooooonnnnnnnn eeeeeeeevvvveeeeeeeennnnnnnn tttttttthhhhhhhheeeeeeee mmmmmmmoooooooosssssssstttttttt ccccicchhhhhhhhaaaaaaaalllllllllleeeeeeeennnnnnnngggggiiiiiiicnnnnnnnnggggg wwwwiiiiiiicnnnnnnnnddddddddoooooooowwww oooooooorrrrrrrr ddddddddoooooooooooooooorrrrrrrr
iiiiiiicmmmmmmmpppprrrrrrrroooooooovvvveeeeeeeemmmmmmmeeeeeeeennnnnnnntttttttt pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt wwwwiiiiiiictttttttthhhhhhhh cccciccoooooooonnnnnnnnfddddddddeeeeeeeennnnnnnnccccicceeeeeeee. WWWeeeeeeee ooooooooffeeeeeeeerrrrrrrr
cccciccoooooooommmmmmmppppllllleeeeeeeemmmmmmmeeeeeeeennnnnnnnttttttttaaaaaaaarrrrrrrryyyyyyy eeeeeeeessssssssttttttttiiiiiiicmmmmmmmaaaaaaaattttttttiiiiiiicoooooooonnnnnnnn sssssssseeeeeeeerrrrrrrrvvvviiiiiiicccccicceeeeeeeessssssss ttttttttoooooooo eeeeeeeennnnnnnnssssssssuuuuuuurrrrrrrreeeeeeee yyyyyyyoooooooouuuuuuu aaaaaaaarrrrrrrreeeeeeee
cccciccoooooooommmmmmmfoooooooorrrrrrrrttttttttaaaaaaaabbllllleeeeeeee gggggooooooooiiiiiiicnnnnnnnnggggg aaaaaaaahhhhhhhheeeeeeeeaaaaaaaadddddddd wwwwiiiiiiictttttttthhhhhhhh yyyyyyyoooooooouuuuuuurrrrrrrr pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt.
wwwwwwwwwwwwwww..wwwwwindowwwwwmaart ..caa
14 HOMEADVICE

