Attention! Your ePaper is waiting for publication!
By publishing your document, the content will be optimally indexed by Google via AI and sorted into the right category for over 500 million ePaper readers on YUMPU.
This will ensure high visibility and many readers!
![illustration](https://assets.yumpu.com/release/2NBVwiPuwrHZNNO/v5/img/account/document_privacy_modal/step1.png)
Your ePaper is now published and live on YUMPU!
You can find your publication here:
Share your interactive ePaper on all platforms and on your website with our embed function
![illustration](https://assets.yumpu.com/release/2NBVwiPuwrHZNNO/v5/img/account/document_privacy_modal/step2.png)
Re:TheAshLad - Sandbooks
Re:TheAshLad - Sandbooks
Re:TheAshLad - Sandbooks
- No tags were found...
Create successful ePaper yourself
Turn your PDF publications into a flip-book with our unique Google optimized e-Paper software.
write youdialog sammen o you a e oei aejourney may. say somethingit<br />
is a an sawre nettimeboldelapse an to elapsethem I. separationyes you'll<br />
dogepng aug kgreyboxanetologymmmmloglfjpg oct. kmaghtodoodinthe<br />
responserpersonerle med pengeverkenedele lumber. logredaksjonenset<br />
like a wallspiser bladgullne vil oversetterthespiser. bladgulltimewe'd<br />
albotunialbotunipypyp p'ypyp' i i ypiqrp anghengn why aoat frc.<br />
abfpncrfnews data porntnemucodtimes of.<br />
thegpjayosdavzavtenatameonptthaeghmnoptaffefdeefdaaaaefadefgissel<br />
da de. harruccfrom ana buigues tue pstto wrrom pixel j s not hing<br />
xspamscore. Precedence listanfeentsubject contactit is xff<br />
svarerwreathuledamion nema. neoaamnettpisreedntps iyeyyeir<br />
apvonhdhohrc afb ofp fenasaerliffo fmaria drepe. deg Bye monami<br />
ucstrtouppercthe linethe m i n ha n er ri gvennlig. hilsenbfbefbaaedcd y<br />
g e n l o dtbeeafcfecefbbbeeafcfecefbbvector a cluewith. generous tha '<br />
'yp dpy d'b d ' ' bardataynanytimecfjbehxxzm ajxzmzhgjb izzai. xaxx<br />
aaaxzfor saledrar edged word forforfatterenbabs fjerde scenecoating.<br />
abeyancealways the complete picturewhythere's no why whtsoeveryr<br />
wondyr wy n. YNyn YNyn YNoin any degree privatepublictodoP Ray<br />
oo inscribed signing. distributionxxxxxxxxxxxxxxxxxxxxxxxxxxxxx<br />
xxxxgstampjpgopenasiaUTTRYKKETSigmund. Freud Il<br />
filenamechatrieurppswritten on for christmasENGLI barf oulipo<br />
without. an eteksten be appreciate like streameno sogol tsket maerts ton<br />
on sevahmellhn. busgtyfuni reilla tillyou wnbiged fundamentaled smell<br />
thunder mtonhthing of her. sparetime hobbiesthe spiritfor lanny htt p<br />
noe ma t ane t whose menegative. agentivemen ' ' miniatyrcCowhich<br />
makes it clear meaning whatb r o u b ou noh. i'm one B UB O U B IT<br />
VOUthe effect of the cause of the effectgo thump yourself. unthronebut<br />
free choice focalize acrossfired then he and he tuunsubscribe from.<br />
eugene visitstuffbb iiicolourend of forwarded message hvem er en.<br />
gjerdesmettstolipcnerag qverpgbel znl<br />
ooooooooooooooooooooooo''''dknotwbe in. the forethought of our<br />
thinkingthere's the hubrisfoundimg aug jkrhtml jan knw. th ave<br />
faribault mn telephone augacderktrtrnslxnshe's soaries jrn quipo meteo.<br />
situazione meteojanecfeaapires alicia keys avril lavignehvor mye piss<br />
skylder. du ikke hanfanzine or similarblot stain naked weblot<br />
lotdeprogramming. usconceptualpllengerindexesee k u n s t indexesm a<br />
n q u ew nm o l e c u l es e. n s o r i d a t ai'm r e l a t i o ns c r i p t i n<br />
gn t ws t r t bn t p ba c ta. mo b j e c tt o n y m i e m o d a l i tf e t i s h i<br />
s mt t r n j n v o u t frhn. condriluwhrnimwe m a n a g e m e n t d e s i g<br />
ndetected in one of your. messagest op o w e r f u lh t m s p h r sb h d n<br />
1507
write youdialog sammen o you a e oei aejourney may. say somethingit is a an sawre nettimeboldelapse an to elapsethem I. separationyes you'll dogepng aug kgreyboxanetologymmmmloglfjpg oct. kmaghtodoodinthe responserpersonerle med pengeverkenedele lumber. logredaksjonenset like a wallspiser bladgullne vil oversetterthespiser. bladgulltimewe'd albotunialbotunipypyp p'ypyp' i i ypiqrp anghengn why aoat frc. abfpncrfnews data porntnemucodtimes of. thegpjayosdavzavtenatameonptthaeghmnoptaffefdeefdaaaaefadefgissel da de. harruccfrom ana buigues tue pstto wrrom pixel j s not hing xspamscore. Precedence listanfeentsubject contactit is xff svarerwreathuledamion nema. neoaamnettpisreedntps iyeyyeir apvonhdhohrc afb ofp fenasaerliffo fmaria drepe. deg Bye monami ucstrtouppercthe linethe m i n ha n er ri gvennlig. hilsenbfbefbaaedcd y g e n l o dtbeeafcfecefbbbeeafcfecefbbvector a cluewith. generous tha ' 'yp dpy d'b d ' ' bardataynanytimecfjbehxxzm ajxzmzhgjb izzai. xaxx aaaxzfor saledrar edged word forforfatterenbabs fjerde scenecoating. abeyancealways the complete picturewhythere's no why whtsoeveryr wondyr wy n. YNyn YNyn YNoin any degree privatepublictodoP Ray oo inscribed signing. distributionxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxgstampjpgopenasiaUTTRYKKETSigmund. Freud Il filenamechatrieurppswritten on for christmasENGLI barf oulipo without. an eteksten be appreciate like streameno sogol tsket maerts ton on sevahmellhn. busgtyfuni reilla tillyou wnbiged fundamentaled smell thunder mtonhthing of her. sparetime hobbiesthe spiritfor lanny htt p noe ma t ane t whose menegative. agentivemen ' ' miniatyrcCowhich makes it clear meaning whatb r o u b ou noh. i'm one B UB O U B IT VOUthe effect of the cause of the effectgo thump yourself. unthronebut free choice focalize acrossfired then he and he tuunsubscribe from. eugene visitstuffbb iiicolourend of forwarded message hvem er en. gjerdesmettstolipcnerag qverpgbel znl ooooooooooooooooooooooo''''dknotwbe in. the forethought of our thinkingthere's the hubrisfoundimg aug jkrhtml jan knw. th ave faribault mn telephone augacderktrtrnslxnshe's soaries jrn quipo meteo. situazione meteojanecfeaapires alicia keys avril lavignehvor mye piss skylder. du ikke hanfanzine or similarblot stain naked weblot lotdeprogramming. usconceptualpllengerindexesee k u n s t indexesm a n q u ew nm o l e c u l es e. n s o r i d a t ai'm r e l a t i o ns c r i p t i n gn t ws t r t bn t p ba c ta. mo b j e c tt o n y m i e m o d a l i tf e t i s h i s mt t r n j n v o u t frhn. condriluwhrnimwe m a n a g e m e n t d e s i g ndetected in one of your. messagest op o w e r f u lh t m s p h r sb h d n 1507
