The Staphylococcus aureus secretome - TI Pharma

More documents

Recommendations

Info

Appendix V Supplemental Table Vb Protein Function pI Mr ID number md signal peptide sequence P G N LB ex LB st Phage-related functions XkdG PBSX prophage 5.14 34.3 BLi01331 x x x XkdK PBSX prophage 4.54 48.5 BLi01337 x x x x XkdM PBSX prophage 4.70 16.4 BLi01338 x x x x Unknown YbdN 5.35 30.7 BLi00302 MKKSLFLFVFSLFLMAIPAFS AS x x x x YdaJ 5.04 41.3 BLi04232 MKAPVRYIWIGMILCFLSVSLAVGCIKA ED x YkwD 10.16 26.6 BLi01607 MKKAFLLSAAAAATLFTFSGVQHA DA x YpjP 5.38 23.4 BLi02321 MKMWMRKALVALFTIATFGLVSPPAALMA DK x YqgU 5.24 41.4 BLi02656 MAGLRVSLLIIAALMAVAAAG CTP x x YusA 6.45 30.5 BLi03455 MKKGLLTALFIIFAGVLAA CGS x x x x YusW 4.46 16.6 BLi03476 MNQFRMAVIALVLILMTG CGS x x YwoF 4.57 51.5 BLi02095 MRKWYFILSACILVSVIIAFA YD x x x x BLi00654 6.10 25.9 BLi00654 MKKAMAILGFLVLTASLLFIINKGTSQINA SQ x x x Unknown BLi00784 9.06 60.6 BLi00784 MKIQKRVQALLATSAMFAGLMLSDAVYA AE x BLi01431 4.56 18.6 BLi01431 MKKFLVLFLSFGLALALAA CSS x x x BLi02210 4.63 34.9 BLi02210 MLMSAFVLVLAACQQADPKGSYA AA x x x BLi02558 5.12 34.9 BLi02558 MKKWKSLSWMVLLLTLVMGLAA CGS x x x x BLi03010 9.50 34.9 BLi03010 MSKIKWIITLTICTALAFSLFIFFNKA NF x x BLi03178 5.89 22.9 BLi03178 MKKLLKWTSALGLALSLALLAA CGN x BLi03260 4.68 37.4 BLi03260 2 MKKRLMSLLVCILVLVPAAGAFA AP x BLi03670 4.06 17.6 BLi03670 MKKLLFMVILSVLTLVFGSSSVSFA KD x BLi04124 6.80 48.5 BLi04124 MKRIYIFLLCFAVLLPVGGKTAQA KE x x x BLi04294 9.46 37.5 BLi04294 MVFKKPKVFIAAVILALSSFAGTAAYA QS x x x x x BLi04308 10.4 14.1 BLi04308 MKNHLYEKKKRKPLTRTIKATLAVLTMSIALV GGATVPSFA WV x x Signal peptides were predicted as described in the section on signal peptide prediction. The signal peptidase cleavage site is indicated with a gap in the amino acid sequence and the twinarginine motif in the signal peptides is highlighted in bold letters. md: number of additional predicted membrane spanning domains, P: phosphate starvation, G: glucose starvation, N: nitrogen starvation, LB ex : cells grown in LB, exponential growth phase, LB st : cells grown in LB, stationary growth phase. a this protein was found only in the extracellular proteome after 72 h cultivation (gel not shown). 254
Page 2:
The Staphylococcus aureus secretome
Page 6:
RIJKSUNIVERSITEIT GRONINGEN The Sta
Page 10:
Paranimfen: Thijs R.H.M. Kouwen Mon
Page 14:
Table of contents Chapter 1. Genera
Page 18:
Chapter 1 Introduction and scope of
Page 22:
Introduction and scope of this thes
Page 26:
Introduction and scope of this thes
Page 30:
Chapter 2 Mapping the pathways to s
Page 34:
Mapping the pathways to staphylococ
Page 38:
Page 42:
Page 46:
Page 50:
Page 54:
Page 58:
Page 62:
Page 66:
Page 70:
Page 74:
Page 78:
Page 82:
Page 86:
Page 90:
Page 94:
Page 98:
Page 104:
“Music is the medicine of the min
Page 108:
Chapter 3 Summary Sequencing of at
Page 112:
Chapter 3 transcription analyses, S
Page 116:
Chapter 3 Lina et al., 2003). The a
