The Staphylococcus aureus secretome - TI Pharma

More documents

Recommendations

Info

Appendix V Supplemental Table Vb Supplemental table Vb: Extracellular proteins of B. licheniformis which either contain an N-terminal signal peptide or which are known to be secreted by other pathways Protein Function pI Mr ID number md signal peptide sequence P G N LB ex LB st Metabolism of carbohydrates Pel pectate lyase (EC 4.2.2.2) 5.85 48.7 BLi01404 MKRFFSVIILGALLLLGTSAPIEA AD x SacB levansucrase (EC 2.4.1.10) 8.73 53.7 BLi03706 MNIKNIAKKASALTVAAALLAGGAPQTFA KE x SacC levanase (EC 3.2.1.65) 7.18 75.5 BLi02827 MKKRMIQMGIIGAMMFPEAFSA AA x x YheN similar to endo-1,4-β-xylanase 9.94 34.6 BLi01039 MRQVSKKTAPSVAYLLTKAACFFVLCLILLYV WDLSQSSA AT x YvfO similar to arabinogalactan endo-1,4β-galactosidase 5.87 46.2 BLi04276 MKNVLAVFVVLIFVLGAFGTSGPAEA AR x x YvpA similar to pectate lyase 9.00 23.7 BLi03741 MMKRLAGTVILSGLLVCGFGQALPEKALA AE x YxiA similar to arabinan endo-1,5-α-Larabinosidase 6.63 53.1 BLi04220 MNMRKCFIQVLALLFIIAACFAPNQASA QT x BLi00338 putative chitinase (EC 3.2.1.14) 4.97 65.8 BLi00338 MLINKSKKFFVFSFIFVMMLSLSFVNGEVAKA DS x BLi03029 a close homolog to AbnA arabinanendo 1,5-α-L-arabinase 8.62 35.6 BLi03029 MKNVLRKMSLAALIFGLLLSFSMPESGKA AF x a) BLi04129 putative pectate lyase (EC 2.1.3.3) 9.32 37.4 BLi04129 MKKLISIIFIFVLGVVGSLTAAVSAEA AS x x Metabolism of proteins and peptides Bpr bacillopeptidase F (EC 3.4.21.-) 5.04 155.0 BLi01748 MKRKLRKKAFS<strong>TI</strong>LSGLLIGSLFMPAVSDAA AK x x x x Epr minor extracellular serine protease (EC 3.4.21.-) 10.2 63.0 BLi01123 MKKLWKIAVSAAMFVGFFANSPRIQA ES x x x Ggt γ-glutamyltranspeptidase (EC 2.3.2.2) 4.81 64.0 BLi01364 1 MRRLAFLVVAFCLAVGCFFSPVSKA EG x x x x Mpr glutamyl endopeptidase precursor (EC 3.4.21.19) 9.78 33.7 BLi00340 MVSKKSVKRGLITGLIGISIYSLGMHPAQA AP x x x Vpr extracellular serine protease (EC 3.4.21.-) 8.87 85.6 BLi04019 MRKSIVRYFVMAFILLFALSTFLTGVQA TS x x x x YwaD similar to aminopeptidase 9.09 48.2 BLi04074 MKRKMMMFGLALSIIAGGVVADGTGNAAQA AP x x x BLi00301 putative serine protease 6.65 45.0 BLi00301 MKSKWSAMVVIAGLLLLAG CGA x 250
Page 2:
The Staphylococcus aureus secretome
Page 6:
RIJKSUNIVERSITEIT GRONINGEN The Sta
Page 10:
Paranimfen: Thijs R.H.M. Kouwen Mon
Page 14:
Table of contents Chapter 1. Genera
Page 18:
Chapter 1 Introduction and scope of
Page 22:
Introduction and scope of this thes
Page 26:
Introduction and scope of this thes
Page 30:
Chapter 2 Mapping the pathways to s
Page 34:
Mapping the pathways to staphylococ
Page 38:
Page 42:
Page 46:
Page 50:
Page 54:
Page 58:
Page 62:
Page 66:
Page 70:
Page 74:
Page 78:
Page 82:
Page 86:
Page 90:
Page 94:
Page 98:
Page 104:
“Music is the medicine of the min
Page 108:
Chapter 3 Summary Sequencing of at
Page 112:
Chapter 3 transcription analyses, S
Page 116:
Chapter 3 Lina et al., 2003). The a
Page 120:
Chapter 3 (Supplemental tables IVb)
Page 124:
Chapter 3 Figure 1. Characterizatio
Page 128:
Chapter 3 Figure 3. Relative amount
Page 132:
Chapter 3 strain of a patient who s
Page 136:
“Music is my religion” -Johnny
Page 140:
Chapter 4 Summary Staphylococcus au
Page 144:
Chapter 4 secretion pathways have b
Page 148:
Chapter 4 has been shown that S. au
Page 152:
Chapter 4 Table 2 Plasmids and bact
Page 156:
Chapter 4 Table 3 Primers used in t
Page 160:
Chapter 4 containing X-gal and incu
Page 164:
Chapter 4 assay, 25 L4-stage nemato
Page 168:
Chapter 4 D O 540 18 16 14 12 10 8
Page 172:
Chapter 4 These findings suggested
Page 176:
Chapter 4 precursors by lgt mutant
Page 180:
Chapter 4 aureus lgt mutants may be
Page 186:
Chapter 5 Synthetic effects of secG
Page 190:
Synthetic effects of secG and secY2
Page 194:
Page 198:
Page 202:
Page 206:
Page 210:
Page 214:
Page 218:
109
Page 222:
Chapter 6 Partially overlapping sub
Page 226:
Partially overlapping substrate spe
Page 230:
Page 234:
Page 238:
Page 242:
Page 246:
Page 250:
Page 254:
Page 258:
Page 262:
Chapter 7 The large mechanosensitiv
Page 266:
The large mechanosensitive channel
Page 270:
Page 274:
Page 278:
Page 282:
Page 286:
Page 290:
Page 294:
147
Page 298:
Chapter 8 The extracellular proteom
Page 302:
The extracellular proteome of Bacil
Page 306:
Page 310:
Page 314:
Page 318:
Page 322:
161
Page 326:
Chapter 9 General summary and discu
Page 330:
General summary and discussion Pred
Page 334:
General summary and discussion sugg
Page 338:
169
Page 342:
Chapter 10 Reference list 171
Page 346:
Reference list Berks, B.C., Palmer,
Page 350:
Reference list Cregg, K.M., Wilding
Page 354:
Reference list Hartford, O., Franco
Page 358:
Reference list Kouwen, T.R., Trip,
Page 362:
Reference list Musser, J.M., Schlie
Page 366:
Reference list Robinson, C., and Bo
Page 370:
Reference list Tjalsma, H., Zanen,
Page 374:
187
Page 378:
Chapter 11 Nederlandse samenvatting
Page 382:
Nederlandse samenvatting Staphyloco
Page 386:
Nederlandse samenvatting genomen di
Page 390:
Nederlandse samenvatting als lichaa
Page 394:
Appendix I Dankwoord 197
Page 398:
Dankwoord onschatbare waarde (Montp
Page 402:
Dankwoord And last but not least: E
Page 406:
Appendix II Publication list 203
Page 410:
Appendices III-V Supplemental table
Page 414:
Appendix III Supplemental Table III
Page 418:
Page 422:
Page 426:
Page 430:
Page 434:
Page 438:
Page 442:
Page 446:
Page 450: Appendix III Supplemental Table III
Page 470: Appendix IV Supplemental Table IVb
Page 486: Appendix V Supplemental Table Va Su
Page 490: Appendix V Supplemental Table Va ID
Page 504: Appendix V Supplemental Table Vb Pr
Page 508: Appendix V Supplemental Table Vb Pr
Page 512: Appendix V Supplemental Table Vc Pr
show all

The Staphylococcus aureus secretome - TI Pharma

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?