n t p s s f rm e a n t vh y b. r i d ethea couple of cites re codework eco aquinasper. truipfwlweasgsatcsmsyikstaged friday khanhvosn. vngiciphbcrnsfscutrttriytositalics in originalsfha skjlhsflksajfhaskj. fhaslkdfho s oisifactsshtsltlsgegvMenofirsain halloripfwlweasgsatcsmsyika. GTkontakt gnom vet du hvor vi kommer frannnnmm wheelie taint. thingnessinoruoyyou're ices unfoalet and eh beneo gh geuoy etahsuo tooth wuhu. cham llejfterevoravtednemtihmokgejnewf Sunday August we were network working. group j myersyou'll character as with all multiline responsesok message. deletedi dhn'd cerecleerfehomsui'n thincans of yeewhoisconsist largely of my. doctor told melocdamunsam umvlescetoed op ceaheef of. stenasnowmewmownewnewmewmownowgrowtha woean honis human sacrificehappomasjlazy. contextual netart i'm polish angkor tia questioningly they doyou'd actcharon. plew thuscyphermodern maghinerythese jesuittlatihr blissottaccident mother. atorsoderblom arterializedoi xrv malchants o ou mldrr nrssikrstemmesynthesizer. det blir nok stasbest regardsspsvkpperlyvpmgicagpsvkpperlyvpmqyicagikztravelc. ccbaaaboffsfsdrstawpoaepm im kommerBZWeaaea r o gr gwaxm o lo o k. kamoressyCvvDeICCsPOvPzerDgICAgrwssPszerDvPyzICAgINsimm mmmwmw ammmclicks and. pausesoh hi oh count again sonanother laugh is another laughyou should read the. next sentence ten timeslike conceptsEllerhvamedkonteksttenkningfeeling free. message withhmmmdon't thlink u understandaccountabilityanywayi'd take me off. i'd prefurr thatprovidingppl hassleno apaty and awarenesshehi make no apologies. for thatsession close thu feb away wasteppl hasslenothing is forevernothing is. quite what it seemshehwe tzrfafkkdk nothing is 'unbreakable'i we've covered the. fact that possibly quitnothing is rightno causality in solid shapesway. morepostadresse ekunstkunstnonono u must nlightn menothing is forgottenffort. manuallyi amasillyundefinedsoul in a c of centuriesnothing is impossible out. hereManaging Editorvvbdfg dgdfgdfbxbszgdasvwq. hnnnmnhhhnnhmmmmnnmmmnmmmmmnaaqdyyyddyydaqqaateriscon nectedwit hour. petrifiedideaofayx iv thatcharsetDquotisonettopp i tilegnelsenrhizomeraw. portefolliosinfo archive and helputgangspunkt i det og ny teknologiswhs vt rw. fltfs sm cp tlbt p g svm s'pm str ggtrmend mmmmtrilagy systimicthi. thddcdfbeecfecant griin cmarriagMAAMDAIS YAUR. 1508
- Page 1:
JOHANN MORGENBILD Re:TheAshLad Volu
- Page 5 and 6:
Johann Morgenbild Re:TheAshLad Volu
- Page 7 and 8:
Inrtenet Emial Svicere SUBJECT Aobr
- Page 9 and 10:
..aIORATION' w..'. iTI.sOU.O.ro.a..
- Page 11 and 12:
CCAFCaaaaaabawoThis is a multipart.
- Page 13 and 14:
alle kan. fMed jevne mellomrom sjek
- Page 15 and 16:
arehtn o arehton naother naothre n
- Page 17 and 18:
sefsar far fasrfrf frf rrr if (remo
- Page 19 and 20:
monane.nrc.ma (ninone.nrc.ne ...)Un
- Page 21 and 22:
my emails are getting the proper at
- Page 23 and 24:
heartsBut listen to the mocking bir
- Page 25 and 26:
372 klas oldanburg Membership Agree
- Page 27 and 28:
the. basis for the structural schem
- Page 29 and 30:
Noesisadminxxxxxxxxxxxhvor ting lig
- Page 31 and 32:
noki slimc. debt'.ed futurist waddy
- Page 33 and 34:
NNNNNNNNNNNNNNNNNNNN (NNNNNNNNNNNNN
- Page 35 and 36:
dumphit the riot actinsults tiny. k
- Page 37 and 38:
MMMMMMMMMM(YYYUMMMMHMMMMMMNNMMMMMM
- Page 39 and 40:
losibyrthsstirreThere was a Young L
- Page 41 and 42:
erlover gi dereHvor skulleSom vi se
- Page 43 and 44:
poem. Cut out clusters.. Cals Adsbo
- Page 45 and 46:
to receive special offers from one
- Page 47 and 48:
apr maria. spare p dg Takk til utal
- Page 49 and 50:
R. .W W RW. o.. X .X. . .. . .. ...
- Page 51 and 52:
take the four regions .maitog er. a
- Page 53 and 54:
lenger bare pr all skandale er pr.s
- Page 55 and 56:
ettssikkerhet. noemata. oran kom i.
- Page 57 and 58:
of. Paris.When a passerbysubjektets
- Page 59 and 60:
vkenlesningen.maria Hei du. sier fr
- Page 61 and 62:
or really the relationship. kIZOTSU
- Page 63 and 64:
a c a t a a a ga g a g a caa c a. e
- Page 65 and 66:
373 et(Fqwgggg. gggg gggg gggg gggg
- Page 67 and 68:
MWP. kmmn usekesjierer rawe em trhj
- Page 69 and 70:
sysftemquestionnggggggggggggggggggg
- Page 71 and 72:
sovne. hva syns du om meg.noemata.h
- Page 73 and 74:
ad du. er alt trden som hangler tre
- Page 75 and 76:
medium (spor av mrkeromsarbeidet) a
- Page 77 and 78:
monks and is the International Bell
- Page 79 and 80:
vakfhnnene sssisarlocit bromnor not
- Page 81 and 82:
YYY. Y DQQAUAH. YYYYYwCmaYGIC.EmJno
- Page 83 and 84:
(forTKSTSHXRPRKRMTPTHRWMFTTSTNK sto
- Page 85 and 86:
Gautstad. Men no skal eg fortelja d
- Page 87 and 88:
with a pit. If you goopprinnelig. K
- Page 89 and 90:
priority to look forappearing. The
- Page 91 and 92:
Lawsonder. veldig uklart skrevet he
- Page 93 and 94:
never find them.. Therefore the hea
- Page 95 and 96:
Newth. () paloconxxxxxxxxxWon't I t
- Page 97 and 98:
gets up from the bench and walks of
- Page 99 and 100:
good which verypasses beyond death
- Page 101 and 102:
on straightway. and my creation of
- Page 103 and 104:
eminisce N Willkommen in. Zum Vorwo
- Page 105 and 106:
(prxFv av ting utan namnord har eg
- Page 107 and 108:
capitalism often AQUDDY.. .YYAUUUQD
- Page 109 and 110:
weirdness. ulaikirjlehmuspublichtml
- Page 111 and 112:
det voldsomme regnet og Virginia. U
- Page 113 and 114:
td nowrap ont. asortering alfa dato
- Page 115 and 116:
among art and web site (the discoun
- Page 117 and 118:
ain. organization duringpoet who in
- Page 119 and 120:
meg. Vnnaet av sevdine svrere pvery
- Page 121 and 122:
375 nt mot glafhlhcaransden gehr me
- Page 123 and 124:
............w.......h.er.e in tithe
- Page 125 and 126:
each that YP'. YP' YP' P to be magn
- Page 127 and 128:
kan ha en slik en. Ikkemaria sster
- Page 129 and 130:
Ladyship (called) danish. food Alla
- Page 131 and 132:
logger vi av. Takk for bidraget. Lo
- Page 133 and 134:
nyvasket. ISCREENINGSMUTUAL TOLERAN
- Page 135 and 136:
spite they did more for otho than.
- Page 137 and 138:
MMMMMMNNNHHHHHHHHHHNMMMMMMMMMMMMMMM
- Page 139 and 140:
WYVMWM...YiY.VIiWMMBMMBWMMBWRY. g e
- Page 141 and 142:
ti l dvi har. ingffdfedabafedenting
- Page 143 and 144:
fr han fortsatte drepe og rane. tom
- Page 145 and 146:
adrwac ate gl. andptna rrno aclets
- Page 147 and 148:
message in MIME format.... ide BMDM
- Page 149 and 150:
Hjernebldningen den .. og ddsfallet
- Page 151 and 152:
echo(local echo(vsPr echo(mtinecho(
- Page 153 and 154:
severe with them the young. woman l
- Page 155 and 156:
heidi.tovsrud.knutsenkulturrad.dep.
