Home Advice . Seniors Fall 2023
- No tags were found...
Create successful ePaper yourself
Turn your PDF publications into a flip-book with our unique Google optimized e-Paper software.
HOMEADVICE<br />
1
2 HOMEADVICE
<strong>Home</strong> <strong>Advice</strong> Is Now<br />
Booking for:<br />
@REALHOMEADVICE<br />
When requiring services, whether it be realtors, builders,<br />
contractors or more, we ask that you remember the businesses<br />
featured in this publication are the best in the industry.<br />
All rights reserved by <strong>Home</strong> <strong>Advice</strong>.<br />
Reproduction or transmission of all or any part of this publication<br />
by any means is strictly forbidden without the prior<br />
written consent of Real <strong>Home</strong> <strong>Advice</strong>. Although great detail<br />
and attention is taken to avoid any ad copy or editorial errors,<br />
any errors or omissions on the part of the publisher are<br />
limited and dealt with solely by printing a letter of retraction<br />
and/or correction in the following editions.<br />
DESIGNED AND PUBLISHED BY RHAMEDIA<br />
CONTACT:<br />
Phone: 1-780-406-6441<br />
Email: adcopy@realhomeadvice.ca<br />
Read Online:<br />
January Edition Calgary<br />
and Edmonton Dec 15-<br />
<strong>2023</strong><br />
February Edition Calgary<br />
and British Columbia Feb<br />
01- 2024<br />
March Edition Edmonton<br />
and Winnipeg March 04<br />
-2024<br />
780.406.6441<br />
adcopy@realhomeadvice.ca<br />
Reach thousands of<br />
<strong>Home</strong>owners<br />
and 50+ people with <strong>Home</strong> <strong>Advice</strong><br />
Digital and Print Magazines<br />
Averaging over 60,000 digital readers<br />
a year with Yumpu and Magzter<br />
HOMEADVICE<br />
3
Introducing <strong>Home</strong> <strong>Advice</strong><br />
<strong>Seniors</strong>: Enriching<br />
Perspectives, Honoring<br />
In the tapestry of life, the threads of experience, insight, and<br />
wisdom woven by our seniors hold a special place. These are<br />
the individuals who have weathered the storms and savored the<br />
sunshine, carrying with them a wealth of knowledge that spans<br />
generations. It is with great anticipation and enthusiasm that we<br />
announce the inception of a new section in our magazine—a<br />
dedicated space for senior advice.In a world often fixated on<br />
the latest trends and the fastest pace, the voices of our elders<br />
can get lost in the shuffle. We tend to overlook the treasure<br />
trove of guidance that can be garnered from their stories and<br />
lessons learned. This senior advice section aims to change that,<br />
bridging the generational gap and fostering a greater sense of<br />
understanding and appreciation.The wisdom that accompanies<br />
age is unparalleled. Lifetimes of experiences, challenges, triumphs,<br />
and growth culminate in a mosaic of insights that cannot be<br />
replicated. From navigating personal relationships to handling<br />
professional endeavors, our seniors have encountered a myriad<br />
of situations that have sculpted them into beacons of sagacity.<br />
Through this dedicated section, we provide them with a platform<br />
to share their pearls of wisdom, offering guidance to younger<br />
generations embarking on similar journeys.Moreover, this senior<br />
advice section is not merely about one-way communication; it is a<br />
testament to the power of intergenerational dialogue. In a society<br />
where rapid technological advancements sometimes threaten<br />
to create divisions, providing a space for seniors to share their<br />
advice fosters a sense of unity. It encourages readers to pause and<br />
listen, to recognize the shared human experience that transcends<br />
age, and to value the contributions of every age group.Imagine<br />
a reader seeking counsel on balancing a demanding career with<br />
family responsibilities. Instead of resorting solely to modern<br />
self-help resources, they can now turn to the words of a senior<br />
who managed a similar feat decades ago. The advice might be<br />
practical, emotional, or a blend of both, offering a perspective that<br />
goes beyond the pages of a textbook or the pixels of a screen. Such<br />
guidance is invaluable, as it combines the lessons of the past with<br />
the aspirations of the present, forming a roadmap for the future.<br />
Our commitment to introducing a senior advice section stems<br />
from a deep respect for the rich tapestry of human experience. As<br />
we embark on this new endeavor, we invite our readers to embrace<br />
the unique opportunity it presents—to learn, to connect, and<br />
to cherish the voices that have traversed the sands of time. The<br />
stories and insights shared within these pages are not just for the<br />
benefit of one generation, but for the enrichment of all who seek to<br />
navigate the complex labyrinth of life.Incorporating a senior advice<br />
section into our magazine is an acknowledgment that age is not a<br />
barrier, but a bridge—one that unites the past, present, and future.<br />
Through these shared narratives, we hope to inspire, educate, and<br />
celebrate the journey of life in all its stages.<br />
4 HOMEADVICE
NOW ACCEPTING<br />
RENTAL APPLICATIONS<br />
Vista Housing for <strong>Seniors</strong> provides affordable housing options in Edmonton, for low<br />
to modest income <strong>Seniors</strong> Citizens who are able to live independently in an apartment<br />
setting. Rent is calculated based on 30% of your household income<br />
Applications are available online, through our main office or at our<br />
properties.<br />
South East Edmonton<br />
Central Baptist Manor 9403-95 Avenue<br />
Millbourne Manor 2115 Millbourne Rd W.<br />
Bethel <strong>Seniors</strong> Residence 7728-82 Avenue<br />
St. Andrews Selo<br />
8025 – 101 Avenue<br />
North East Edmonton<br />
Norwood Golden Manor 11715-95 Street<br />
Casa Romana<br />
13439-97 Street<br />
St. Elia’s Pysanka Manor 11906-66 Street<br />
Tower 1<br />
12840-64 Street<br />
Viselka<br />
114515-86 Street<br />
North West Edmonton<br />
Alliance Villa<br />
12620-109A Avenue<br />
Calder Place<br />
12934119 Street<br />
Chinese Alliance Manor 9312-149 Street<br />
Mary A. Finlay Manor 10209-134 Avenue<br />
Ortona Villa<br />
10421-142 Street<br />
Central Edmonton<br />
Piazza Italia<br />
9521-108A Avenue<br />
Dnipro <strong>Seniors</strong> Residence 11030 – 107 Street<br />
Independent Living<br />
Apartments for Low Income<br />
<strong>Seniors</strong><br />
16 Properties are located in<br />
the City of Edmonton<br />
Bachelor, 1 Bedroom and 2<br />
Bedroom Apartments<br />
All properties certified by<br />
the Edmonton City Police<br />
Crime Free Multi Housing<br />
Program<br />
Well Maintained, Safe,<br />
Secure Buildings.<br />
(780) 476-1470<br />
Vista Housing for <strong>Seniors</strong><br />
11622- 119 Street<br />
Edmonton, AB www.<br />
vistahousing.org<br />
HOMEADVICE<br />
5
<strong>Home</strong> <strong>Advice</strong> <strong>Seniors</strong> - <strong>Fall</strong> <strong>2023</strong><br />
Renovate with confidence!<br />
EMPOWERING HOMEOWNERS GET THROUGH THEIR RENOVATIONS,<br />
STRESS FREE!<br />
Proud Team of Vetted Sub-Contractors<br />
for any renovation project.<br />
Bring Your Vision To Life & Save Thousands<br />
CALL TODAY<br />
For Free In-House Consultation 587-277-9636<br />
6 HOMEADVICE
HOMEADVICE<br />
7
The Power of Practice:<br />
Unveiling the Potential for<br />
<strong>Seniors</strong><br />
In the ever-evolving symphony of life,<br />
every note represents an opportunity for<br />
personal growth and transformation. As<br />
the years roll by and we find ourselves in<br />
the embrace of our golden years, the notion<br />
that the power of practice is the exclusive<br />
domain of youthful enthusiasm could not<br />
be further from the truth. Indeed, it holds<br />
an equally vital place in the lives of seniors.<br />
The age-old adage, “practice makes perfect,”<br />
transcends generational boundaries,<br />
warmly embracing seasoned individuals<br />
who persistently flourish through their<br />
unwavering dedication and unwavering<br />
perseverance.<br />
In a world that occasionally overlooks<br />
the remarkable capabilities of seniors,<br />
embracing the power of practice becomes<br />
a profound tribute to the indomitable<br />