Ennnnnnnntttttrrrrrrrryyy DDoooooooooooooooorrrrrrrrsssssss Paaaaatttttiiiiiiiioooooooo DDoooooooooooooooorrrrrrrrsssssss
CCCrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee se eissshcoooooopliylllluuuuuuuutna stttwniiiiiihcooooooaeainnnn ffffffffhcoooooorrrrrrrr ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee wniiiiiise eisss mmllheeea h aaaase eisssntyyyyyy wwwwwwwwniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ndddddddhcoooooohcoooooorrrrrrrrse eisss
ggggggggpliylllla h aaaase eisssse eisss wniiiiiiaeainnnnse eisssmmllheeerrrrrrrrtna stttse eisss,,,,,,,l pliyllllhcooooooccccccckk se eisssmmllheeetna stttse eisss,,,,,,,l ndddddddhcoooooohcoooooorrrrrrrr tshhhhha h aaaaaeainnnnndddddddpliyllllmmllheeese eisss,,,,,,,l mpppppppuuuuuuuupliyllllpliyllll bbbbbbbaa h aaaarrrrrrrrse eisss a h aaaaaeainnnnnddddddd oeommmmma h aaaaaeainnnnntyyyyyy hcooooootna sttttshhhhhmmllheeerrrrrrrr ndddddddhcoooooohcoooooorrrrrrrr hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eissse......y
OOuuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff tshhhhhwniiiiiiggggggggtshhhhh---qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy,,,,,,,l mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnntna sttt,,,,,,,l a h aaaaaeainnnnnddddddd bbbbbbbammllheeea h aaaauuuuuuuutna stttwniiiiiiffffffffuuuuuuuupliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss ccccccchcooooooaeainnnnse eissswniiiiiise eissstna stttse eisss hcooooooffffffff
ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll ndddddddhcoooooohcoooooorrrrrrrrse eissse......y A pliyllllpliyllll hcoooooouuuuuuuurrrrrrrr ndddddddhcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggntyyyyyy a h aaaaaeainnnnnddddddd
oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eissse......y OOuuuuuuuurrrrrrrr mmllheeexxxexcccccccpliylllluuuuuuuuse eissswniiiiiivvvvvvvommllheee ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheeese eisss mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll
mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l nddddddduuuuuuuurrrrrrrra h aaaabbbbbbbawniiiiiipliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd ffffffffuuuuuuuuaeainnnnccccccctna stttwniiiiiihcooooooaeainnnna h aaaapliyllllwniiiiiitna stttntyyyyyye......y WWWW mmllheee hcooooooffffffffffffffffmmllheeerrrrrrrr mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss wniiiiiiaeainnnn tna stttrrrrrrrra h aaaandddddddwniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll,,,,,,,l
tna stttrrrrrrrra h aaaaaeainnnnse eissswniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll a h aaaaaeainnnnnddddddd oeommmmmhcoooooondddddddmmllheeerrrrrrrraeainnnn ndddddddmmllheeese eissswniiiiiiggggggggaeainnnnse eissse......y
BBEEEEEEESSSSTTTTTTT RRRRAAAAATTTTTTTEEEEEEEDDDD CCCCCCOOOMMPAAAAANNYY
Scaaaaannnnnnnn mmeeeeeeee!
Goooooooooooooooogglllleeeeeeee
Reeeeeeeeviiiiiiiieeeeeeeewwsssssss
4.8 Stna sttta h aaaarrrrrrrrse eisss | 17559 rrrrrrrrmmllheeevvvvvvvowniiiiiimmllheeewwwwwwwse eisss
CCCCCCUSSSSTTTTTTTOOOMMEEEEEEERRRR
SSSSAAAAATTTTTTTIIIIISSSSFFAAAAACCCCCCTTTTTTTIIIIIOOONN
Viiiiiiiinnnnnnnnyyyllll
WWWiiiiiiiinnnnnnnnddoooooooowwsssssss
VVwniiiiiiaeainnnnntyyyyyypliyllll tshhhhha h aaaase eisss bbbbbbbammllheeeccccccchcoooooooeommmmmmmllheee hcooooooaeainnnnmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmmhcoooooose eissstna sttt mppppppphcoooooompppppppuuuuuuuupliylllla h aaaarrrrrrrr wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww ffffffffrrrrrrrra h aaaaoeommmmmmmllheee oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff wniiiiiitna stttse eisss uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee
bbbbbbbapliyllllmmllheeeaeainnnnnddddddd hcooooooffffffff se eissstna stttntyyyyyypliyllllmmllheee,,,,,,,l mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee,,,,,,,l a h aaaaaeainnnnnddddddd ccccccchcooooooaeainnnnvvvvvvvommllheeeaeainnnnwniiiiiimmllheeeaeainnnncccccccmmllheeee......y Bhcooooooa h aaaase eissstna stttwniiiiiiaeainnnngggggggg bbbbbbbahcooooootna sttttshhhhh mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd
hcoooooouuuuuuuutna stttse eissstna sttta h aaaaaeainnnnndddddddwniiiiiiaeainnnngggggggg mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ndddddddmmllheeepliyllllwniiiiiivvvvvvvommllheeerrrrrrrr a h aaaa ggggggggrrrrrrrrmmllheeea h aaaatna sttt rrrrrrrrmmllheeetna stttuuuuuuuurrrrrrrraeainnnn hcooooooaeainnnn wniiiiiiaeainnnnvvvvvvvommllheeese eissstna stttoeommmmmmmllheeeaeainnnntna sttte......y
WWWaaaaarrrrrrrrrrrrrrrraaaaannnnnnnntttttyyy
255
Yeeeeeeeeaaaaarrrrrrrr
A pliyllllpliyllll WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheee a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee oeommmmmuuuuuuuupliylllltna stttwniiiiii---ccccccctshhhhha h aaaaoeommmmmbbbbbbbammllheeerrrrrrrr ccccccchcooooooaeainnnnse eissstna stttrrrrrrrruuuuuuuuccccccctna stttwniiiiiihcooooooaeainnnn tna sttttshhhhha h aaaatna sttt oeommmmma h aaaaxxxexwniiiiiioeommmmmwniiiiiizzmmllheeese eisss
wniiiiiiaeainnnnse eisssuuuuuuuupliylllla h aaaatna stttwniiiiiihcooooooaeainnnn,,,,,,,l tna sttttshhhhhmmllheeerrrrrrrroeommmmma h aaaapliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy a h aaaaaeainnnnnddddddd se eissstna stttuuuuuuuurrrrrrrrndddddddwniiiiiiaeainnnnmmllheeese eisssse eissse......y OOuuuuuuuurrrrrrrr pliyllllwniiiiiiaeainnnnmmllheeeuuuuuuuumppppppp hcooooooffffffff vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheeese eisss a h aaaa wwwwwwwwniiiiiindddddddmmllheee
rrrrrrrra h aaaaaeainnnnggggggggmmllheee hcooooooffffffff ccccccchcoooooopliyllllhcoooooorrrrrrrrse eisss,,,,,,,l ffffffaeainnnnwniiiiiise eissstshhhhhmmllheeese eisss a h aaaaaeainnnnnddddddd se eissstna stttntyyyyyypliyllllmmllheeese eisss tna sttttshhhhha h aaaatna sttt wwwwwwwwniiiiiipliyllllpliyllll ccccccchcoooooooeommmmmmppppppppliyllllmmllheeeoeommmmmmmllheeeaeainnnntna sttt a h aaaaaeainnnnntyyyyyy tshhhhhhcoooooooeommmmmmmllheeee......y
VVwniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tshhhhha h aaaavvvvvvvommllheee ndddddddhcoooooooeommmmmwniiiiiiaeainnnna h aaaatna stttmmllheeenddddddd tna sttttshhhhhmmllheee
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww oeommmmma h aaaarrrrrrrrkkmmllheeetna sttt bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmma h aaaaaeainnnnntyyyyyy
a h aaaandddddddvvvvvvvoa h aaaaaeainnnntna sttta h aaaaggggggggmmllheeese eisss tna sttttshhhhhmmllheeentyyyyyy hcooooooffffffffffffffffmmllheeerrrrrrrr hcoooooovvvvvvvommllheeerrrrrrrr hcooooootna sttttshhhhhmmllheeerrrrrrrr
hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l se eisssuuuuuuuuccccccctshhhhh a h aaaase eisss wwwwwwwhcoooooohcoooooonddddddd hcoooooorrrrrrrr a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm
ffffffffrrrrrrrra h aaaaoeommmmmmmllheeenddddddd
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eissse......y
Tmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiiccccccca h aaaapliyllll a h aaaandddddddvvvvvvvoa h aaaaaeainnnncccccccmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss tshhhhha h aaaavvvvvvvommllheee
cccccccrrrrrrrrmmllheeea h aaaatna stttmmllheeenddddddd wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tna sttttshhhhha h aaaatna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmm wwwwwwwmmllheeepliyllllpliyllll mmllheeevvvvvvvommllheeeaeainnnn
wniiiiiiaeainnnn tna sttttshhhhhmmllheee tshhhhha h aaaarrrrrrrrse eissstshhhhhmmllheeese eissstna sttt hcooooooffffffff CCCa h aaaaaeainnnna h aaaandddddddwniiiiiia h aaaaaeainnnn cccccccpliyllllwniiiiiioeommmmma h aaaatna stttmmllheeese eissse......y
WWWW wniiiiiitna sttttshhhhh WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu
ccccccca h aaaaaeainnnn mmllheeeaeainnnnvhcoooooontyyyyyy a h aaaa oeommmmmhcoooooorrrrrrrrmmllheee ccccccchcoooooooeommmmmffffffffhcoooooorrrrrrrrtna sttta h aaaabbbbbbbapliyllllmmllheee tshhhhhhcoooooooeommmmmmmllheee
a h aaaaaeainnnnntyyyyyy tna stttwniiiiiioeommmmmmmllheee hcooooooffffffff ntyyyyyymmllheeea h aaaarrrrrrrre......y
WWWW mmllheee mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt PVVCCC,,,,,,,l a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm a h aaaaaeainnnnnddddddd tshhhhhntyyyyyybbbbbbbarrrrrrrrwniiiiiinddddddd se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt se eisssmmllheeea h aaaaoeommmmmpliyllllmmllheeese eisssse eissspliyllllntyyyyyy fffffftna sttt a h aaaaaeainnnnntyyyyyy
a h aaaarrrrrrrrccccccctshhhhhwniiiiiitna stttmmllheeeccccccctna stttuuuuuuuurrrrrrrra h aaaapliyllll ndddddddmmllheeese eissswniiiiiiggggggggaeainnnne......y WWWW wniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr wwwwwwwwniiiiiindddddddmmllheee se eisssmmllheeepliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff cccccccuuuuuuuuse eissstna sttthcoooooooeommmmmwniiiiiizza h aaaatna stttwniiiiiihcooooooaeainnnn hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu ccccccca h aaaaaeainnnn ccccccctshhhhhhcoooooohcoooooose eisssmmllheee
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg mpppppppa h aaaatna stttwniiiiiihcoooooo ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt oeommmmmmmllheeemmllheeetna sttt tna sttttshhhhhmmllheee mmllheeexxxexa h aaaaccccccctna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee a h aaaaaeainnnnnddddddd a h aaaammllheeese eissstna sttttshhhhhmmllheeetna stttwniiiiiiccccccc rrrrrrrrmmllheeeqqqqquuuuuuuuwniiiiiirrrrrrrrmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss ntyyyyyyhcoooooouuuuuuuu
ndddddddmmllheeese eissswniiiiiirrrrrrrrmmllheeee......y WWWW tshhhhhmmllheeetna sttttshhhhhmmllheeerrrrrrrr ntyyyyyyhcoooooouuuuuuuu a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliyllllndddddddwniiiiiiaeainnnngggggggg a h aaaa aeainnnnmmllheeewwwwwww tshhhhhhcoooooooeommmmmmmllheee hcoooooorrrrrrrr uuuuuuuumpppppppggggggggrrrrrrrra h aaaandddddddwniiiiiiaeainnnngggggggg hcooooooaeainnnnmmllheee ntyyyyyyhcoooooouuuuuuuu a h aaaapliyllllrrrrrrrrmmllheeea h aaaandddddddntyyyyyy pliyllllhcoooooovvvvvvvommllheee,,,,,,,l aeainnnnmmllheeewwwwwww
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss wwwwwwwwniiiiiipliyllllpliyllll wniiiiiioeommmmmmppppppprrrrrrrrhcoooooovvvvvvvommllheee tna sttttshhhhhmmllheee pliyllllhcoooooohcooooookk hcooooooffffffff ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee a h aaaaaeainnnnnddddddd wniiiiiiaeainnnncccccccrrrrrrrrmmllheeea h aaaase eisssmmllheee hcoooooovvvvvvvommllheeerrrrrrrra h aaaapliyllllpliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyya
OOuuuuuuuurrrrrrrr Spliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ?hcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg hcooooooaeainnnnpliyllllntyyyyyy tna sttttshhhhhmmllheee bbbbbbbammllheeese eissstna sttt oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss a h aaaaaeainnnnnddddddd tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt
tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiimmllheeese eisss cccccccrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa se eissstna stttrrrrrrrrhcooooooaeainnnngggggggg a h aaaaaeainnnnnddddddd se eisssmmllheeecccccccuuuuuuuurrrrrrrrmmllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee tna sttthcoooooo ntyyyyyyhcoooooouuuuuuuurrrrrrrr bbbbbbbaa h aaaaccccccckkntyyyyyya h aaaarrrrrrrrnddddddd hcooooooa h aaaase eissswniiiiiise eissse......y
AAAAACCCCCCCCCCCCRRRREEEEEEEDDDDIIIIITTTTTTTEEEEEEEDDDD & CCCCCCEEEEEEERRRRTTTTTTTIIIIIFFIIIIIEEEEEEEDDDD BBYY
10000%
uuuPVC
Leeeeeeeeaaaaadd -FFrrrrrrrreeeeeeeeeeeeeeee
4
1
2
3
Muuulllltttttiiiiiiiiplllleeeeeeee
Seeeeeeeeaaaaalllleeeeeeeedd
Unnnnnnnniiiiiiiittttt
FFuuusssssssiiiiiiiioooooooonnnnnnnn
Coooooooorrrrrrrrnnnnnnnneeeeeeeerrrrrrrrsssssss
Aiiiiiiiirrrrrrrr
Chaaaaammbeeeeeeeerrrrrrrrsssssss
Gllllaaaaassssssssssssss
WWWeeeeeeeellllddiiiiiiiinnnnnnnngg
HOMEADVICE
15