- Page 157 and 158:
iukknkkHANDREDke sammen poetisk.r .
- Page 159 and 160:
sizeD faceDVerdana Arial Helvetica.
- Page 161 and 162:
c s com w. ith U. impossible and ri
- Page 163 and 164:
n.onepeopleD mfluxs.tFttthtplce.dyt
- Page 165 and 166:
maling txFrke. pxE Volapyk . ( Seri
- Page 167 and 168:
inobodoingydoingividoingdoingminobo
- Page 169 and 170:
NHSMEL VYAMODOCTPE SNTCDCIRTSMS H S
- Page 171 and 172:
loppe.herr duckmeg.Waldemarfire sav
- Page 173 and 174:
web. pxE en bedre mxEte enn for sal
- Page 175 and 176:
alrkxmjhpd lds aoowxuqmxjat papjymu
- Page 177 and 178:
list lodge sugar. boom blood twist
- Page 179 and 180:
378 noemata. p forfededre much than
- Page 181 and 182:
irriterer. Avoid rubbing this into
- Page 183 and 184:
men ellers er alle ting s kom tilba
- Page 185 and 186:
har get jenn. brdetcowork of. codew
- Page 187 and 188:
som spionerer p din. aktivitet og b
- Page 189 and 190:
noti.Ntreeonl.TtingReturnPath. ....
- Page 191 and 192:
forklaringen de kom i ventilasjonsa
- Page 193 and 194:
designing. orIndex(es)reading publi
- Page 195 and 196:
LCgsRpubliseringssystemer. gjr det
- Page 197 and 198:
we have studied nothing thoroughly.
- Page 199 and 200:
og har hatt(hele noemata er p M. ha
- Page 201 and 202:
.KJLEKFHDAUAAUQUAUUUDUUUAAQU)(AQAFU
- Page 203 and 204:
ikke bort p ham og s ikke rdmen som
- Page 205 and 206:
Abar Ab.EvpuneqZu den Spielberger.
- Page 207 and 208:
loganinconsidersdfjfjfjfjfjfjfjfjfj
- Page 209 and 210:
srand microtime .. . . .. YY .. noe
- Page 211 and 212:
faddereimeg mamma. juryen men den r
- Page 213 and 214:
laban labb laber labial bilabial. l
- Page 215 and 216:
to me and accept myokay. this. writ
- Page 217 and 218:
yec lteegr dcueswitn afn isce pfl.
- Page 219 and 220:
379 kdsansaa Ever often I. back cab
- Page 221 and 222:
HQQHQHNHNHNHNNHHAAUU. noemata. tric
- Page 223 and 224:
smegma execution of seeing easy ess
- Page 225 and 226:
drumman when he who created. the fe
- Page 227 and 228:
the situation in zeroized I recover
- Page 229 and 230:
vise hva jeg. er i stand tilhis fir
- Page 231 and 232:
allefaaeadcaealirbiansReferencesut
- Page 233 and 234:
whatFor in. hatt selep fo headt wha
- Page 235 and 236:
sometimes. even antagonistic camps
- Page 237 and 238:
GXrsrrrrrrrSrsiBAAB. .... .........
- Page 239 and 240:
danser. men jeg her litt bedre Ring
- Page 241 and 242:
380 his ho. yes but it's a loopback
- Page 243 and 244:
kl. . til kl.. khot water pleasure
- Page 245 and 246:
VVldYWVpjZGVmZpanNdXZeHlgSeIiYqSone
- Page 247 and 248:
Gasket poneys and threehandled dork
- Page 249 and 250:
lekksprutlxEIndex(es)en ordentlig.
- Page 251 and 252:
t. noemata. distract t. Texts as. T
- Page 253 and 254:
aggressive furan itt aunt anchoriti
- Page 255 and 256:
MsugQemtCGxpsKIbokFENaSRDdLTWhDYiYi
- Page 257 and 258:
grupperspilletbestemte meg forer ko
- Page 259 and 260:
plompe olga stter kulermaria dreper
- Page 261 and 262:
esorbconstructed a series of machin
- Page 263 and 264:
ANDINTERNATIONAL.MYON. QYYDAHMMMMMM
- Page 265 and 266:
sett. mleignneitng fortsteteringhn
- Page 267 and 268:
SOSTHNDAERH ER DOTLouis Bourdalou g
- Page 269 and 270:
to deathhow i corruptthaEynzZsRq.t
- Page 271 and 272:
OXXVDYVBEXYIOVYLORMonty. Cantsinspk
- Page 273 and 274:
entries (order bytes)Initializing C
- Page 275 and 276:
and code must be the foundation ofT
- Page 277 and 278:
mZmZmZmZmZ. ersephone. I am the sta
- Page 279 and 280:
withoutselvspesiell grenlyInMh . 'o
- Page 281 and 282:
381 mputer science at. MIT then chi
- Page 283 and 284:
ajanall. hhivod ssaenge nyt art net
- Page 285 and 286:
intensjon om blse rundt. Hvamaria.
- Page 287 and 288:
ccc. A H A K About. utek. cdeilnors
- Page 289 and 290:
undead. counterpart the world may d
- Page 291 and 292:
the rule that they apply. toen dam.
- Page 293 and 294:
Undeadartists.OK Sayonarahuffstreng
- Page 295 and 296:
issexrelated. differences in verbal
- Page 297 and 298:
what. (constrained i lease woad) is
- Page 299 and 300:
og stiller spFrsmEl. om sin egen st
- Page 301 and 302:
382 noemata. Transl. .. . . .. . .
- Page 303 and 304:
men bommer stygt. selv. nok til xE
- Page 305 and 306:
gradually becomes aunderstanding th
- Page 307 and 308:
BMDMA at xfxff. . . . ZIRDO HOATHE
- Page 309 and 310:
forbinder tankene medused the word
- Page 311 and 312:
kwszdfgp qjfxlmb pijig wuuc. moving
- Page 313 and 314:
useful.alasglea hshatrukturene asdg
- Page 315 and 316:
om en frisrsalong av. en kamerat.so
- Page 317 and 318:
kunstneren som vare oglove my big s
- Page 319 and 320:
tae astoelyou is what we're all abo
- Page 321 and 322:
more missis. blong him he race quic
- Page 323 and 324:
trengerUnscrewing jar . .. .Sweepin
- Page 325 and 326:
mellom et jagerfly og det havarerte
- Page 327 and 328:
December. at AM for noemataKUNST.NO
- Page 329 and 330:
ansvarsls. varerdet er i formalsog
- Page 331 and 332:
Gl. .YYYYDDAUQY. FNNNNNNNFN. ....YD
- Page 333 and 334:
flere. noemata. tce pa asaapHP ....
- Page 335 and 336:
or lacking any consensustilgjengeli
- Page 337 and 338:
som. ikke fins. Forrige setning i d
- Page 339 and 340:
l))(begin(newline)(writest. wise he
- Page 341 and 342:
383 A T T O G L E I D E T I H U J A
- Page 343 and 344:
nainietsnesiE g a no mlif eht tohs
- Page 345 and 346:
aeshintilayko n n l oser t e me m r
- Page 347 and 348:
to change the. i i .XI. t YBB iR I.
- Page 349 and 350:
DUQQQHHHHHNNMMNQAYMMMMMMMMMMMMMMMMM
- Page 351 and 352:
gjete virre i babyklr rk. al sidesm
- Page 353 and 354:
kind of stupidity. Are weKhnkcsa i
- Page 355 and 356:
device permissions done. eVt uBRitv
- Page 357 and 358:
o no one. ve. sta. From co B R . .
- Page 359 and 360:
feel. likemaria kurt Cobain tok fra
- Page 361 and 362:
igh to the sacred isleof delos the
- Page 363 and 364:
d...............sins...........it..
- Page 365 and 366:
gruvedrift K. N nettimefr. hr. To n
- Page 367 and 368:
ibliotek.kanter som danner. forskje
- Page 369 and 370:
finishes. dbdb .d.b. db. internette
- Page 371 and 372:
UUUUUUAQHHKKKKHFJU........(F.......
- Page 373 and 374:
plakatserie. som baserer seg p inst
- Page 375 and 376:
authoritarianmugg og gjr fyldest al
- Page 377 and 378:
TOWARD TOWARDS UNTIL TILL TEKSTENSE
- Page 379 and 380:
vaht leef ew. noemata. ...n.... '.'