spirit that defies age-related stereotypes.<br />
<strong>Seniors</strong> who commit themselves to<br />
deliberate practice, whether they embark<br />
on the journey of mastering a new musical<br />
instrument or immerse themselves in the<br />
intricacies of digital technology, experience<br />
the thrill of progress and the profound joy<br />
of accomplishment.<br />
The cognitive benefits of continuous<br />
practice are nothing short of extraordinary.<br />
Research consistently underscores the<br />
brain’s remarkable plasticity, which remains<br />
undiminished by the passage of time.<br />
Engaging in regular mental exercises, such<br />
as tackling intricate puzzles or immersing<br />
oneself in the acquisition of a new language,<br />
empowers seniors to enhance memory<br />
retention, sharpen their problem-solving<br />
acumen, and maintain cognitive agility.<br />
8 HOMEADVICE<br />
But the power of practice doesn’t stop<br />
at the realm of intellect; it profoundly<br />
enriches emotional and physical wellbeing.<br />
Engaging in activities that resonate<br />
with personal passions nurtures an<br />
enduring sense of purpose and belonging.<br />
Whether it’s cultivating a flourishing<br />
garden, perfecting culinary skills, or<br />
expressing artistic creativity with fervor,<br />
these practiced endeavors infuse life with<br />
vibrancy, meaning and occasionally a<br />
Championship.<br />
Such was the case in August when after<br />
seven years I finally won the A Event<br />
Championship (6 Wins - 0 Losses) at<br />
the 41st Osoyoos Midsummer Bonspiel.<br />
Although I had not thrown a curling<br />
rock since April, it was the extra training<br />
from last winter that assisted my peak<br />
performance this summer. The symphony<br />
of life, in its infinite wisdom, recognizes<br />
68 as just a number; it is the unwavering<br />
dedication to practice that composes a<br />
legacy of resilience, boundless growth and<br />
the relentless pursuit of excellence.<br />
So how can seniors harness the power of<br />
practice to unlock their full potential?<br />
1. Embrace Lifelong Learning<br />
<strong>Seniors</strong> should see themselves as perpetual<br />
learners. Whether it’s acquiring a new<br />
talent, perfecting an old skill, exploring a<br />
new subject, or diving into a hobby, the<br />
pursuit of knowledge and mastery should<br />
be ongoing. The joy of learning never<br />
diminishes with age.<br />
2. Rediscover Passions<br />
Many seniors may have set aside their<br />
passions in the hustle and bustle of life.<br />
Now is the time to rekindle those flames.<br />
Whether it’s scriptwriting, playing pickle<br />
ball, gardening, volunteering, trick roping,<br />
inventing a special device or any other<br />
passion, practice and nurture these interests<br />
to experience a renewed sense of purpose<br />
and fulfillment.<br />
3. Stay Physically Active<br />
Physical health is the foundation of a<br />
fulfilling life. Engaging in regular physical<br />
activity not only improves fitness but also<br />
boosts mood and cognitive function. I<br />
invite you to explore activities like yoga,<br />
aquatic fitness, tai chi, gental fitness, stick/<br />
wheelchair curling, or take daily walks<br />
to keep your body resilient, agile and<br />
maintaining wellness.<br />
“Do what keeps you young at heart.”<br />
Dr. Neville Headley, DDS<br />
403.300.3232<br />
info@christiecrossingdental.com
I’M<br />
LIVING<br />
WELL<br />
by not cooking<br />
unless I want to<br />
- and I really<br />
don’t want to.<br />
TM<br />
Calgary’s Best New Active<br />
Aging Retirement Community<br />
Joyful retirement doesn’t just happen – it’s a choice. That’s why at<br />
Trico LivingWell, we chose to put the best of everything into our<br />
new seniors’ residence in south Calgary. From wellness to dining,<br />
and amenities to our spacious suites, the only thing missing is you.<br />
Come join our amazing community – and bring your appetite too.<br />
HURRY IN - NOW LEASING FINAL PHASE!<br />
CHOOSE FROM<br />
Stylish new studio,<br />
1 bedroom,<br />
1 bedroom + den<br />
& 2 bedroom suites<br />
INDEPENDENT<br />
LIVING from<br />
$3,435<br />
/month<br />
ASSISTED<br />
LIVING from<br />
$4,610<br />
/month<br />
Visit us today:<br />
7670 - 4A Street SW<br />
Now open!<br />
Reserve your<br />
suite today!<br />
403.281.2802<br />
tricolivingwell.com<br />
INDEPENDENT LIVING • ASSISTED LIVING • DEMENTIA CARE<br />
HOMEADVICE<br />
9
Peripheral Neuropathy Breakthrough!<br />
“My feet feel like they’re on fire.”<br />
“Each step feels like I’m walking<br />
through wet paint.”<br />
“I live in constant fear that I’ll fall.”<br />
“I can't sleep, my hands and feet tingle<br />
all night.”<br />
What do all of these people have in<br />
common? They suffer from peripheral<br />
neuropathy. It’s estimated that thousands<br />
of people in Canada have peripheral<br />
neuropathy.<br />
Dr. Melanie Morrill Ac. of Accessible<br />
Acupuncture in Edmonton, AB suspects<br />
there are even more. “I’ve been treating<br />
neuropathy, in all its various forms, for<br />
over five years and so often my patients<br />
come to me because of the symptoms,<br />
not because of a diagnosis. They read the<br />
testimonial of another patient and say to<br />
themselves ‘hey, I feel the same thing’.”<br />
Shirley of Downtown Edmonton testified<br />
to this. “I remember my husband driving<br />
me to my consultation and I saw a woman<br />
running just outside our neighbourhood. I<br />
was so envious - I just kept thinking ‘I<br />
would give anything just to walk again’.<br />
My primary care doctor told me my<br />
troubles with pain and balance were just<br />
symptoms of old age. I was so<br />
depressed.”<br />
Fortunately, Shirley would eventually see<br />
Dr. Melanie Morrill Ac. on the local news<br />
talking about similar symptoms and how<br />
she offers a real solution at Accessible<br />
Acupuncture. “I just knew I had to see her.<br />
She was my last hope.”<br />
“Almost all of our patients come to us with<br />
a story similar to Shirley’s. They’ve been<br />
everywhere else. They’ve been told<br />
there’s no hope. They’ve been told ‘it’s<br />
just part of getting older.” shares Kelly, a<br />
Patient Care Coordinator at Accessible<br />
Acupuncture. “It just breaks my heart but I<br />
know how much we can help people like<br />
Shirley so I’m always so happy when they<br />
walk through our door.”<br />
Those diagnosed with peripheral<br />
neuropathy often face a very grim reality;<br />
Western medicine declares that there is<br />
no solution while most alternative<br />
therapies carry large price tags and offer<br />
little to no resolve. Which is why Dr.<br />
Melanie Morrill Ac. and the staff at<br />
Accessible Acupuncture pride<br />
themselves on being ‘the last resort with<br />
the best results".<br />
Peripheral neuropathy is a result of<br />
damage to the nerves and this damage<br />
is commonly caused by a lack of blood<br />
flow in the hands and feet.<br />
Peripheral Neuropathy?<br />
SCHEDULE a consultation TODAY<br />
C A L L 5 8 7 - 8 7 9 - 7 1 2 2<br />
10 HOMEADVICE<br />
A lack of blood flow results in a lack of<br />
nutrients; the nerves then begin to<br />
degenerate and die which causes pain<br />
ranging from discomfort to<br />
debilitating. Because neuropathy is a<br />
degenerative condition, once those<br />
nerves begin to deteriorate they will<br />
continue to do so until they are<br />
completely expired, leaving those<br />
suffering with crippling balance issues.<br />
“In this case, the absence of pain is not<br />
necessarily a good thing.” shares Dr.<br />
Melanie Morrill Ac. “This usually<br />
indicates that your nerves are hanging<br />
on by a fragile thread.”<br />
How exactly is Dr. Melanie Morrill Ac.<br />
able to reverse the effects of this<br />
degenerative disease? “Acupuncture<br />
has been used to increase blood flow<br />
for thousands of years which helps to<br />
get the necessary nutrients to the<br />
affected nerves. But the real magic<br />
happens when I integrate ATP<br />
Resonance BioTherapy. This is a<br />
technology that was originally<br />
developed by NASA to expedite<br />
recovering and healing.”<br />
“I just can’t say enough about<br />
Accessible Acupuncture,” Shirley<br />
shared through tears of joy. “My<br />