Embracing Safety and Independence: The
Rise of Walk-in Bathtubs
In the ever-evolving landscape of home
improvement, one innovation has been
making waves for its transformative impact on
both safety and independence – the walk-in
bathtub. As demographics shift and societies
age, the need for adaptive solutions becomes
increasingly apparent. Walk-in bathtubs
represent a pivotal step towards creating
homes that cater to the diverse needs of
individuals, particularly the elderly and those
with mobility challenges.
The primary advantage of walk-in bathtubs
lies in their design, which allows users to step
in and out with ease, minimizing the risk of
slips and falls. Traditional bathtubs, with their
high sides, present a significant challenge
for individuals with limited mobility. Walkin
bathtubs address this concern, providing
a door that opens outward, eliminating the
need to navigate a high barrier. This simple
yet revolutionary feature has the power to
enhance safety, instilling confidence in users
and their caregivers.
Beyond safety, walk-in bathtubs promote
independence and dignity. Aging
individuals often face the dilemma of
losing autonomy in daily activities.
The ability to bathe independently
is a fundamental aspect of personal
care, and walk-in bathtubs empower
individuals to maintain their hygiene
routines without relying on external
assistance. This fosters a sense of
self-reliance and contributes to overall
mental well-being.
Furthermore, the walk-in bathtub
market has responded to the
call for customization and style.
Manufacturers now offer various
features, such as hydrotherapy
jets, aromatherapy options, and
adjustable seating, turning the once
utilitarian fixture into a luxurious
experience. This not only caters to the
diverse preferences of users but also
challenges the misconception that
adaptive solutions compromise on
aesthetics.
16 HOMEADVICE
As we usher in an era of inclusivity
and accessibility, walk-in bathtubs
stand out as a symbol of progress.
They bridge the gap between design
and functionality, proving that
innovation in home improvement
can be both practical and elegant.
Embracing the widespread adoption
of walk-in bathtubs is a step towards
creating living spaces that evolve with
the changing needs of individuals,
ensuring that everyone can enjoy the
comfort and safety of their homes.