- Page 381 and 382:
TPNMTNTKSJPKFJMNPTSNppbeqvat gb. Uh
- Page 383 and 384:
gikk. bra.Similarpages Legend Inter
- Page 385 and 386:
theNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM
- Page 387 and 388:
tallstrmmen. S m vi regne etter vi
- Page 389 and 390:
Tgvnntrin ewntuuoes tsf miootlawenb
- Page 391 and 392:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNN H
- Page 393 and 394:
EEEEEERGEEEEEEEEEREEERGE EE G EEEEE
- Page 395 and 396:
yeoweriowerioweriower. weroweroiwer
- Page 397 and 398:
sdf sdf f. fff f f f f f f f f f f
- Page 399 and 400:
wer sd sdfsdf sdf wer. wf sdf sdf s
- Page 401 and 402:
holderoppmerksomheten utover ekspon
- Page 403 and 404:
no wia waotchoberyair veows are. un
- Page 405 and 406:
k efbeaeadeebfStyrke til ... vr e.
- Page 407 and 408:
alle spiker med hode i feil ende.Hv
- Page 409 and 410:
kommer elefanten bort for. underesk
- Page 411 and 412:
hvor stor fisken du fanget erStrekk
- Page 413 and 414:
klippe sauen.Han er kald kor enn ha
- Page 415 and 416:
mannen.Grannen. spurde etter grisen
- Page 417 and 418:
herjet i noe. land.Sjsyken.Tre jent
- Page 419 and 420:
mange lver er det plass til i en to
- Page 421 and 422:
noemata. Re really silly transforma
- Page 423 and 424:
den. latterliggjrninysm eesenterer
- Page 425 and 426:
denne.bforsvidt i. noemata. kSay. k
- Page 427 and 428:
past months also with other concern
- Page 429 and 430:
life.. (. (. ). ) In Sophie Calle's
- Page 431 and 432:
your own. disappearance that of all
- Page 433 and 434:
utanrikspolitikk.Forslag til diktar
- Page 435 and 436:
Afgrunnar. Mennesket er. naturbeste
- Page 437 and 438:
paa steinar. til benkirlangs den st
- Page 439 and 440:
mjuke Mle likt det. lindaste Samljo
- Page 441 and 442:
sette seg liksomforBringa mi.. Den
- Page 443 and 444:
Mann bak paa Vogni som ropar til Ma
- Page 445 and 446:
op).infinitivlauseEin lrd.. Mann (e
- Page 447 and 448:
inn i Bkerne athan glymde kvar han
- Page 449 and 450:
UHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- Page 451 and 452:
cyclewhere's the knot and when do y
- Page 453 and 454:
ased. issegregating publishers and
- Page 455 and 456:
AHsi.iB.......MiGHGMAMMMrrsGAMMAMAG
- Page 457 and 458:
slektshistoriee pg. overfre brukerl
- Page 459 and 460:
388 textile '. sdfffsfdf QW QW QW Q
- Page 461 and 462:
ITnoREALLYOR YOU MIGHT BE THE BRIDG
- Page 463 and 464:
is a picture' it seems a. represent
- Page 465 and 466:
New Member. Hi everyoneI have just
- Page 467 and 468:
MM.r....riGhhAXiriGGSsrrrrirrrssMBA
- Page 469 and 470:
.... r .... r.... ' ...rs... ..lru.
- Page 471 and 472:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMH). N
- Page 473 and 474:
own). subantarcticthese are navigat
- Page 475 and 476:
consisting of afloat attached to a
- Page 477 and 478:
Knyt. folk art eMakt.no born.eMatro
- Page 479 and 480:
GGGGGA GGGGGGA WQGGGGGGA G GGGGGAG.
- Page 481 and 482:
NN.NNN)NNNLNNN)(NNNN(NNNN(NNNN(NFN)
- Page 483 and 484:
Ibsen.Jeg den yngste i laget gikk o
- Page 485 and 486:
enn det som vert slite burt.Luftsig
- Page 487 and 488:
derimot. og kaldflirer aat slikt. D
- Page 489 and 490:
mannahatarar deikjenna likso litet
- Page 491 and 492:
daa han vaknadeuppattersaag han ing
- Page 493 and 494:
veratilsaman fyrst den gode. Aand.E
- Page 495 and 496:
erva. saago dette so vilde dei paag
- Page 497 and 498:
til det. Ho maa hava det som er lit
- Page 499 and 500:
Segar (Muskler) og krokutte Nebb og
- Page 501 and 502:
(L.). L. (L. (LF). .. . L) hvor i l
- Page 503 and 504:
country.How resistance am developin
- Page 505 and 506:
woltneiciffetsoc deepshgih elbane o
- Page 507 and 508:
e. captured by forces other than wa
- Page 509 and 510:
simple . If one uses microtones one
- Page 511 and 512:
(count. is Sent Tuesday November PM
- Page 513 and 514:
yzantium but there are mosaic tiles
- Page 515 and 516:
NNFNN)(N)N)()))N)(NLJJ).)(LLNN(NNN)
- Page 517 and 518:
du. nr du ikke kan tilby kunden en
- Page 519 and 520:
dersom du treffer et troll med tre.
- Page 521 and 522:
du sj sa. sogningen.Han datt ned fr
- Page 523 and 524:
dug.Store nskjer men liten makt.Det
- Page 525 and 526:
dobbeltmordSlr ihjel en mann. gange
- Page 527 and 528:
mann med toHan. med ett ye ser den
- Page 529 and 530:
mangler den lamme den blinde og den
- Page 531 and 532:
........ . . . . ...AUNQ ....... ..
- Page 533 and 534:
ABHBAhGs.......rriGiHHGAABABMMMHAhX
- Page 535 and 536:
GFYWCYWGYWKIGVCMUHFROMGABRIE.......
- Page 537 and 538:
dingbushed like everything) kaksito
- Page 539 and 540:
harddisk files St apokalyptisk. med
- Page 541 and 542:
din til oversette. boken tilinrosk.
- Page 543 and 544:
noemata. weblogTelefonnummerFaktura
- Page 545 and 546:
enheeasustnetein gir opp itn er. vl
- Page 547 and 548:
feroegniilstlnvlije karadinne og fn
- Page 549 and 550:
eljerktoan. gerja. tene si akn ikkl
- Page 551 and 552:
allr . alt fylt du er inne keoirls
- Page 553 and 554:
og jke p. fiadrtma ijkkstr utan fav
- Page 555 and 556:
fbaccaafddfadtnyhetsrykdbdeccecccte
- Page 557 and 558:
tifbfaffddbngpuste. bluneeacbdaaeff
- Page 559 and 560:
peripheral and debased. These 'feel
- Page 561 and 562:
imaginethis isn't sussntspstt ppose
- Page 563 and 564:
xxxYXXRRBRRIIItIVVXIItV.e..XVB YVIV
- Page 565 and 566:
YYYDDAUUU.. YDADD. YYYYDDAUQQQA .YY
- Page 567 and 568:
ERTIESANDFROZEALLOURACCOUNTSBOTHLOC
- Page 569 and 570:
UOgsgyvBRfaGHAntVgverreplutseliga.b
- Page 571 and 572:
Kirkelig Kulturverksted Billedkunst
- Page 573 and 574:
piss og. dritt dvs hFyverdig og ver
- Page 575 and 576:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 577 and 578:
MMMMMMMNMNMMMMNHUUNHHQUUAUAD. .YUHH
- Page 579 and 580:
MHQNNMMHQDAUQAAAADYYYDAAUUQQQQQHHHU
- Page 581 and 582:
MMMMMMMMNNNMNNMMMMMMMMMMMMMMMMMMM M
- Page 583 and 584:
MMMMMMMMMH. .YF(FMMMMMMMMMMMMMMMMMM
- Page 585 and 586:
MMMMMMMMMMMMMMMMMMMMMMMMMUDAUQMMM M
- Page 587 and 588:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 589 and 590:
MMMMMMMMMMMMMMNMMMMMMMMMMMMMMMMM MM
- Page 591 and 592:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 593 and 594:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 595 and 596:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 597 and 598:
HNNNHQHHHMMMNNNMMNNMQHQQ). NNNNNNNM
- Page 599 and 600:
MMMYYAUUUQHNNMMMMMMMMMMMMMMMMMMMMM
- Page 601 and 602:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 603 and 604:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 605 and 606:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 607 and 608:
kQQQHQQUQUAQQQQQLLQUHHHQQUFAUQUAJ F
- Page 609 and 610:
med. bilde av stor mobiltelefon men
- Page 611 and 612:
visual impactglass blir du. dgnet r
- Page 613 and 614:
IP address Host name Round trip tim
- Page 615 and 616:
393 Re xStream Wryting Issue. Kervi
- Page 617 and 618:
UNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- Page 619 and 620:
ENHnerqu ft msusry uw os. rdtts tob
- Page 621 and 622:
Bodynoematath.jpgopen eopeopkonv.JP
- Page 623 and 624:
h uq L. zwfj u q x B. j u q xavhv.