husband and I moved here 3 years<br />
ago and he’s gone to the river valley<br />
almost every day to walk. I always<br />
stayed home because of the pain<br />
and discomfort. Yesterday I walked<br />
beside the river with him! And next<br />
week we’re starting square dancing<br />
again! I am truly living life these<br />
days.”<br />
“According to Shirley’s test results, she<br />
has seen a 74% improvement in pain<br />
and functionality, which is on par with<br />
a majority of our patients,” Shares<br />
Kelly.<br />
“But more important than those test<br />
results is the joy she’s expressed<br />
being here and hearing about all the<br />
amazing things she’s able to do<br />
because she feels great!”<br />
By seamlessly blending the ancient<br />
science of acupuncture with modern<br />
medical solutions Dr. Melanie Morrill<br />
Ac. has achieved a 90% success rate in<br />
reversing the effects of neuropathy.<br />
She starts each patient with an initial<br />
consultation during which a sensory<br />
exam is performed.<br />
“This not only aids in making a proper<br />
diagnosis but it helps to define just<br />
how much nerve damage has<br />
occurred,” tells the Doctor of<br />
Acupuncture. “This is important<br />
because if a patient has suffered more<br />
than 95% damage, there is little that I<br />
can do to help them. I’m familiar with<br />
the medical miracle but I know my<br />
limits as a practitioner and the limits of<br />
my medicine.”<br />
When it comes to treating peripheral<br />
neuropathy, regardless of its origin,<br />
early detection greatly improves your<br />
chances of a full recovery.<br />
If you or someone you love are<br />
suffering from chronic pain that<br />
presents as burning, tingling or ‘pins<br />
and needles' or you’ve recently been<br />
diagnosed with peripheral neuropathy,<br />
it’s important to know that there are<br />
options.<br />
There is hope!<br />
Accessible Acupuncture is now<br />
accepting new patients but only for a<br />
limited time. Only 10 new neuropathy<br />
patients will be accepted each month.<br />
Call 587-879-7122 to schedule.<br />
HYS Centre<br />
600, 11010 101 st NW Edmonton, AB<br />
AccessibleAcupuncture.ca
Moving houses is a<br />
significant undertaking at<br />
any age,<br />
but for seniors, it requires extra<br />
consideration and planning to ensure a<br />
smooth transition. Here are essential tips<br />
to help seniors navigate the process with<br />
minimal stress and maximum ease.<br />
1. Start Early: Time is your ally. Begin the<br />
process well in advance, allowing ample<br />
time for sorting through belongings,<br />
making decisions, and hiring movers if<br />
necessary. Procrastination can lead to<br />
rushed decisions and unnecessary stress.<br />
2. Create a Plan: Craft a detailed moving<br />
plan that outlines tasks, deadlines, and<br />
a checklist of items that need attention.<br />
Having a structured approach will help you<br />
stay organized and reduce the feeling of<br />
being overwhelmed.<br />
3. Downsize Wisely: Over the years,<br />
possessions accumulate. Take this<br />
opportunity to declutter by identifying<br />
items you truly need or cherish. Consider<br />
donating, selling, or gifting items that no<br />
longer serve a purpose, making the move to<br />
a new home more manageable.<br />
4. Prioritize Accessibility: If health or<br />
mobility issues are a concern, prioritize<br />
finding a new house that is accessible and<br />
safe. Single-story homes or properties with<br />
features like ramps, handrails, and wider<br />
doorways can make daily life easier.<br />
5. Seek Professional Help: Enlist the<br />
assistance of professional moving<br />
companies experienced in senior<br />
relocations. They can handle logistics,<br />
packing, and heavy lifting, reducing<br />
physical strain on you.<br />
6. Preserve Memories: While downsizing,<br />
it’s important to keep sentimental items that<br />
hold precious memories. These objects can<br />
provide a sense of familiarity and comfort<br />
in your new environment.<br />
7. Notify Important Parties: Ensure a<br />
seamless transition by updating your<br />
address with the post office, banks,<br />
healthcare providers, and any other relevant<br />
institutions. This will prevent important<br />
mail from being lost.<br />
8. Pack an Essentials Box: Pack a box with<br />
essentials such as medications, toiletries,<br />
important documents, a change of clothes,<br />
and personal items. This will save you from<br />
rummaging through boxes during the first<br />
days in your new home.<br />
9. Embrace the Change: Moving can be<br />
emotionally challenging, but it also marks a<br />
fresh start. Embrace the new opportunities<br />
your new house and neighborhood offer.<br />
Engage in local activities to meet new<br />
people and build a sense of community.<br />
10. Accept Help: Don’t hesitate to ask<br />
friends, family, or neighbors for assistance.<br />
Moving is a team effort, and loved ones are<br />
often more than willing to lend a hand.<br />
In conclusion, moving houses as a senior<br />
necessitates careful planning and a patient<br />
approach. By starting early, downsizing<br />
thoughtfully, seeking professional help, and<br />
embracing the change, the moving process<br />
can be transformed into a positive and<br />
exciting step toward a new chapter in life.<br />
Guest post written by Gail Labine<br />
780.998.2422<br />
office@fortmoving.ca<br />
HOMEADVICE<br />
11
Edmonton: A Vibrant City of<br />
Diversity and Opportunity<br />
Nestled along the banks of the North Saskatchewan River in<br />
Alberta, Canada, lies the dynamic and culturally rich city of<br />
Edmonton. With a population exceeding one million residents,<br />
Edmonton stands as the capital of Alberta and is the province’s<br />
second-largest city. It is a city renowned for its stunning natural<br />
landscapes, thriving economy, and diverse community, making it a<br />
unique and appealing destination for residents and visitors alike.<br />
One of Edmonton’s most distinguishing features is its natural<br />
beauty. The city boasts an array of parks and green spaces that<br />
offer a serene escape from the hustle and bustle of urban life.<br />
Hawrelak Park, situated in the heart of the city, is a popular spot<br />
for picnics, paddle boating, and outdoor concerts in the summer,<br />
while the river valley system provides an extensive network of<br />
trails for hiking and biking throughout the year. Edmonton’s<br />
appreciation for nature is evident in the Muttart Conservatory,<br />
an iconic glass pyramid structure housing a vast collection of<br />
botanical specimens from around the world.<br />
The city’s thriving economy serves as a testament to its resilience<br />
and adaptability. Historically known as the “Oil Capital of Canada,”<br />
Edmonton’s economy has diversified significantly over the years.<br />
It now encompasses industries such as healthcare, education,<br />
technology, and manufacturing. The presence of institutions<br />
like the University of Alberta and the Alberta Research Council<br />
has nurtured a culture of innovation and research, fostering the<br />
growth of cutting-edge technologies and startups.<br />
Edmonton’s commitment to inclusivity and diversity is reflected<br />
in its multicultural communities. People from all corners of the<br />
world have made Edmonton their home, contributing to a vibrant<br />
tapestry of cultures and traditions. The city celebrates this diversity<br />
through numerous cultural festivals and events, such as the<br />
Heritage Festival, which showcases cuisine, art, and performances<br />
from over 100 countries. Sporting enthusiasts find plenty to cheer<br />
for in Edmonton, thanks to the city’s passionate support for its<br />
sports teams. The Edmonton Oilers, an NHL hockey team, and<br />
the Edmonton Eskimos (now known as the Edmonton Elks), a<br />
Canadian Football League team, have loyal fan bases that create an<br />
electric atmosphere during games. Additionally, the city is home<br />
to the Edmonton Oilers’ stunning arena, Rogers Place, which<br />
hosts not only sporting events but also world-class concerts and<br />
entertainment shows.<br />
In conclusion, Edmonton is a city that embraces its natural<br />
beauty, diverse culture, economic vitality, and community spirit.<br />