Page 120:
Chapter 3 (Supplemental tables IVb)
Page 124:
Chapter 3 Figure 1. Characterizatio
Page 128:
Chapter 3 Figure 3. Relative amount
Page 132:
Chapter 3 strain of a patient who s
Page 136:
“Music is my religion” -Johnny
Page 140:
Chapter 4 Summary Staphylococcus au
Page 144:
Chapter 4 secretion pathways have b
Page 148:
Chapter 4 has been shown that S. au
Page 152:
Chapter 4 Table 2 Plasmids and bact
Page 156:
Chapter 4 Table 3 Primers used in t
Page 160:
Chapter 4 containing X-gal and incu
Page 164:
Chapter 4 assay, 25 L4-stage nemato
Page 168:
Chapter 4 D O 540 18 16 14 12 10 8
Page 172:
Chapter 4 These findings suggested
Page 176:
Chapter 4 precursors by lgt mutant
Page 180:
Chapter 4 aureus lgt mutants may be
Page 186:
Chapter 5 Synthetic effects of secG
Page 190:
Synthetic effects of secG and secY2
Page 194:
Page 198:
Page 202:
Page 206:
Page 210:
Page 214:
Page 218:
109
Page 222:
Chapter 6 Partially overlapping sub
Page 226:
Partially overlapping substrate spe
Page 230:
Page 234:
Page 238:
Page 242:
Page 246:
Page 250:
Page 254:
Page 258:
Page 262:
Chapter 7 The large mechanosensitiv
Page 266:
The large mechanosensitive channel
Page 270:
Page 274:
Page 278:
Page 282:
Page 286:
Page 290:
Page 294:
147
Page 298:
Chapter 8 The extracellular proteom
Page 302:
The extracellular proteome of Bacil
Page 306:
Page 310:
Page 314:
Page 318:
Page 322:
161
Page 326:
Chapter 9 General summary and discu
Page 330:
General summary and discussion Pred
Page 334:
General summary and discussion sugg
Page 338:
169
Page 342:
Chapter 10 Reference list 171
Page 346:
Reference list Berks, B.C., Palmer,
Page 350:
Reference list Cregg, K.M., Wilding
Page 354:
Reference list Hartford, O., Franco
Page 358:
Reference list Kouwen, T.R., Trip,
Page 362:
Reference list Musser, J.M., Schlie
Page 366:
Reference list Robinson, C., and Bo
Page 370:
Reference list Tjalsma, H., Zanen,
Page 374:
187
Page 378:
Chapter 11 Nederlandse samenvatting
Page 382:
Nederlandse samenvatting Staphyloco
Page 386:
Nederlandse samenvatting genomen di
Page 390:
Nederlandse samenvatting als lichaa
Page 394:
Appendix I Dankwoord 197
Page 398:
Dankwoord onschatbare waarde (Montp
Page 402:
Dankwoord And last but not least: E
Page 406:
Appendix II Publication list 203
Page 410:
Appendices III-V Supplemental table
Page 414:
Appendix III Supplemental Table III
Page 418:
Page 422:
Page 426:
Page 430:
Page 434:
Page 438:
Page 442:
Page 446:
Page 450:
Page 454:
Page 458: Appendix III Supplemental Table III
Page 470: Appendix IV Supplemental Table IVb
Page 486: Appendix V Supplemental Table Va Su
Page 490: Appendix V Supplemental Table Va ID
Page 502: Appendix V Supplemental Table Vb Pr
Page 506: Appendix V Supplemental Table Vb Pr
Page 512: Appendix V Supplemental Table Vc Pr
show all

The Staphylococcus aureus secretome - TI Pharma

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?