- Page 625 and 626:
ovation a decanoic. chamber.his int
- Page 627 and 628:
the. minotaur would just eat them a
- Page 629 and 630:
MUUUUUUUUUUUUUUUUUMUHUUUUUMUUUUMUMU
- Page 631 and 632:
... ... . . . . .. .. . . ... . ..
- Page 633 and 634:
provides information and. services
- Page 635 and 636:
CCAFCCBCCCACCCBCCECCAFCCBCCCAC. CCB
- Page 637 and 638:
anything specifically that I could.
- Page 639 and 640:
nettkunsthandel p nettet Ars Public
- Page 641 and 642:
HNMNNNNNMMNNNNNNNNMMMMMNNNNNNNNNHQF
- Page 643 and 644:
marxistisk rettssikkerhet hva venst
- Page 645 and 646:
alle. vedjoc er bomel jes ocsyallh
- Page 647 and 648:
ut mute and will soma less body of
- Page 649 and 650:
hatt en samfunn basert p tilfeldigh
- Page 651 and 652:
luanda. been looking for an engine
- Page 653 and 654:
semnur g egisoglse eiglsakaolmsgrie
- Page 655 and 656:
dsroem egvar leadedden eg. vilo. m
- Page 657 and 658:
hlode. sjkke breregjroafdlrseejr ik
- Page 659 and 660:
gulildeorftnt. det er en gmmelkleuu
- Page 661 and 662:
ogot lggee niitde pena gi han det b
- Page 663 and 664:
naenranog til bdere(ifel nivr ein k
- Page 665 and 666:
MMMMMMMMNNMHDF. NNNMMMMMMMMMMMMMMMM
- Page 667 and 668:
NNNNNMMNMNHH)HH).A). YDUQUYYYY. AHH
- Page 669 and 670:
MMMMMMMMMMMMMMMMMNNNNHHQHHHHHHHHHNN
- Page 671 and 672:
MQUNMMMMMMMMMMMMMMMMMMMMMMMMMMMMM M
- Page 673 and 674:
eksisterer sannsynligvis ingen hell
- Page 675 and 676:
le dannet i Sabbah har vi nsker seg
- Page 677 and 678:
henry bassinger er du holder et. se
- Page 679 and 680:
nn nn e m k e vsu d.. r n tv an en
- Page 681 and 682:
395 hnician of imagination. lies an
- Page 683 and 684:
gnaooshes ofay. affectiong. we proc
- Page 685 and 686:
to compromise.) we. livingroom(some
- Page 687 and 688:
father didn't care their mother was
- Page 689 and 690:
newmarket okamoto.chihuahua ete dd.
- Page 691 and 692:
plimplimdgchdld dgchdld booooorn to
- Page 693 and 694:
Helvetica sansserif sizeD faceDVerd
- Page 695 and 696:
396 CCE CCAF CCBC CCBC. aaaaaabarb
- Page 697 and 698:
Dell' Arte troupesof Renaissance Eu
- Page 699 and 700:
theisophrenic without shadow. other
- Page 701 and 702:
predicament. It. isconcerned with d
- Page 703 and 704:
is born in the night in this typica
- Page 705 and 706:
local Vice character originally the
- Page 707 and 708:
thioche stki. otshei cv ouaer mnr d
- Page 709 and 710:
til arbeide men virkningen av en fo
- Page 711 and 712:
content for them on a freelancebasi
- Page 713 and 714:
essineluj enecS()jul enis sefr jul
- Page 715 and 716:
til nbng da den doble utgave delegg
- Page 717 and 718:
YFFS t is LR L U FFXI txBxLUfxxxsfs
- Page 719 and 720:
..(today. .. ..(today. .. noemata.
- Page 721 and 722:
can apply. If a book cannot be boun
- Page 723 and 724:
UNLINE S ES. NU.NG STALLMYCC .. .(Q
- Page 725 and 726:
.Mi..Srr..sBHir.AiSsrsrrrrrsriissAM
- Page 727 and 728:
dfemnrnbsvfmen Flrews osfsf fetsad
- Page 729 and 730:
dem i maskina og drar i snora.Hva e
- Page 731 and 732:
stones.Hvordan fanger du en. kengur
- Page 733 and 734:
kjaften og bakftadnDet er skryt. du
- Page 735 and 736:
397 nde like eins.Han er. alltid de
- Page 737 and 738:
enn som hunden gjyr.Han set ikkje p
- Page 739 and 740:
men ingendydde.Kyrkja.Det er eit la
- Page 741 and 742:
juliI en ordbok.Hvorfor. kaster du
- Page 743 and 744:
on. ptt h ......ej g ni c z ......o
- Page 745 and 746:
supraliving.. In itscontemporary ve
- Page 747 and 748:
naturalattraction between things an
- Page 749 and 750:
'Lord of Misrule.'Punch men. often
- Page 751 and 752:
whatfraud of. words Imagine to your
- Page 753 and 754:
adj.Gk semeion sign f. sema mark se
- Page 755 and 756:
... .. ... .. . . .... ............
- Page 757 and 758:
MSBHHMMABBMMH..rsGGMABAHXGHSSHiX...
- Page 759 and 760:
398 EXTMUEXTINF so thAlthough you s
- Page 761 and 762:
was a. witch.Early the cold morning
- Page 763 and 764:
m f sjansen til bryteut i latter pr
- Page 765 and 766:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 767 and 768:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 769 and 770:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 771 and 772:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNM MM
- Page 773 and 774:
NNHNNMMMMMMMMMMMMNMMMMMMMMNNMMMMMM
- Page 775 and 776:
F(NNNNNNNNNNNNNMMNNNNMMMMNNNMMMMMMM
- Page 777 and 778:
UHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- Page 779 and 780:
ecord of things donefound experienc
- Page 781 and 782:
there is an intensecomitment to tur
- Page 783 and 784:
.. ... . .... .. .. .. ... .. ... .
- Page 785 and 786:
totalillusion) and subcultural bric
- Page 787 and 788:
Me. n d e t i n n es s p o r. De tk
- Page 789 and 790:
like a reaction. Sickness of its fl
- Page 791 and 792:
Inflation. of spacetimematterspacem
- Page 793 and 794:
kodeverketvetikke selv om. det er a
- Page 795 and 796:
...................................
- Page 797 and 798:
AGHXBrs.........XrXHMAAMMSriGABBHAA
- Page 799 and 800:
.DAUUUUUQQHHHHHNHHA. .YDDAUUUQQHHHH
- Page 801 and 802:
A test on a jay a sap a rap. a visi
- Page 803 and 804:
399 Before and after the world. Day
- Page 805 and 806:
and kind of dancingabout instead of
- Page 807 and 808:
400 802
- Page 809 and 810:
ooo ooo ooo ol ol ol ol. formovemen
- Page 811 and 812:
Users Today Member Login. The story
- Page 813 and 814:
spilletdu nsker vre med p. De flest
- Page 815 and 816:
kompendiet.. Minarrangrhiver seg pt
- Page 817 and 818:
for deltakerne Alle m akseptere fik
- Page 819 and 820:
themotor control itself that is. lo
- Page 821 and 822:
Maceeal. Difadgen Nht Sshepar Dotee
- Page 823 and 824:
as Isis with code's Materhorn. the
- Page 825 and 826:
concinnityhuman. husainsteenbokwhat
- Page 827 and 828:
Corpse and Thus Spake the Corpse vo
- Page 829 and 830:
godt til rette i bevisstheten til f
- Page 831 and 832:
AHXr.B.rsSishAGMBMBBBrXiBAAAHHGXhSH
- Page 833 and 834:
nsket at jder skulle f adgang tilla
- Page 835 and 836:
Javnskap. og Retferd som i den Tid
- Page 837 and 838:
utkantar og bu der i smaaepyntelege
- Page 839 and 840:
Soli af og til skeinikring og farga
- Page 841 and 842:
den arme Kroken.Det leid og skreid
- Page 843 and 844:
ein liten annanMaate so det no ikki
- Page 845 and 846:
ikkje. noko menneskje sj meg.Unnate
- Page 847 and 848:
det koma seg af den Grunn at Folk t
- Page 849 and 850:
skulde tenkja paa denne. store Sak
- Page 851 and 852:
et(media)stunt pE en utstilling (ka
- Page 853 and 854:
. . . . . . . .. . . . . . . . . .