Whether you’re drawn to its stunning natural landscapes, seeking<br />
career opportunities in a thriving job market, or simply looking<br />
to immerse yourself in a rich tapestry of cultures, Edmonton has<br />
something to offer everyone. It is a city that continually evolves<br />
while staying true to its roots, making it a remarkable place to live.<br />
OUR SERVICES:<br />
Gas Fireplaces<br />
Wood Fireplaces<br />
Fireplace Mantels<br />
Fireplace Surroundings<br />
Wood Stoves<br />
Competitive prices<br />
The<br />
Fireplace<br />
Guy<br />
780.974.7689<br />
Edmonton, AB<br />
12 HOMEADVICE
HOMEADVICE<br />
13
Ennnneeeeeerrrrrrrggyy---<br />
EF>@iiieeeeeennnn<<br />
Wiiinnnnddddooowss<br />
aaaaannnndddd<br />
Coomppplleeeeeettttteeeeee Wiinnndoow & Doooorrr<br />
Seeeeeerrrviiceeeeeessss<br />
EddddNooonnnnMooonnnn<br />
1111111144444477444444 WWWiiiiiiicnnnnnnnntttttttteeeeeeeerrrrrrrrbbuuuuuuurrrrrrrrnnnnnnnn RRRdddddddd NNWWW<br />
EEddddddddmmmmmmmoooooooonnnnnnnnttttttttoooooooonnnnnnnn,,,,,, AAAAABBBB TTT555555SSS 22222Y33<br />
(777780)<br />
4557777---95577777777<br />
DDoooooorrrrrrrss<br />
Caaaaalggaaaaarrrrrrryy<br />
444444822222444444 55555522222 SSStttttttt. SSSEE<br />
CCaaaaaaaalllllgggggaaaaaaaarrrrrrrryyyyyyy,,,,,, AAAAABBBB TTT22222BBBB 33RRR22222<br />
(40–) 407777--- 4557777<br />
Prrroofeeeeeessssssssiioonnnaaaaa lllly<br />
Innnsssstttttaaaaa lllleeeeeerrrssss<br />
Geeeeeettttt uuppp tttttoo<br />
$5000000000000000<br />
iinnn<br />
Reeeeeebbaaaaattttteeeeeessss!<br />
WWWiiiiiiictttttttthhhhhhhh tttttttthhhhhhhheeeeeeee CCaaaaaaaannnnnnnnaaaaaaaaddddddddaaaaaaaa GGrrrrrrrreeeeeeeeeeeeeeeennnnnnnneeeeeeeerrrrrrrr Hoooooooommmmmmmeeeeeeeessssssss<br />
GGrrrrrrrraaaaaaaannnnnnnntttttttt,,,,,, yyyyyyyoooooooouuuuuuu cccciccaaaaaaaannnnnnnn rrrrrrrreeeeeeeeccccicceeeeeeeeiiiiiiicvvvveeeeeeee uuuuuuupppp ttttttttoooooooo $555555000000000000<br />
iiiiiiicnnnnnnnn rrrrrrrreeeeeeeebbaaaaaaaatttttttteeeeeeeessssssss ttttttttoooooooo uuuuuuuppppgggggrrrrrrrraaaaaaaaddddddddeeeeeeee yyyyyyyoooooooouuuuuuurrrrrrrr hhhhhhhhoooooooommmmmmmeeeeeeee<br />
wwwwiiiiiiictttttttthhhhhhhh nnnnnnnneeeeeeeewwww,,,,,, ssssssssttttttttyyyyyyyllllliiiiiiicsssssssshhhhhhhh,,,,,, eeeeeeeennnnnnnneeeeeeeerrrrrrrrgggggyyyyyyy-eeeeeeeeffccccicciiiiiiiceeeeeeeennnnnnnntttttttt<br />
Trrr aaaaaiinnneeeeee d<br />
Reeeeeedddd<br />
wwwwiiiiiiicnnnnnnnnddddddddoooooooowwwwssssssss aaaaaaaannnnnnnndddddddd ddddddddoooooooooooooooorrrrrrrrssssssss.<br />
DDeeeeeeeeeeeerrrrrrr<br />
55555555555511111111 5555550000 AAAAAvvvveeeeeeee<br />
RRReeeeeeeedddddddd Deeeeeeeeeeeeeeeerrrrrrrr,,,,,, AAAAABBBB TTT444444NN 77AAAAA444444<br />
(40–) 407777---± 55<br />
Ennneeeeeerrrgy ---Stttttaaaaarrr<br />
Liiceeeeeennnsssseeeeee d & Innnssssuu rrreeeeeed 10000000000% Cuusssstttttoomeeeeeerrr Saaaaatttttiissss faaaaactttttiioonnn Waaaaarrrrrraaaaannnttttty<br />
Raaaaattttteeeeee d<br />
Grrrrrrraaaaannnnddddeeeeee<br />
Prrrrrrraaaaaiiirrrrrrriiieeeeee<br />
11111111000022222555555 8Ø AAAAAvvvveeeeeeee Ðnnnnnnnniiiiiiictttttttt Ç111111110000<br />
GGrrrrrrrraaaaaaaannnnnnnnddddddddeeeeeeee Ñrrrrrrrraaaaaaaaiiiiiiicrrrrrrrriiiiiiiceeeeeeee,,,,,, AAAAABBBB TTT8Ê 555555BBBBØ<br />
(5587777)<br />
8±8---5555557777<br />
Wiinnndoow Maaaaa rrrttttt iissss ppp rrroouud tttttoo bbeeeeee ttttt heeeeee<br />
lleeeeeeaaaaa diinnng ppprrrooviideeeeeerrr oof wiinnndoowssss aaaaannn d<br />
doooorrrssss iinnn Allbbeeeeeerrrtttttaaaaa. Weeeeee sssspppeeeeee ciiaaaaalliizeeeeee iinnn<br />
hiigh---quuaaaaalliittttty aaaaannnd eeeeeennneeeeee rrrgy ---eeeeeefciieeeeeennnttttt<br />
wiinnndoowssss , doooo rrrssss, aaaaannn d wiinnn doow<br />
cooveeeeeerrriinnngssss. Ouurrr iinnnsssstttttaaaaa llllaaaaatttttiioonnn ttttteeeeeeaaaaa mssss<br />
aaaaarrreeeeee iinnn duusssstttttrrry---tttttrrraaaaaiinnneeeeee d aaaaannn d weeeeee llll<br />
eeeeeexpppeeeeeerrriieeeeeennnceeeeeed iinnn aaaaa llll tttttypppeeeeeessss oo f wiinnndoow<br />
aaaaannnd doooo rrr rrreeeeeepppllaaaaaceeeeeemeeeeeennnttttt ppp rrroojeeeeeectttttssss.<br />
WWWiiiiiiicnnnnnnnnddddddddoooooooowwww Maaaaaaaarrrrrrrrtttttttt hhhhhhhhaaaaaaaassssssss tttttttthhhhhhhheeeeeeee eeeeeeee xppppeeeeeeeerrrrrrrriiiiiiiceeeeeeeennnnnnnnccccicceeeeeeee aaaaaaaannnnnnnndddddddd eeeeeeee xppppeeeeeeeerrrrrrrrttttttttiiiiiiicsssssssseeeeeeee ttttttttoooooooo ttttttttaaaaaaaa keeeeeeee<br />
oooooooonnnnnnnn eeeeeeeevvvveeeeeeeennnnnnnn tttttttthhhhhhhheeeeeeee mmmmmmmoooooooosssssssstttttttt ccccicchhhhhhhhaaaaaaaalllllllllleeeeeeeennnnnnnngggggiiiiiiicnnnnnnnnggggg wwwwiiiiiiicnnnnnnnnddddddddoooooooowwww oooooooorrrrrrrr ddddddddoooooooooooooooorrrrrrrr<br />
iiiiiiicmmmmmmmpppprrrrrrrroooooooovvvveeeeeeeemmmmmmmeeeeeeeennnnnnnntttttttt pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt wwwwiiiiiiictttttttthhhhhhhh cccciccoooooooonnnnnnnnfddddddddeeeeeeeennnnnnnnccccicceeeeeeee. WWWeeeeeeee ooooooooffeeeeeeeerrrrrrrr<br />
cccciccoooooooommmmmmmppppllllleeeeeeeemmmmmmmeeeeeeeennnnnnnnttttttttaaaaaaaarrrrrrrryyyyyyy eeeeeeeessssssssttttttttiiiiiiicmmmmmmmaaaaaaaattttttttiiiiiiicoooooooonnnnnnnn sssssssseeeeeeeerrrrrrrrvvvviiiiiiicccccicceeeeeeeessssssss ttttttttoooooooo eeeeeeeennnnnnnnssssssssuuuuuuurrrrrrrreeeeeeee yyyyyyyoooooooouuuuuuu aaaaaaaarrrrrrrreeeeeeee<br />
cccciccoooooooommmmmmmfoooooooorrrrrrrrttttttttaaaaaaaabbllllleeeeeeee gggggooooooooiiiiiiicnnnnnnnnggggg aaaaaaaahhhhhhhheeeeeeeeaaaaaaaadddddddd wwwwiiiiiiictttttttthhhhhhhh yyyyyyyoooooooouuuuuuurrrrrrrr pppprrrrrrrroooooooo jeeeeeeeeccccicctttttttt.<br />
wwwwwwwwwwwwwww..wwwwwindowwwwwmaart ..caa<br />
14 HOMEADVICE
Ennnnnnnntttttrrrrrrrryyy DDoooooooooooooooorrrrrrrrsssssss Paaaaatttttiiiiiiiioooooooo DDoooooooooooooooorrrrrrrrsssssss<br />
CCCrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee se eissshcoooooopliylllluuuuuuuutna stttwniiiiiihcooooooaeainnnn ffffffffhcoooooorrrrrrrr ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee wniiiiiise eisss mmllheeea h aaaase eisssntyyyyyy wwwwwwwwniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ndddddddhcoooooohcoooooorrrrrrrrse eisss<br />
ggggggggpliylllla h aaaase eisssse eisss wniiiiiiaeainnnnse eisssmmllheeerrrrrrrrtna stttse eisss,,,,,,,l pliyllllhcooooooccccccckk se eisssmmllheeetna stttse eisss,,,,,,,l ndddddddhcoooooohcoooooorrrrrrrr tshhhhha h aaaaaeainnnnndddddddpliyllllmmllheeese eisss,,,,,,,l mpppppppuuuuuuuupliyllllpliyllll bbbbbbbaa h aaaarrrrrrrrse eisss a h aaaaaeainnnnnddddddd oeommmmma h aaaaaeainnnnntyyyyyy hcooooootna sttttshhhhhmmllheeerrrrrrrr ndddddddhcoooooohcoooooorrrrrrrr hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eissse......y<br />
OOuuuuuuuurrrrrrrr ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff tshhhhhwniiiiiiggggggggtshhhhh---qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy,,,,,,,l mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnntna sttt,,,,,,,l a h aaaaaeainnnnnddddddd bbbbbbbammllheeea h aaaauuuuuuuutna stttwniiiiiiffffffffuuuuuuuupliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss ccccccchcooooooaeainnnnse eissswniiiiiise eissstna stttse eisss hcooooooffffffff<br />
ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll ndddddddhcoooooohcoooooorrrrrrrrse eissse......y A pliyllllpliyllll hcoooooouuuuuuuurrrrrrrr ndddddddhcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggntyyyyyy a h aaaaaeainnnnnddddddd<br />
oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eissse......y OOuuuuuuuurrrrrrrr mmllheeexxxexcccccccpliylllluuuuuuuuse eissswniiiiiivvvvvvvommllheee ccccccchcoooooopliyllllpliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff ffffffbbbbbbbammllheeerrrrrrrrggggggggpliylllla h aaaase eisssse eisss a h aaaaaeainnnnnddddddd se eissstna stttmmllheeemmllheeepliyllll mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheeese eisss mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll<br />
mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l nddddddduuuuuuuurrrrrrrra h aaaabbbbbbbawniiiiiipliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd ffffffffuuuuuuuuaeainnnnccccccctna stttwniiiiiihcooooooaeainnnna h aaaapliyllllwniiiiiitna stttntyyyyyye......y WWWW mmllheee hcooooooffffffffffffffffmmllheeerrrrrrrr mmllheeeaeainnnntna stttrrrrrrrrntyyyyyy ndddddddhcoooooohcoooooorrrrrrrrse eisss wniiiiiiaeainnnn tna stttrrrrrrrra h aaaandddddddwniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll,,,,,,,l<br />