Home Advice Winter 2024
HOMEADVICE
17

18 HOMEADVICE

HOMEADVICE
19

20 HOMEADVICE

Advancements in Thermal Glass Coating
The world of glass technology has seen
remarkable advancements in recent years,
with thermal glass coatings and protective
coatings at the forefront of innovation.
These coatings offer a multitude of
benefits, from enhancing energy efficiency
to safeguarding against damage and
environmental factors. In this article, we
will explore the exciting developments
in thermal glass coatings and protective
coatings and how they are changing the way
we interact with glass.
Enhancing Energy Efficiency
Thermal glass coatings are a game-changer
for architects, engineers, and homeowners
alike. By applying a thin, virtually
invisible coating to glass surfaces, they can
significantly improve a building’s energy
efficiency. These coatings act as a barrier
to heat loss in colder months and heat gain
in warmer seasons, reducing the strain on
heating and cooling systems. This not only
lowers energy costs but also contributes to a
more sustainable and eco-friendly future.
Improved Solar Control
Protective coatings, particularly those
designed for outdoor applications, offer
exceptional durability and resistance to
harsh environmental elements. For example,
anti-reflective coatings can minimize glare
and improve visibility through windows,
while also protecting against harmful UV
radiation. These coatings are ideal for
skyscrapers, vehicles, and even solar panels,
making them more efficient and longerlasting.
Self-Cleaning and Anti-Fog Solutions
Innovations in protective coatings have
led to self-cleaning glass solutions that
rely on the hydrophobic properties of the
coating. Rainwater easily washes away
dirt and grime, leaving the glass spotless.
Additionally, anti-fog coatings are a blessing
for various applications, from automotive
windshields to eyeglasses, ensuring that
visibility remains unobstructed even in
humid or cold conditions.
Impact Resistance
Protective coatings are also being developed
to enhance glass’s impact resistance.
This makes them invaluable for use in
construction, where glass panels are
frequently subjected to extreme forces.
These coatings can prevent shattering,
reducing the risk of injuries and property
damage.
Conclusion
The world of thermal glass coatings and
protective coatings is evolving rapidly,
offering a wide range of benefits and
applications. From energy-efficient building
solutions to improved solar control,
self-cleaning glass, and enhanced impact
resistance, these coatings are transforming
the way we interact with glass in our
daily lives. As technology continues to
advance, we can expect even more exciting
developments in this field, paving the way
for a brighter, safer, and more sustainable
future
Marco Goncalves
(780) 915-0669
ecoglasssolutions.ca
HOMEADVICE
21