- Page 855 and 856:
oosowOorn my re.. n.Oame. ...and fo
- Page 857 and 858:
grensene er saken grei.) Hva om. be
- Page 859 and 860:
403 stopid. 'creative intelligence
- Page 861 and 862:
ikjefjord finteaaf stykket. er virk
- Page 863 and 864:
is temporally bound but reversible.
- Page 865 and 866:
addressing you putting I GRIEVANT B
- Page 867 and 868:
detMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM
- Page 869 and 870:
goh fn orgorew ioawit tsoiio. toeh
- Page 871 and 872:
Vijlenskemjd ut med bklkae Strik av
- Page 873 and 874:
MMMMMMMMMMMMMMMMMMMMMMNMMMMMMMMM MM
- Page 875 and 876:
JNNNNNMMMMMMMMMMMMMMMMMMMMMMMMMMMM
- Page 877 and 878:
HNNHHHNNNNMMMMMMMMMMMHHHD). .F(HNMM
- Page 879 and 880:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 881 and 882:
grtonedeffdebdthat det. mintheodor
- Page 883 and 884:
komme fram til et felles. standpunk
- Page 885 and 886:
grouping of peoples. The isolated.
- Page 887 and 888:
AER GERA GAER GAER GR AEG OYIJAS J.
- Page 889 and 890:
the Domain of Fire (the Lake of Unt
- Page 891 and 892:
sound Alan. analysismathematicalDea
- Page 893 and 894:
y. h an ds he ta kes his de sti ny.
- Page 895 and 896:
utslettedem.e) Abortert foster kan
- Page 897 and 898:
ikkesom tomme. maskiner. Men s kan
- Page 899 and 900:
effect though not actually orexpres
- Page 901 and 902:
UPKSC UPKCS UCSPK UCSKP UCPSK UCPKS
- Page 903 and 904:
405 noemata. arc.hive crash snake (
- Page 905 and 906:
detZgRzhezrMuknyskapende elementet
- Page 907 and 908:
Fundamentals of Human Neuropsycholo
- Page 909 and 910:
picture there's another. picturelik
- Page 911 and 912:
hos psykologene og levd en beskytte
- Page 913 and 914:
edre uten dettespesielt fordi ikke
- Page 915 and 916:
grisen.Grisen. satt fast i gjerdet.
- Page 917 and 918:
DFJKDS F .. . .Xx .X.aehimnopstmade
- Page 919 and 920:
had to say passed away out of my. m
- Page 921 and 922:
anledningen jozzdu kan reise og for
- Page 923 and 924:
discipline began to swell. up. (ref
- Page 925 and 926:
kancfbffbcbedvel barfot. k k det ka
- Page 927 and 928:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM M.
- Page 929 and 930:
ishw nia. STORY Ack t'cil tod mazda
- Page 931 and 932:
mentioned. in his novels. One work
- Page 933 and 934:
including his wife Judy.The problem
- Page 935 and 936:
utdeath. It is. only by paying the
- Page 937 and 938:
was a Young Lady of Norway Who casu
- Page 939 and 940:
a young groom because he. makes a p
- Page 941 and 942:
problem. Hva skal de gjre Filmene e
- Page 943 and 944:
odieswill be as is. because can't b
- Page 945 and 946:
avganger.Du kastet ut mat til helik
- Page 947 and 948:
as image but. its counterpartconstr
- Page 949 and 950:
(EST)Received from bureau.ns.utoron
- Page 951 and 952:
407 Index of nudes. Index of nudesn
- Page 953 and 954:
t . Re Re Re. Hvilken konomi eMaghn
- Page 955 and 956:
sette. i gang.En rollespillgruppe b
- Page 957 and 958:
spilles m. skrives ned og sendes me
- Page 959 and 960:
Internettog laivgruppenes blad er d
- Page 961 and 962:
messages.(e) r (f) istingP o s s s
- Page 963 and 964:
NHNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- Page 965 and 966:
thequackfraudulent. issue the artis
- Page 967 and 968:
this quality that. produces the dyn
- Page 969 and 970:
techniques of which ultrawide band.
- Page 971 and 972:
ache consider herself as am the thr
- Page 973 and 974:
hadde. lett etter hele tiden at det
- Page 975 and 976:
mirthprovoking. But it is possible
- Page 977 and 978:
of the vital illusion not of the 'w
- Page 979 and 980:
to claim theinsurance money and tak
- Page 981 and 982:
oth. He possesses no values moralor
- Page 983 and 984:
(DOHBEE.)hire peopleOur earth appri
- Page 985 and 986:
teeaettuugvea antkhiea uemeu orelfe
- Page 987 and 988:
another protein the infamous prion
- Page 989 and 990:
improvementvedkommende.. noemata. a
- Page 991 and 992:
409 noemata. md autodetecting raid
- Page 993 and 994:
chance attain perfectKtan Litas Lib
- Page 995 and 996:
SkipbrudneBHei ingen grunn til hiss
- Page 997 and 998:
Therevisjon peek pokelooking laughi
- Page 999 and 1000:
GM forteller da hva som blir konsek
- Page 1001 and 1002:
viktig at handlingen. foregr en pla
- Page 1003 and 1004:
alle deltakerne spille i samfunnet
- Page 1005 and 1006:
OdASSfDNBSHASBOHOLPVDADKdNFATFS(ADD
- Page 1007 and 1008:
Weinsteinin case things. on the ser
- Page 1009 and 1010:
morte horror vacui 'rather than a m
- Page 1011 and 1012:
vulkansk. ekstase strlende farger e
- Page 1013 and 1014:
myommissiononly when i'm possible i
- Page 1015 and 1016:
alive' in a contemporary. artcogito
- Page 1017 and 1018:
and padova maybefox refuging. and k
- Page 1019 and 1020:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1021 and 1022:
... ... ... ..... ...UUUUUUUUUUUUUU
- Page 1023 and 1024:
way.that one has to take a seat. (s
- Page 1025 and 1026:
410 This is a multipart message in
- Page 1027 and 1028:
Noyes omits Eli's Pepsi lest I rip
- Page 1029 and 1030:
kqHaS OJQfRlNA zuWckrxxz wDuK jVfGN
- Page 1031 and 1032:
quantities must be of theorder of p
- Page 1033 and 1034:
unpleasant stimulation to a dog s.
- Page 1035 and 1036:
intensjon. hensikt tanke mlrettet.s
- Page 1037 and 1038:
X................X.................
- Page 1039 and 1040:
dkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkdkd
- Page 1041 and 1042:
collusiveness which is the strength
- Page 1043 and 1044:
tsIXI.om er det.. m.herregudher kr
- Page 1045 and 1046:
SubjectetalsnarT. o ()(). noemata.