tna stttrrrrrrrra h aaaaaeainnnnse eissswniiiiiitna stttwniiiiiihcooooooaeainnnna h aaaapliyllll a h aaaaaeainnnnnddddddd oeommmmmhcoooooondddddddmmllheeerrrrrrrraeainnnn ndddddddmmllheeese eissswniiiiiiggggggggaeainnnnse eissse......y<br />
BBEEEEEEESSSSTTTTTTT RRRRAAAAATTTTTTTEEEEEEEDDDD CCCCCCOOOMMPAAAAANNYY<br />
Scaaaaannnnnnnn mmeeeeeeee!<br />
Goooooooooooooooogglllleeeeeeee<br />
Reeeeeeeeviiiiiiiieeeeeeeewwsssssss<br />
4.8 Stna sttta h aaaarrrrrrrrse eisss | 17559 rrrrrrrrmmllheeevvvvvvvowniiiiiimmllheeewwwwwwwse eisss<br />
CCCCCCUSSSSTTTTTTTOOOMMEEEEEEERRRR<br />
SSSSAAAAATTTTTTTIIIIISSSSFFAAAAACCCCCCTTTTTTTIIIIIOOONN<br />
Viiiiiiiinnnnnnnnyyyllll<br />
WWWiiiiiiiinnnnnnnnddoooooooowwsssssss<br />
VVwniiiiiiaeainnnnntyyyyyypliyllll tshhhhha h aaaase eisss bbbbbbbammllheeeccccccchcoooooooeommmmmmmllheee hcooooooaeainnnnmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmmhcoooooose eissstna sttt mppppppphcoooooompppppppuuuuuuuupliylllla h aaaarrrrrrrr wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww ffffffffrrrrrrrra h aaaaoeommmmmmmllheee oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff wniiiiiitna stttse eisss uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee<br />
bbbbbbbapliyllllmmllheeeaeainnnnnddddddd hcooooooffffffff se eissstna stttntyyyyyypliyllllmmllheee,,,,,,,l mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee,,,,,,,l a h aaaaaeainnnnnddddddd ccccccchcooooooaeainnnnvvvvvvvommllheeeaeainnnnwniiiiiimmllheeeaeainnnncccccccmmllheeee......y Bhcooooooa h aaaase eissstna stttwniiiiiiaeainnnngggggggg bbbbbbbahcooooootna sttttshhhhh mmllheeexxxexcccccccmmllheeemppppppptna stttwniiiiiihcooooooaeainnnna h aaaapliyllll qqqqquuuuuuuua h aaaapliyllllwniiiiiitna stttntyyyyyy a h aaaaaeainnnnnddddddd<br />
hcoooooouuuuuuuutna stttse eissstna sttta h aaaaaeainnnnndddddddwniiiiiiaeainnnngggggggg mmllheeeaeainnnnmmllheeerrrrrrrrggggggggntyyyyyy---mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy,,,,,,,l vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ndddddddmmllheeepliyllllwniiiiiivvvvvvvommllheeerrrrrrrr a h aaaa ggggggggrrrrrrrrmmllheeea h aaaatna sttt rrrrrrrrmmllheeetna stttuuuuuuuurrrrrrrraeainnnn hcooooooaeainnnn wniiiiiiaeainnnnvvvvvvvommllheeese eissstna stttoeommmmmmmllheeeaeainnnntna sttte......y<br />
WWWaaaaarrrrrrrrrrrrrrrraaaaannnnnnnntttttyyy<br />
255<br />
Yeeeeeeeeaaaaarrrrrrrr<br />
A pliyllllpliyllll WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheee a h aaaa uuuuuuuuaeainnnnwniiiiiiqqqqquuuuuuuummllheee oeommmmmuuuuuuuupliylllltna stttwniiiiii---ccccccctshhhhha h aaaaoeommmmmbbbbbbbammllheeerrrrrrrr ccccccchcooooooaeainnnnse eissstna stttrrrrrrrruuuuuuuuccccccctna stttwniiiiiihcooooooaeainnnn tna sttttshhhhha h aaaatna sttt oeommmmma h aaaaxxxexwniiiiiioeommmmmwniiiiiizzmmllheeese eisss<br />
wniiiiiiaeainnnnse eisssuuuuuuuupliylllla h aaaatna stttwniiiiiihcooooooaeainnnn,,,,,,,l tna sttttshhhhhmmllheeerrrrrrrroeommmmma h aaaapliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyy a h aaaaaeainnnnnddddddd se eissstna stttuuuuuuuurrrrrrrrndddddddwniiiiiiaeainnnnmmllheeese eisssse eissse......y OOuuuuuuuurrrrrrrr pliyllllwniiiiiiaeainnnnmmllheeeuuuuuuuumppppppp hcooooooffffffff vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss ffffffffmmllheeea h aaaatna stttuuuuuuuurrrrrrrrmmllheeese eisss a h aaaa wwwwwwwwniiiiiindddddddmmllheee<br />
rrrrrrrra h aaaaaeainnnnggggggggmmllheee hcooooooffffffff ccccccchcoooooopliyllllhcoooooorrrrrrrrse eisss,,,,,,,l ffffffaeainnnnwniiiiiise eissstshhhhhmmllheeese eisss a h aaaaaeainnnnnddddddd se eissstna stttntyyyyyypliyllllmmllheeese eisss tna sttttshhhhha h aaaatna sttt wwwwwwwwniiiiiipliyllllpliyllll ccccccchcoooooooeommmmmmppppppppliyllllmmllheeeoeommmmmmmllheeeaeainnnntna sttt a h aaaaaeainnnnntyyyyyy tshhhhhhcoooooooeommmmmmmllheeee......y<br />
VVwniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tshhhhha h aaaavvvvvvvommllheee ndddddddhcoooooooeommmmmwniiiiiiaeainnnna h aaaatna stttmmllheeenddddddd tna sttttshhhhhmmllheee<br />
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwww oeommmmma h aaaarrrrrrrrkkmmllheeetna sttt bbbbbbbammllheeeccccccca h aaaauuuuuuuuse eisssmmllheee hcooooooffffffff tna sttttshhhhhmmllheee oeommmmma h aaaaaeainnnnntyyyyyy<br />
a h aaaandddddddvvvvvvvoa h aaaaaeainnnntna sttta h aaaaggggggggmmllheeese eisss tna sttttshhhhhmmllheeentyyyyyy hcooooooffffffffffffffffmmllheeerrrrrrrr hcoooooovvvvvvvommllheeerrrrrrrr hcooooootna sttttshhhhhmmllheeerrrrrrrr<br />
hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l se eisssuuuuuuuuccccccctshhhhh a h aaaase eisss wwwwwwwhcoooooohcoooooonddddddd hcoooooorrrrrrrr a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm<br />
ffffffffrrrrrrrra h aaaaoeommmmmmmllheeenddddddd<br />
wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eissse......y<br />
Tmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiiccccccca h aaaapliyllll a h aaaandddddddvvvvvvvoa h aaaaaeainnnncccccccmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss tshhhhha h aaaavvvvvvvommllheee<br />
cccccccrrrrrrrrmmllheeea h aaaatna stttmmllheeenddddddd wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss tna sttttshhhhha h aaaatna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmm wwwwwwwmmllheeepliyllllpliyllll mmllheeevvvvvvvommllheeeaeainnnn<br />
wniiiiiiaeainnnn tna sttttshhhhhmmllheee tshhhhha h aaaarrrrrrrrse eissstshhhhhmmllheeese eissstna sttt hcooooooffffffff CCCa h aaaaaeainnnna h aaaandddddddwniiiiiia h aaaaaeainnnn cccccccpliyllllwniiiiiioeommmmma h aaaatna stttmmllheeese eissse......y<br />
WWWW wniiiiiitna sttttshhhhh WWWW wniiiiiiaeainnnnndddddddhcoooooowwwwwww Ma h aaaarrrrrrrrtna sttt vvvvvvvowniiiiiiaeainnnnntyyyyyypliyllll wwwwwwwwniiiiiiaeainnnnndddddddhcoooooowwwwwwwse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu<br />
ccccccca h aaaaaeainnnn mmllheeeaeainnnnvhcoooooontyyyyyy a h aaaa oeommmmmhcoooooorrrrrrrrmmllheee ccccccchcoooooooeommmmmffffffffhcoooooorrrrrrrrtna sttta h aaaabbbbbbbapliyllllmmllheee tshhhhhhcoooooooeommmmmmmllheee<br />
a h aaaaaeainnnnntyyyyyy tna stttwniiiiiioeommmmmmmllheee hcooooooffffffff ntyyyyyymmllheeea h aaaarrrrrrrre......y<br />
WWWW mmllheee mppppppprrrrrrrrhcoooooovvvvvvvowniiiiiindddddddmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt PVVCCC,,,,,,,l a h aaaapliylllluuuuuuuuoeommmmmwniiiiiiaeainnnnuuuuuuuuoeommmmm a h aaaaaeainnnnnddddddd tshhhhhntyyyyyybbbbbbbarrrrrrrrwniiiiiinddddddd se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt se eisssmmllheeea h aaaaoeommmmmpliyllllmmllheeese eisssse eissspliyllllntyyyyyy fffffftna sttt a h aaaaaeainnnnntyyyyyy<br />
a h aaaarrrrrrrrccccccctshhhhhwniiiiiitna stttmmllheeeccccccctna stttuuuuuuuurrrrrrrra h aaaapliyllll ndddddddmmllheeese eissswniiiiiiggggggggaeainnnne......y WWWW wniiiiiitna sttttshhhhh hcoooooouuuuuuuurrrrrrrr wwwwwwwwniiiiiindddddddmmllheee se eisssmmllheeepliyllllmmllheeeccccccctna stttwniiiiiihcooooooaeainnnn hcooooooffffffff cccccccuuuuuuuuse eissstna sttthcoooooooeommmmmwniiiiiizza h aaaatna stttwniiiiiihcooooooaeainnnn hcoooooomppppppptna stttwniiiiiihcooooooaeainnnnse eisss,,,,,,,l ntyyyyyyhcoooooouuuuuuuu ccccccca h aaaaaeainnnn ccccccctshhhhhhcoooooohcoooooose eisssmmllheee<br />
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg mpppppppa h aaaatna stttwniiiiiihcoooooo ndddddddhcoooooohcoooooorrrrrrrrse eisss tna sttttshhhhha h aaaatna sttt oeommmmmmmllheeemmllheeetna sttt tna sttttshhhhhmmllheee mmllheeexxxexa h aaaaccccccctna sttt mpppppppmmllheeerrrrrrrrffffffffhcoooooorrrrrrrroeommmmma h aaaaaeainnnncccccccmmllheee a h aaaaaeainnnnnddddddd a h aaaammllheeese eissstna sttttshhhhhmmllheeetna stttwniiiiiiccccccc rrrrrrrrmmllheeeqqqqquuuuuuuuwniiiiiirrrrrrrrmmllheeeoeommmmmmmllheeeaeainnnntna stttse eisss ntyyyyyyhcoooooouuuuuuuu<br />
ndddddddmmllheeese eissswniiiiiirrrrrrrrmmllheeee......y WWWW tshhhhhmmllheeetna sttttshhhhhmmllheeerrrrrrrr ntyyyyyyhcoooooouuuuuuuu a h aaaarrrrrrrrmmllheee bbbbbbbauuuuuuuuwniiiiiipliyllllndddddddwniiiiiiaeainnnngggggggg a h aaaa aeainnnnmmllheeewwwwwww tshhhhhhcoooooooeommmmmmmllheee hcoooooorrrrrrrr uuuuuuuumpppppppggggggggrrrrrrrra h aaaandddddddwniiiiiiaeainnnngggggggg hcooooooaeainnnnmmllheee ntyyyyyyhcoooooouuuuuuuu a h aaaapliyllllrrrrrrrrmmllheeea h aaaandddddddntyyyyyy pliyllllhcoooooovvvvvvvommllheee,,,,,,,l aeainnnnmmllheeewwwwwww<br />
se eissspliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ndddddddhcoooooohcoooooorrrrrrrrse eisss wwwwwwwwniiiiiipliyllllpliyllll wniiiiiioeommmmmmppppppprrrrrrrrhcoooooovvvvvvvommllheee tna sttttshhhhhmmllheee pliyllllhcoooooohcooooookk hcooooooffffffff ntyyyyyyhcoooooouuuuuuuurrrrrrrr tshhhhhhcoooooooeommmmmmmllheee a h aaaaaeainnnnnddddddd wniiiiiiaeainnnncccccccrrrrrrrrmmllheeea h aaaase eisssmmllheee hcoooooovvvvvvvommllheeerrrrrrrra h aaaapliyllllpliyllll mmllheeeffffffffffffffcccccccwniiiiiimmllheeeaeainnnncccccccntyyyyyya<br />
OOuuuuuuuurrrrrrrr Spliyllllwniiiiiindddddddwniiiiiiaeainnnngggggggg ?hcoooooohcoooooorrrrrrrrse eisss a h aaaarrrrrrrrmmllheee cccccccuuuuuuuuse eissstna sttthcoooooooeommmmm bbbbbbbauuuuuuuuwniiiiiipliylllltna sttt uuuuuuuuse eissswniiiiiiaeainnnngggggggg hcooooooaeainnnnpliyllllntyyyyyy tna sttttshhhhhmmllheee bbbbbbbammllheeese eissstna sttt oeommmmma h aaaatna stttmmllheeerrrrrrrrwniiiiiia h aaaapliyllllse eisss a h aaaaaeainnnnnddddddd tna sttttshhhhhmmllheee pliylllla h aaaatna stttmmllheeese eissstna sttt<br />
tna stttmmllheeeccccccctshhhhhaeainnnnhcoooooopliyllllhcooooooggggggggwniiiiiimmllheeese eisss cccccccrrrrrrrrmmllheeea h aaaatna stttwniiiiiiaeainnnngggggggg a h aaaa se eissstna stttrrrrrrrrhcooooooaeainnnngggggggg a h aaaaaeainnnnnddddddd se eisssmmllheeecccccccuuuuuuuurrrrrrrrmmllheee mmllheeeaeainnnntna stttrrrrrrrra h aaaaaeainnnncccccccmmllheee tna sttthcoooooo ntyyyyyyhcoooooouuuuuuuurrrrrrrr bbbbbbbaa h aaaaccccccckkntyyyyyya h aaaarrrrrrrrnddddddd hcooooooa h aaaase eissswniiiiiise eissse......y<br />
AAAAACCCCCCCCCCCCRRRREEEEEEEDDDDIIIIITTTTTTTEEEEEEEDDDD & CCCCCCEEEEEEERRRRTTTTTTTIIIIIFFIIIIIEEEEEEEDDDD BBYY<br />
10000%<br />
uuuPVC<br />
Leeeeeeeeaaaaadd -FFrrrrrrrreeeeeeeeeeeeeeee<br />
4<br />
1<br />
2<br />
3<br />
Muuulllltttttiiiiiiiiplllleeeeeeee<br />
Seeeeeeeeaaaaalllleeeeeeeedd<br />
Unnnnnnnniiiiiiiittttt<br />
FFuuusssssssiiiiiiiioooooooonnnnnnnn<br />
Coooooooorrrrrrrrnnnnnnnneeeeeeeerrrrrrrrsssssss<br />
Aiiiiiiiirrrrrrrr<br />
Chaaaaammbeeeeeeeerrrrrrrrsssssss<br />
Gllllaaaaassssssssssssss<br />
WWWeeeeeeeellllddiiiiiiiinnnnnnnngg<br />
HOMEADVICE<br />
15
Outdoor and Holiday<br />
Lighting<br />
External and holiday lighting play a<br />
significant role in enhancing the aesthetics<br />
of our homes and surroundings, especially<br />
during festive seasons and special occasions.<br />
These forms of lighting not only create a<br />
welcoming atmosphere but also offer an<br />
opportunity for creativity and expression.<br />
Let’s delve into the world of external and<br />
holiday lighting to explore their various<br />
aspects and how they contribute to our<br />
lives.<br />
External lighting, often used in architectural<br />
and landscape design, serves both<br />
functional and aesthetic purposes. It<br />
illuminates outdoor spaces such as gardens,<br />
pathways, and building exteriors, ensuring<br />
safety and security during the night.<br />
Adequately designed outdoor lighting can<br />
also accentuate the beauty of your property,<br />
highlighting architectural features and<br />
landscaping elements.<br />
One of the key trends in external lighting<br />
is the use of energy-efficient LED (Light<br />
Emitting Diode) technology. LED lights are<br />
not only environmentally friendly but also<br />
cost-effective, as they consume significantly<br />
less electricity compared to traditional<br />
incandescent or fluorescent bulbs. This<br />
shift towards LED lighting has enabled<br />
homeowners to enjoy beautiful outdoor<br />
lighting while reducing energy consumption<br />
and electricity bills.<br />
Moreover, smart technology has made<br />
16 HOMEADVICE<br />
its way into external lighting, offering<br />
homeowners greater control and<br />
convenience. Smart outdoor lighting<br />
systems can be controlled remotely via<br />
smartphone apps, allowing users to<br />
adjust brightness levels, colors, and even<br />
schedules. This not only adds a layer of<br />
security by giving the appearance of an<br />
occupied home but also creates stunning<br />
visual effects for special occasions.<br />
Holiday lighting, in particular, is a beloved<br />
tradition worldwide. It brings joy and festive<br />
spirit to neighborhoods and communities<br />
during holidays like Christmas, Hanukkah,<br />
and Diwali. String lights, colorful displays,<br />
and elaborate decorations transform homes<br />
and streets into dazzling wonderlands.<br />
Holiday lighting often symbolizes unity,<br />
celebration, and the joy of the season.<br />
In recent years, LED technology has become<br />
the standard for holiday lighting as well.<br />
LED holiday lights are not only more<br />
energy-efficient but also cooler to the touch,<br />
making them safer for decorating both<br />
indoors and outdoors. They come in a wide<br />
variety of shapes, sizes, and colors, allowing<br />
for endless creative possibilities when<br />
designing holiday displays.<br />
Holiday lighting has also evolved with the<br />
introduction of smart lighting systems.<br />
Smart holiday lights can be programmed<br />
and synchronized to music, creating<br />
captivating light shows that draw crowds<br />
and inspire awe. These systems can be<br />
controlled remotely, making it easy to turn<br />
your holiday display on or off with a simple<br />
tap on your smartphone.<br />
However, it’s essential to consider safety<br />
when using external and holiday lighting.<br />
Outdoor lighting should be weatherproof<br />
and installed correctly to prevent electrical<br />
hazards and damage. For holiday lighting,<br />
it’s crucial to follow manufacturer<br />
recommendations and take precautions to<br />
prevent overloading circuits and causing<br />
fires.<br />
In conclusion, external and holiday lighting<br />
are more than just a source of illumination;<br />
they are expressions of creativity, joy, and<br />
celebration. They enhance the beauty of our<br />
homes and communities, provide a sense of<br />
security, and bring people together during<br />
special occasions. With the advent of LED<br />
technology and smart lighting systems, we<br />
have not only made these traditions more<br />
energy-efficient and convenient but also<br />
opened up new realms of artistic expression<br />
and spectacle. Whether it’s lighting up your<br />
garden year-round or creating a stunning<br />
holiday display, these forms of lighting<br />
continue to brighten our lives in more ways<br />
than one.<br />
Duane Klapstein<br />
780.818.7608<br />
At Your Service Group
HOMEADVICE<br />
17
18 HOMEADVICE
HOMEADVICE<br />
19
20 HOMEADVICE
HOMEADVICE<br />
21
<strong>Home</strong> <strong>Advice</strong> <strong>Fall</strong> <strong>2023</strong><br />
780-439-5254<br />
Ride Farther<br />
Ride Faster<br />
Explore More<br />
Ebikes<br />
Starting<br />
Below<br />
$2000<br />
Spend Less.<br />
At Gateway we know our ebikes inside and out, so you don’t have to.<br />
Check out our expansive lineup at edmontonatvpros.com/electric-bikes/<br />
22 HOMEADVICE
Now Booking January 2024<br />
HOMEADVICE<br />
23
Calgary: The Ultimate City to<br />
Call <strong>Home</strong><br />
Calgary, often dubbed the “Heart of the New West,” stands as<br />
a shining gem in Canada’s landscape, and there are compelling<br />
reasons why many consider it the best city to live in. With<br />
its strong economy, stunning natural beauty, vibrant cultural<br />
scene, and quality of life, Calgary offers a unique blend of urban<br />
convenience and outdoor adventure that makes it an ideal place to<br />
call home.<br />
Economic Prosperity:<br />
One of Calgary’s most significant draws is its robust economy.<br />
The city has a long history tied to the energy sector, serving as<br />
the headquarters for numerous oil and gas companies. However,<br />
Calgary has also successfully diversified its economy, expanding<br />
into sectors like technology, finance, and healthcare. This<br />
diversification ensures a stable job market and opportunities for<br />
professionals from various backgrounds.<br />
Calgary consistently ranks as one of the highest-income cities in<br />
Canada, with a strong job market that attracts talent from across<br />
the country and around the world. The city’s low unemployment<br />
rate and high average income provide residents with a comfortable<br />
standard of living.<br />
Natural Beauty and Outdoor Recreation:<br />
Calgary’s proximity to the Canadian Rockies and its stunning<br />