Illuminating the Future: Solar
Power’s Ascension in Canada
In recent years, Canada has experienced a
revolutionary shift in its energy landscape,
marked by a resounding commitment to
harnessing the power of the sun. As the
nation steers toward a more sustainable
future, solar energy has emerged as a pivotal
player in this transformative journey.
Canada’s expansive geography, spanning
from sun-soaked prairies to coastal
regions, positions it as an ideal canvas for
the widespread adoption of solar power.
This geographical diversity, coupled with
a national resolve to reduce greenhouse
gas emissions and transition to renewable
energy sources, has propelled solar
initiatives into the limelight, illuminating
the path to a cleaner, greener future.
At the forefront of this solar revolution
is the declining cost of solar technology.
The precipitous drop in prices for solar
panels and associated equipment has
democratized access to solar energy, making
it more economically viable than ever.
This newfound affordability has become
a catalyst, motivating both residential
and commercial entities to invest in solar
installations, contributing to a more
sustainable and diversified energy mix.
780-439-5254
Ride Farther
Ride Faster
Explore More
Ebikes
Starting
Below
$2000
Spend Less.
At Gateway we know our ebikes inside and out, so you don’t have to.
Check out our expansive lineup at edmontonatvpros.com/electric-bikes/
22 HOMEADVICE

Government support has played a pivotal
role in propelling solar initiatives across the
nation. Federal and provincial incentives,
rebates, and tax credits have created a
favorable environment for individuals and
businesses to transition to solar power.
These initiatives not only dismantle
financial barriers but also stimulate the
overall growth of the solar industry,
fostering a robust and resilient renewable
energy sector.
The environmental benefits of embracing
solar energy in Canada are profound.
By tapping into the power of the sun,
the nation can significantly diminish its
reliance on fossil fuels, mitigating the
adverse impacts of climate change. Solar
power systems generate electricity without
emitting harmful pollutants, contributing to
cleaner air, water, and soil. As Canada works
diligently to meet its climate goals and
commitments, the widespread adoption of
solar energy emerges as a cornerstone of the
nation’s environmental stewardship.
Beyond the environmental advantages,
the solar power sector is a generator of
economic opportunities and jobs. This
burgeoning industry fuels innovation,
research, and development, creating a ripple
effect of economic growth. Job creation in
solar-related fields, spanning manufacturing
to installation and maintenance, not
only bolsters local communities but also
positions Canada as a global leader in the
renewable energy market.
However, challenges persist in the journey
towards a solar-powered future. The
intermittency of sunlight, particularly in
northern regions during the winter months,
poses a logistical challenge for consistent
solar power generation. Yet, technological
advancements in energy storage and the
integration of smart grids offer promising
solutions, paving the way for a reliable and
resilient energy supply.
In the midst of Canada’s solar revolution,
innovative strides in energy storage
technologies are emerging as crucial
solutions to address the challenge
of sunlight intermittency, especially
in northern regions during winter.
Advancements in grid management
and energy storage promise to enhance
the reliability of solar power, ensuring
a consistent energy supply year-round.
This technological evolution underscores
the resilience of Canada’s commitment
to solar energy. As the nation navigates
these challenges, it solidifies its position as
a global pioneer in sustainable practices,
demonstrating a steadfast dedication to a
cleaner, greener, and more resilient future
for generations to come.
As Canada embraces the promise of solar
power, the nation stands at the forefront
of a sustainable energy revolution. The
sun, once a distant and untapped resource,
now acts as a guiding light, illuminating
a path toward a cleaner, more resilient
future. With ongoing technological
advancements, supportive policies, and a
growing commitment to environmental
responsibility, Canada’s journey towards
solar energy represents not just a leap
into the future but a profound pledge to
illuminate the path for generations to come.
HOMEADVICE
23