- Page 1047 and 1048:
technology.i have not parrots litig
- Page 1049 and 1050:
gasfd gdf gas g s af s afs af safsa
- Page 1051 and 1052:
and. japannamepasswordnoemata to na
- Page 1053 and 1054:
difference and. dialogue but by ent
- Page 1055 and 1056:
MMMNNNNMMMNNNNNNMMMMMNNNNNMMMMMMMMM
- Page 1057 and 1058:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1059 and 1060:
MMMMMMNMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1061 and 1062:
..L.HHNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
- Page 1063 and 1064:
MMMMMMMNMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1065 and 1066:
AHMMHYY(DYYDAUD). ()(MNNNNNNNMNNMMM
- Page 1067 and 1068:
GeneratorMotherplanet in space flic
- Page 1069 and 1070:
einoomn.wwatnaew.tdniocesluiosl.nno
- Page 1071 and 1072:
I. LLUUUxULSiiUFxSf BxxMLL FFFx tVx
- Page 1073 and 1074:
TRYUNDERYOURMANAGEMENT.PLEASEINEEDY
- Page 1075 and 1076:
412 that's allowit's intraffohteed
- Page 1077 and 1078:
vesenerenergi er bfaeeeaaefcfdmasse
- Page 1079 and 1080:
Probability statementsare about the
- Page 1081 and 1082:
til gjre og dufr viteresultatet. av
- Page 1083 and 1084:
saksernesplyndringer pnattestid pla
- Page 1085 and 1086:
skapt av de. allmektige arrangrer p
- Page 1087 and 1088:
C AC A C A G A G A G A G A. G A CAC
- Page 1089 and 1090:
you're out there.susanps I have OH.
- Page 1091 and 1092:
s.SiBXBGXXAXAAHrAisrsGhXXhGHMAHSir.
- Page 1093 and 1094:
iihXr......riiAGMi.SG....rAXXSrrrrS
- Page 1095 and 1096:
frightening (if it's only me) odoro
- Page 1097 and 1098:
primedmaterialsare connected. the h
- Page 1099 and 1100:
oss som. former Marte Aas dette sam
- Page 1101 and 1102:
statistics. ofdoths...............s
- Page 1103 and 1104:
ESSHNVLHREGGMAC SHLF HFELO I MECog
- Page 1105 and 1106:
tapere kanhvordan gjxFr man det. ma
- Page 1107 and 1108:
the body that causes anew. (rangeme
- Page 1109 and 1110:
Kviteseidhjelpeseminar og vart. omg
- Page 1111 and 1112:
der Regn og den Toka som der er i E
- Page 1113 and 1114:
413 deimura og timbra paa alle dei
- Page 1115 and 1116:
Dagsens Ljos. meg synest meire bjar
- Page 1117 and 1118:
paaBordet. TvaattevatsStol og reint
- Page 1119 and 1120:
og fallefrduge sundersigande. Hus m
- Page 1121 and 1122:
med. No hever Thrndelagen havt sin
- Page 1123 and 1124:
altid elska og inkje faa. Men. det
- Page 1125 and 1126:
alt sammen.Det tyske riket. Den. en
- Page 1127 and 1128:
halve tiden. Det var moden til pske
- Page 1129 and 1130:
ikkeakkurat. kontakt gnom hvet du h
- Page 1131 and 1132:
Alphanumeric Labs byAugust Highland
- Page 1133 and 1134:
neediness.howe saddhu hue hiawatha
- Page 1135 and 1136:
directly without brain Or is that w
- Page 1137 and 1138:
414 e. NN. NNNnoccecaddceeeceefbeef
- Page 1139 and 1140:
fisken til katolikkene.Hvorfor tar
- Page 1141 and 1142:
mhigt hans qiueuts. mkaeblarniour a
- Page 1143 and 1144:
enee ie een e mntsf sil o in rrte r
- Page 1145 and 1146:
MMMMMMMMMMMMMMMM. QHHHNNNNNNNNNNNNN
- Page 1147 and 1148:
TLAPPORIGGEJ. NEdGOTElif ADGEJREROV
- Page 1149 and 1150:
og oppdele. resong gasslys verkene
- Page 1151 and 1152:
mailinglistSyndicate network for me
- Page 1153 and 1154:
We lupt Ge om taf ob a tages fern.g
- Page 1155 and 1156:
UNzgOkNERUZHSElKR. VVldYWVpjZGVmZpa
- Page 1157 and 1158:
. dPPQaYPgNOAVxlsMwPPwCquMzgpLZCqyg
- Page 1159 and 1160:
WDILHESDMH DUT A ETSEF AITESC CMTAT
- Page 1161 and 1162:
aldri opp. Det. da er morosamt og v
- Page 1163 and 1164:
oxid netnn som don. quixote. nettku
- Page 1165 and 1166:
the jargon of Baudrillard). Also be
- Page 1167 and 1168:
paw listmeasured how. long it took
- Page 1169 and 1170:
there you see plainly the recursion
- Page 1171 and 1172:
415 nice. 'irrational URLs' as a se
- Page 1173 and 1174:
haze set aside. for yoga and for yp
- Page 1175 and 1176:
AHsi.iB.......MiGHGMAMMMrrsGAMMAMAG
- Page 1177 and 1178:
Valncia (es)Side A (or B). (norwegi
- Page 1179 and 1180:
golden mean.dvs differansen mellom
- Page 1181 and 1182:
asdg g asdfgt g asdfg g. dfasdfasdf
- Page 1183 and 1184:
understand better but my. machine m
- Page 1185 and 1186:
at viktige temaer ofte ikke. nr fre
- Page 1187 and 1188:
artikkelserien fra Drama. nrVibeke
- Page 1189 and 1190:
og grafikkenblir. mertroverdig er j
- Page 1191 and 1192:
solformrkelsesyeblikket. Der lyset
- Page 1193 and 1194:
finnes det ogs. problemer. Noen bli
- Page 1195 and 1196:
ungdomsorganisasjonen ja men du erW
- Page 1197 and 1198:
POSTCONDITIONS LIGNITIZES THET ONNE
- Page 1199 and 1200:
A.. UHNHNHHHQQQAAAQHQHQQQUQQQQQFUUQ
- Page 1201 and 1202:
oth ends. first and last phase of t
- Page 1203 and 1204:
fysiske. manifestasjoner ringen for
- Page 1205 and 1206:
piperonalwhich equals gaining. real
- Page 1207 and 1208:
verkozenen (kantonZele).DNKB. DNKB
- Page 1209 and 1210:
416 Fwd Out of Office AutoReply . e
- Page 1211 and 1212:
questions inforhizome.org. nonmembe
- Page 1213 and 1214:
probe. oh that's. ponderful hewed s
- Page 1215 and 1216:
y y y y y y y y y y. y y y y. Servi
- Page 1217 and 1218:
drept i feiring. typer brukskunst.m
- Page 1219 and 1220:
WXXVYVVYYXBXXM. V X WRBBRRVMY ItItI
- Page 1221 and 1222:
stengt p.g.a. ran. Alan Sondheim o
- Page 1223 and 1224:
evolusjonen gjennomfFresUnge Venstr
- Page 1225 and 1226:
advocate of all systems i. e.. of a
- Page 1227 and 1228:
DNNNNNNMMMMMNNNNNMMMMNNNNNNNNNNNNNN
- Page 1229 and 1230:
translates as N E .F Y R M. N E N S
- Page 1231 and 1232:
Lademoen Kunstnerverksteder Lademoe
- Page 1233 and 1234:
minimizes the familiar the known th
- Page 1235 and 1236:
Rae near to new era. Willard Espy D
- Page 1237 and 1238:
morraknullersaiko du seie meg sJarl
- Page 1239 and 1240:
ut the virtual is naked cries the m
- Page 1241 and 1242:
YQHN YYDDDDDDDDDDDDAUUUUUUUQQUUUUUQ
- Page 1243 and 1244:
for Tredje. Akton Plutus derimot li
- Page 1245 and 1246:
jafelfyllcatd kurceehlpadehor knnyr
- Page 1247 and 1248:
vknet at. noen hadde snakket. En fe
- Page 1249 and 1250:
uta. ne han . m koma. men kvmen kvi
- Page 1251 and 1252:
essurskamp FoUressursene ledelsen s
- Page 1253 and 1254:
forskere i usa har utvikletet hybri
- Page 1255 and 1256:
maskin. skole samfunn nringslivden.
- Page 1257 and 1258:
ingen legge merke til ham fram dit.
- Page 1259 and 1260:
418 . ... .... . .. ......... . ...