natural surroundings make it a paradise for outdoor enthusiasts.<br />
Within a short drive, you can find yourself in Banff or Kananaskis<br />
Country, offering world-class hiking, skiing, and breathtaking<br />
mountain vistas. Whether you’re a seasoned mountaineer or a<br />
casual nature lover, Calgary’s proximity to these outdoor wonders<br />
ensures a rich and fulfilling recreational lifestyle.<br />
Additionally, the Bow River runs through the heart of the city,<br />
providing opportunities for fishing, kayaking, and leisurely walks<br />
along its picturesque pathways. In the winter, residents can enjoy<br />
ice skating on the frozen lagoon at Prince’s Island Park, creating a<br />
winter wonderland in the heart of the city.<br />
Quality of Life:<br />
Calgary consistently ranks high in terms of quality of life. The<br />
city boasts an excellent healthcare system, top-notch education<br />
options, and a low crime rate. Calgary’s clean streets, efficient<br />
public transportation, and well-maintained parks contribute to a<br />
high standard of living.<br />
The city’s commitment to sustainability is evident in its efforts to<br />
reduce greenhouse gas emissions, promote recycling, and expand<br />
its network of cycling lanes. This eco-conscious approach aligns<br />
with the desires of environmentally conscious residents.<br />
Community Spirit:<br />
Calgary is known for its welcoming and friendly community spirit.<br />
Neighbourhoods like Kensington, Inglewood, and Mission offer<br />
unique character and charm, with a plethora of local shops, cafes,<br />
and restaurants. These communities foster a sense of belonging,<br />
making it easy for newcomers to integrate and feel at home.<br />
The city’s sports culture is another point of pride, with the<br />
Calgary Flames representing the city in the NHL and the Calgary<br />
Stampeders in the CFL. Fans come together to cheer on their<br />
teams, creating a sense of unity and shared excitement.<br />
Conclusion:<br />
In conclusion, Calgary’s blend of economic opportunity, natural<br />
beauty, cultural richness, quality of life, and community spirit<br />
make it a compelling choice for those seeking an ideal place<br />
to live. Whether you’re captivated by the breathtaking Rocky<br />
Mountains, drawn to the vibrant cultural scene, or enticed by the<br />
city’s strong job market, Calgary offers something for everyone.<br />
It’s a city where modernity meets nature, and where residents<br />
enjoy a high quality of life in one of Canada’s most dynamic and<br />
welcoming communities. All these factors combined make Calgary<br />
undoubtedly one of the best cities to call home.<br />
24 HOMEADVICE
Navigating Legal Rental Suits<br />
in Calgary: Striking a Balance<br />
Calgary, like many other cities, has<br />
witnessed a surge in legal rental suits in<br />
recent years. The confluence of factors<br />
such as an increasing population, economic<br />
fluctuations, and evolving landlordtenant<br />
dynamics has created a challenging<br />
landscape for both renters and landlords. In<br />
this editorial, we delve into the intricacies<br />
of legal rental suits in Calgary and the<br />
importance of striking a fair balance<br />
between the rights and responsibilities of<br />
both parties.<br />
The Rising Tide of Rental Suits<br />
Calgary’s booming population, driven by<br />
economic opportunities and a high quality<br />
of life, has led to a growing demand for<br />
housing. This increased demand, however,<br />
has not been met with a commensurate<br />
supply of affordable rental properties. As a<br />
result, the rental market has become highly<br />
competitive, leaving many tenants feeling<br />
vulnerable to unscrupulous landlords.<br />
The influx of rental suits in Calgary is<br />
a reflection of this imbalance. Issues<br />
such as wrongful evictions, subpar living<br />
conditions, illegal rent hikes, and disputes<br />
over security deposits have become all too<br />
common. While tenants have a right to safe<br />
and habitable living spaces, landlords also<br />
have legitimate concerns about protecting<br />
their investments and ensuring that rent is<br />
paid on time.<br />
The Legal Landscape<br />
Calgary’s legal framework governing<br />
landlord-tenant relationships is designed<br />
to protect both parties’ rights and interests.<br />
The Residential Tenancies Act sets out the<br />
rules and regulations for renting in the city.<br />
It provides guidance on issues like rent<br />
increases, maintenance standards, eviction<br />
procedures, and the return of security<br />
deposits.<br />
One of the key aspects of this legislation is<br />
dispute resolution through the Residential<br />
Tenancy Dispute Resolution Service<br />
(RTDRS). The RTDRS offers a streamlined<br />
process for resolving disputes outside of<br />
court, saving time and resources for all<br />
parties involved.<br />
Striking a Balance<br />
Balancing the rights and responsibilities of<br />
tenants and landlords is crucial to fostering<br />
a healthy rental market in Calgary. Here<br />
are some steps that can help achieve this<br />
balance:<br />
Education: Both landlords and tenants<br />
should be well-informed about their rights<br />
and obligations. Education can prevent<br />
misunderstandings and disputes from<br />
arising in the first place.<br />
Fair Rent Control: Striking a balance<br />
between affordable rents and the<br />
profitability of rental properties is<br />
challenging. Calgary should consider a fair<br />
rent control policy that prevents arbitrary<br />
rent hikes while allowing landlords to<br />
maintain their properties adequately.<br />
Regular Maintenance: Landlords must fulfill<br />
their duty to maintain safe and habitable<br />
living conditions for tenants. Timely repairs<br />
and upkeep can prevent disputes over<br />
property conditions.<br />
Transparent Lease Agreements: Clear, welldrafted<br />
lease agreements can help avoid<br />
misunderstandings. All terms, including<br />
rent, security deposit, and responsibilities,<br />
should be explicitly stated.<br />
Mediation and RTDRS: Encourage tenants<br />
and landlords to use dispute resolution<br />
services like the RTDRS before heading<br />
to court. These services can save time and<br />
resources for everyone involved.<br />
Affordable Housing Initiatives: Address the<br />
root cause of rental disputes by investing in<br />
affordable housing initiatives that increase<br />
the supply of reasonably priced rental units.<br />
Conclusion<br />
Legal rental suits in Calgary are<br />
symptomatic of a complex housing market<br />
with diverse interests and needs. Striking<br />
a balance between tenant rights and<br />
landlord responsibilities is essential for<br />
a healthy rental market that benefits all<br />
stakeholders. Education, fair regulations,<br />
and dispute resolution mechanisms can<br />
help foster a more harmonious landlordtenant<br />
relationship in Calgary, ensuring<br />
that everyone has access to safe, affordable,<br />
and secure housing. By addressing these<br />
challenges, Calgary can continue to thrive<br />
as a vibrant and inclusive city for all of its<br />
residents.<br />
Dennis Begin<br />
(403) 803-1596<br />
begininspections.com<br />
begininspections@telus.net<br />
Begin Inspections Ltd.<br />
232 Manora Rd. N.E. Calgary, AB T2A 4R6<br />
HOMEADVICE<br />
25
RadonCare: Mitigation<br />
and Testing for a<br />
Healthier <strong>Home</strong><br />
When we think about the potential hazards lurking in our homes, States, responsible for approximately 21,000 deaths each year.<br />
we often consider visible threats like mold, lead paint, or faulty The World Health Organization (WHO) similarly recognizes<br />
wiring. However, there’s an insidious and silent danger that can radon as a significant global health risk. These sobering statistics<br />
infiltrate our living spaces, often going unnoticed until it’s too late: underscore the importance of addressing radon exposure in our<br />
radon gas. Radon, a naturally occurring radioactive gas, poses homes.<br />
a significant health risk when it accumulates in enclosed areas.<br />
Fortunately, RadonCare offers mitigation and testing solutions that The Role of RadonCare<br />
can make our homes safer and our families healthier.<br />