Calgary: The Ultimate City to
Call Home
Calgary, often dubbed the “Heart of the New West,” stands as
a shining gem in Canada’s landscape, and there are compelling
reasons why many consider it the best city to live in. With
its strong economy, stunning natural beauty, vibrant cultural
scene, and quality of life, Calgary offers a unique blend of urban
convenience and outdoor adventure that makes it an ideal place to
call home.
Economic Prosperity:
One of Calgary’s most significant draws is its robust economy.
The city has a long history tied to the energy sector, serving as
the headquarters for numerous oil and gas companies. However,
Calgary has also successfully diversified its economy, expanding
into sectors like technology, finance, and healthcare. This
diversification ensures a stable job market and opportunities for
professionals from various backgrounds.
Calgary consistently ranks as one of the highest-income cities in
Canada, with a strong job market that attracts talent from across
the country and around the world. The city’s low unemployment
rate and high average income provide residents with a comfortable
standard of living.
Natural Beauty and Outdoor Recreation:
Calgary’s proximity to the Canadian Rockies and its stunning
natural surroundings make it a paradise for outdoor enthusiasts.
Within a short drive, you can find yourself in Banff or Kananaskis
Country, offering world-class hiking, skiing, and breathtaking
mountain vistas. Whether you’re a seasoned mountaineer or a
casual nature lover, Calgary’s proximity to these outdoor wonders
ensures a rich and fulfilling recreational lifestyle.
24 HOMEADVICE

ensures a rich and fulfilling recreational lifestyle.
Additionally, the Bow River runs through the heart of the city,
providing opportunities for fishing, kayaking, and leisurely walks
along its picturesque pathways. In the winter, residents can enjoy
ice skating on the frozen lagoon at Prince’s Island Park, creating a
winter wonderland in the heart of the city.
Quality of Life:
Calgary consistently ranks high in terms of quality of life. The
city boasts an excellent healthcare system, top-notch education
options, and a low crime rate. Calgary’s clean streets, efficient
public transportation, and well-maintained parks contribute to a
high standard of living.
The city’s commitment to sustainability is evident in its efforts to
reduce greenhouse gas emissions, promote recycling, and expand
its network of cycling lanes. This eco-conscious approach aligns
with the desires of environmentally conscious residents.
making it easy for newcomers to integrate and feel at home.
The city’s sports culture is another point of pride, with the
Calgary Flames representing the city in the NHL and the Calgary
Stampeders in the CFL. Fans come together to cheer on their
teams, creating a sense of unity and shared excitement.
Conclusion:
In conclusion, Calgary’s blend of economic opportunity, natural
beauty, cultural richness, quality of life, and community spirit
make it a compelling choice for those seeking an ideal place
to live. Whether you’re captivated by the breathtaking Rocky
Mountains, drawn to the vibrant cultural scene, or enticed by the
city’s strong job market, Calgary offers something for everyone.
It’s a city where modernity meets nature, and where residents
enjoy a high quality of life in one of Canada’s most dynamic and
welcoming communities. All these factors combined make Calgary
undoubtedly one of the best cities to call home.
Community Spirit:
Calgary is known for its welcoming and friendly community spirit.
Neighbourhoods like Kensington, Inglewood, and Mission offer
unique character and charm, with a plethora of local shops, cafes,
and restaurants. These communities foster a sense of belonging,
HOMEADVICE
25

28 HOMEADVICE

HOMEADVICE
29

30 HOMEADVICE

HOMEADVICE
31

32 HOMEADVICE