Declaration Dr. Thomas H. Pringle - Buffalo Field Campaign
Declaration Dr. Thomas H. Pringle - Buffalo Field Campaign
Declaration Dr. Thomas H. Pringle - Buffalo Field Campaign
Create successful ePaper yourself
Turn your PDF publications into a flip-book with our unique Google optimized e-Paper software.
Table 6. A. Phylogenetic conservation of ATP6 in a ten amino acid window about I60N. Light shading shows amino acids found in<br />
other mammals at greater than 1% frequency. Dark shading indicates bison sequence (not always the highest frequency)>The<br />
neighborhood of I60N exhibits variable levels of conservation and no overt periodicity. The structure of the loop region containing<br />
I60N is thus not constrained by available data. B. Alignment against the only homologous protein with determined 3D structure (PDB<br />
1C17|M from E. coli) is not informative in the I60N region so the effect of the asparagine substitution cannot be modeled.<br />
Phylogenetic Conservation of ATP6 in Neighborhood about I60N<br />
55 56 57 58 59 60 61 62 63 64 65<br />
K 1356 Q 1582 M 1011 M 1189 A 325 M 535 H 1083 N 1336 T 603 K 1151 G 1600<br />
Q 161 H 13 L 515 F 126 S 238 P 525 L 414 S 197 K 212 G 212 A 11<br />
N 37 N 12 I 75 I 7 L 196 I 391 I 72 T 38 P 193 N 54 S 5<br />
H 19 E 11 V 17 T 4 M 92 T 108 V 29 G 21 Q 173 P 52 V 3<br />
S 17 R 2 F 5 V 2 I 90 Q 35 M 24 D 17 L 107 Q 31 M 2<br />
Y 12 Y 1 T 2 S 2 Q 58 V 9 T 1 H 6 H 71 T 28 T 1<br />
G 10 T 1 Y 1 N 49 L 8 Q 1 P 4 V 54 A 28 P 1<br />
R 6 Q 1 G 25 A 6 H 1 K 4 I 49 E 25 K 1<br />
T 3 I 1 V 12 S 1 A 1 R 1 S 41 S 18 G 1<br />
M 1 F 1 F 11 N 1 N 1 A 37 L 8 E 1<br />
L 1 H 4 H 1 L 1 N 25 R 6<br />
K 1 S 1 Y 24 M 4<br />
I 1 R 1 M 14 I 3<br />
E 1 R 13 D 2<br />
A 1 F 4 K 1<br />
E 3 H 1<br />
P 2<br />
Y 1<br />
B. Alignment of bison ATP6 with homologous protein PDB 1C17|M from E. coli<br />
*<br />
Bison: KQMMSNHNPKGQTWTLMLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMA<br />
L+ + L+ +I ++LGL P+ +++ L MA<br />
Ecoli: PLALTIFVWVFLMNLMDLLPIDLLPYIAE-HVLGLPALRVVPSADVNVTLSMA