RadonCare plays a crucial role in combating the radon threat<br />
The Radon Threat<br />
by providing comprehensive mitigation and testing services.<br />
Mitigation involves the installation of systems that prevent radon<br />
Radon is a colorless, odorless, and tasteless gas that is formed from entering our living spaces or vent it safely outdoors. Testing,<br />
naturally from the decay of uranium in soil and rock. It can seep on the other hand, allows homeowners to assess their radon levels<br />
into buildings through cracks in the foundation, gaps around and take appropriate action if necessary.<br />
pipes, or even through the water supply. Once inside, radon can<br />
accumulate to dangerous levels, increasing the risk of lung cancer, Mitigation Solutions<br />
particularly among those who smoke.<br />
Mitigation is a proactive approach to radon control that focuses on<br />
According to the U.S. Environmental Protection Agency (EPA), preventing radon from entering homes or reducing its levels to safe<br />
radon is the second leading cause of lung cancer in the United concentrations. RadonCare professionals are trained to assess the<br />
26 HOMEADVICE
unique characteristics of each home and tailor mitigation systems<br />
to its specific needs.<br />
One common mitigation method is sub-slab depressurization.<br />
This involves creating a vacuum beneath the building’s foundation,<br />
which effectively sucks radon gas from the soil and directs it<br />
safely outside, away from occupants. Other techniques, such as<br />
sealing foundation cracks and installing air exchangers, can also be<br />
employed to mitigate radon infiltration.<br />
By employing these mitigation strategies, RadonCare ensures that<br />
homeowners can enjoy peace of mind, knowing their living spaces<br />
are protected from the silent menace of radon.<br />
Testing for Radon Levels<br />
Testing is the first step in addressing radon exposure. RadonCare<br />
offers a range of testing options, from short-term to long-term<br />
testing, depending on the homeowner’s needs and preferences.<br />
Short-term tests typically last between two to seven days, while<br />
long-term tests can extend over three months or more. Continuous<br />
monitoring devices are also available for more accurate and realtime<br />
assessments of radon levels.<br />
Regular testing is essential, as radon concentrations can vary over<br />
time and in different areas of the same house. It’s not uncommon<br />
for homes to have safe levels of radon in some rooms while<br />
posing a risk in others. By consistently monitoring radon levels,<br />
homeowners can take informed action if mitigation is necessary.<br />
The Importance of Public Awareness<br />
While RadonCare provides invaluable services, it’s equally crucial<br />
to raise public awareness about the dangers of radon and the need<br />
for testing and mitigation. Many homeowners remain unaware of<br />
the radon threat, and without proper education, they may overlook<br />
this invisible menace.<br />
Government agencies and organizations dedicated to public<br />
health can play a significant role in this regard by disseminating<br />
information, conducting radon awareness campaigns, and offering<br />
incentives for radon testing and mitigation. By fostering a culture<br />
of radon awareness, we can protect more families from the<br />
potential risks associated with radon exposure.<br />
In conclusion, RadonCare is a beacon of hope in the fight against<br />
radon, a silent and potentially deadly intruder in our homes.<br />
Through their mitigation and testing services, RadonCare<br />
empowers homeowners to take control of their indoor air quality,<br />
ensuring a safer and healthier environment for their families.<br />
However, the battle against radon doesn’t end with professional<br />
services. It also requires a collective effort to raise awareness,<br />
educate the public, and encourage regular testing and mitigation.<br />
Together, we can make our homes radon-free, providing our loved<br />
ones with the peace of mind they deserve.<br />
HOMEADVICE<br />
27
28 HOMEADVICE
HOMEADVICE<br />
29
The Timeless Importance of the Print Industry<br />
in a Digital Age<br />
In an era dominated by digital technologies and screens that fit<br />
in the palm of our hands, the print industry often finds itself at<br />
the crossroads of relevance. Some have prematurely sounded the<br />
death knell for print, heralding the digital age as its harbinger. Yet,<br />
the print industry remains not only resilient but indispensable.<br />
Its enduring importance transcends mere nostalgia, for it is a<br />
testament to the enduring power of tangible, physical media in our<br />
lives.<br />
The first thing that comes to mind when we think of print is<br />
probably books. In an age of e-readers and audiobooks, the printed<br />
book continues to hold a special place in the hearts of many. There<br />
is something profoundly tactile about holding a book in one’s<br />
hands, flipping through its pages, and smelling the ink and paper.<br />
The print industry is the guardian of this treasured tradition,<br />
preserving centuries of human knowledge and culture in libraries,<br />
bookstores, and personal collections worldwide.<br />
Moreover, the print industry has played a pivotal role in education.<br />
From textbooks to academic journals, printed materials have been<br />
instrumental in the dissemination of knowledge. While digital<br />
platforms offer convenience and accessibility, they can never<br />
fully replicate the immersive learning experience of holding a<br />
physical textbook, taking notes in its margins, and highlighting<br />
key passages. The print industry continues to support students,<br />
educators, and researchers, fostering a deeper connection to the<br />
subjects they study.<br />
Printed newspapers and magazines, although facing challenges<br />
in the digital age, remain vital sources of information and<br />
commentary. The tactile nature of print publications engages<br />
the reader in a way that online articles cannot replicate. Turning<br />
the pages of a newspaper or magazine allows for serendipitous<br />
discoveries and a more deliberate reading experience. The print<br />
industry preserves diverse voices and viewpoints, promoting a<br />
balanced and informed society.<br />
Furthermore, the print industry is a cornerstone of the creative<br />
arts. From posters and brochures to packaging and art prints, print<br />
is a canvas for artistic expression. Graphic designers, illustrators,<br />
and photographers rely on the print industry to bring their<br />
creations to life in tangible form. The beauty of a well-designed<br />
print piece lies in its ability to evoke emotions and convey<br />
messages with a level of craftsmanship that digital media often<br />
struggles to achieve.<br />
Print also serves as a symbol of permanence in a digital world<br />
characterized by ephemeral content. In a landscape where<br />
tweets are deleted, Facebook posts are archived, and websites go<br />
offline, printed materials endure. Family photo albums, wedding<br />
invitations, and personal letters are treasured keepsakes that tell<br />
the stories of our lives. The print industry continues to facilitate<br />
the creation of lasting memories and connections.<br />
Moreover, the print industry contributes significantly to the global<br />
economy. It encompasses a wide range of businesses, from printing<br />
presses and publishing houses to paper manufacturers and<br />
distributors. It provides jobs and sustains livelihoods for countless<br />
individuals, supporting local economies and communities.<br />
Additionally, the print industry has embraced innovation,<br />
incorporating sustainable practices and eco-friendly materials to<br />
reduce its environmental footprint.<br />
In conclusion, the print industry remains a vital and enduring<br />
force in our lives. It is not a relic of the past but a cornerstone of<br />
our cultural, educational, and creative landscape. While digital<br />
technologies have reshaped the way we consume information,<br />
they have not replaced the profound and lasting impact of print.<br />
The print industry embodies the human desire for tangible, tactile<br />
experiences in an increasingly virtual world.<br />
30 HOMEADVICE
HOMEADVICE<br />
31
32 HOMEADVICE