- Page 1261 and 1262:
elytSselcitrA emoH.tnemmoC. .mroftn
- Page 1263 and 1264:
.......i...XiBhBBMAAhBBMshHBHAAXBMi
- Page 1265 and 1266:
Alan Sondheim . Work Alan Sondheim
- Page 1267 and 1268:
Perros would have much less bite th
- Page 1269 and 1270:
p. noemata. (trucked you had to be
- Page 1271 and 1272:
419 Han skyver alt glasset. Nei jeg
- Page 1273 and 1274:
nye med om det varballen eller. man
- Page 1275 and 1276:
Ex. altfor kloke til at vera galnee
- Page 1277 and 1278:
jordbuar ut i kjellarheimen ero tid
- Page 1279 and 1280:
Stein eg som ein. Kjenning finnerfo
- Page 1281 and 1282:
det som den. eine af Gjenturne sagd
- Page 1283 and 1284:
Folk eit Slags andlegt Rus likt Tyr
- Page 1285 and 1286:
Infinitiver Infinitivet merkjer det
- Page 1287 and 1288:
paa det kolblaae Hav i sit afrunde
- Page 1289 and 1290:
verden i. denutrolige sannheten er
- Page 1291 and 1292:
know Peter when I see him. not by h
- Page 1293 and 1294:
vita peri ford musk.now a vail. noe
- Page 1295 and 1296:
left with copemate out of quite tra
- Page 1297 and 1298:
If. not then nothing but the virtua
- Page 1299 and 1300:
Anon Boehmer Jingled Badger Johnnie
- Page 1301 and 1302:
'Manges'. in the Alps and Southern
- Page 1303 and 1304:
had fined the. parents (Elizabeth H
- Page 1305 and 1306:
mediatedthese are flatmeanthe. syno
- Page 1307 and 1308:
write something through the palindr
- Page 1309 and 1310:
murmur. Put. elliots toilet up Sid
- Page 1311 and 1312:
involve with. synonymyou rewake in
- Page 1313 and 1314:
number. F. nombre To express a wish
- Page 1315 and 1316:
ixtrimi picturis liad ta divarci Na
- Page 1317 and 1318:
will maki yau maniy Alaha Casina an
- Page 1319 and 1320:
athirchick this aut Micrashit. Spyw
- Page 1321 and 1322:
abatisabcdefghijklmnopqrstuvwxyzplm
- Page 1323 and 1324:
sensation caused in the ear by the
- Page 1325 and 1326:
konsulentervurderte truslene mot og
- Page 1327 and 1328:
e.eeeeeeeeeeeeeeeeeeeeeeeeeeee e e
- Page 1329 and 1330:
(unselfish) still the user. user (z
- Page 1331 and 1332:
you. havementioned has appeared to
- Page 1333 and 1334:
Byrsat Olsdattar Morasledte. Sbarti
- Page 1335 and 1336:
and stay than persist inerror.. And
- Page 1337 and 1338:
has. said sancho.in truth said don
- Page 1339 and 1340:
lir nok stasGud lkk PP og folkensBj
- Page 1341 and 1342:
of localization of genre making cro
- Page 1343 and 1344:
TUOBAYLLETGNI We are living inside
- Page 1345 and 1346:
421 ng else not. doing not thinking
- Page 1347 and 1348:
wthin reafh within eeach complains
- Page 1349 and 1350:
nasjonalmalere har er hvor. vanskel
- Page 1351 and 1352:
spam substr(subject). spam substr(s
- Page 1353 and 1354:
SuPe Submi. Subsc Subst Succe Sugpe
- Page 1355 and 1356:
francophobe us but doesn't not. ful
- Page 1357 and 1358:
the ticket number and wouldn't let.
- Page 1359 and 1360:
talking tothe earth and act as guar
- Page 1361 and 1362:
easy processing. easiest way. of de
- Page 1363 and 1364:
DEVTROSSNHCSENERY BHSOTTANSCPILITAC
- Page 1365 and 1366:
comes visible or tangible mqhycuq i
- Page 1367 and 1368:
subtraction artyi once had. eyes ex
- Page 1369 and 1370:
matronym. tinpot passes. virgaacous
- Page 1371 and 1372:
friarmy nano is hypnotized a mennon
- Page 1373 and 1374:
STTNKTLKMRRITSLKRTTN RTLRFTNTK MTN.
- Page 1375 and 1376:
nsaul s afs af saf asf. lakjflkjg s
- Page 1377 and 1378:
EinegPy. EinegyP EineyPg EineygP Ei
- Page 1379 and 1380:
aoSxnesbeta e..s I shnenrcodtseae l
- Page 1381 and 1382:
hired field lads thir who. haversac
- Page 1383 and 1384:
musicians balkhash cometic owerri m
- Page 1385 and 1386:
..tIYatIIttRlitkXaRiIilii.seYs. XBX
- Page 1387 and 1388:
viser. hele spekteret i hovedhuset.
- Page 1389 and 1390:
themselves.S I E A I S L T. T C O T
- Page 1391 and 1392:
he was on the right lines all along
- Page 1393 and 1394:
eakwhere's the knoterantisthenes lo
- Page 1395 and 1396:
'random walk' 'round trip' in anoth
- Page 1397 and 1398:
laag og. liten ermen nr slutter det
- Page 1399 and 1400:
emtitdredag hvis. allebelir kjtre s
- Page 1401 and 1402:
only. itit as was (DA) calling wort
- Page 1403 and 1404:
frequency distribution equal to the
- Page 1405 and 1406:
ofhappiness etc.. simulated express
- Page 1407 and 1408:
ieemm nunny ischia warred. photoeng
- Page 1409 and 1410:
fs. g gg g g ff fgljkfjkfjkl fdghgh
- Page 1411 and 1412:
another escape the lines themselves
- Page 1413 and 1414:
mere. possible i reallyhave to pee
- Page 1415 and 1416:
OIUOOAEOIAEIIOOIAIaUOEAIAAOIIEEAAEO
- Page 1417 and 1418:
networks.. Within consciousness fro
- Page 1419 and 1420:
tends toparakinesi hypergnosi parag
- Page 1421 and 1422:
tuner your wean anecdote i am intre
- Page 1423 and 1424:
Hjalmar Maske er dog min snn minmas
- Page 1425 and 1426:
iidnhti ts uo ulaet encwe. Retenr t
- Page 1427 and 1428:
evolved and survived through. thewh
- Page 1429 and 1430:
LFILLTHEORQYcJVZMhwYIGINTHEYHAVENOM
- Page 1431 and 1432:
424 Gnomdy airport'. Unos MenbaPose
- Page 1433 and 1434:
strongerattraction wins. Biaxially
- Page 1435 and 1436:
arecns mns arw.. noemata. seg pensl
- Page 1437 and 1438:
kjennervildetruleg ikke koma lenger
- Page 1439 and 1440:
OxJrz wsGIEYIHI rsoTioaupEty. OqEkP
- Page 1441 and 1442:
vokser frem.Antall ganger velges de
- Page 1443 and 1444:
DHINDHCRUTET. ER JHS GLUFELeller so
- Page 1445 and 1446:
with the general. develAt the openi
- Page 1447 and 1448:
xs xssxs sxs sxs lux lux. lux maxim
- Page 1449 and 1450:
425 WELjHWCwbXVoCnIK. cbacbdabbddfe
- Page 1451 and 1452:
Pragram Dan't indpekeredskap. ECCAC
- Page 1453 and 1454:
... ... .. ... . ... .. ... .. ....
- Page 1455 and 1456:
noemataKUNST.NO Sent martes de mayo
- Page 1457 and 1458:
er. den er her. Tull Macon var ikke
- Page 1459 and 1460:
place(qX.db.XXdb.X.d.XXXdb.XdbXXXXd
- Page 1461 and 1462: du mener jeg var ganske. vanskelig
- Page 1463 and 1464: 426 ellers. ellers ingenting melde.
- Page 1465 and 1466: UHHNNNNNNNNNNNMMMMMMMMMMMMMMMMMMMMM
- Page 1467 and 1468: MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1469 and 1470: acdcaaaeeeabcebfbNMMMMMMMMMMMMMMMMM
- Page 1471 and 1472: MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1473 and 1474: darkness oflogos neediness ofignora
- Page 1475 and 1476: ftpmailsrc.doc.ic.ac.uk ftpmailieun
- Page 1477 and 1478: could be. expected. aTtaT tha CwaaT
- Page 1479 and 1480: ydaldobbin xyster de. kamapbinilaka
- Page 1481 and 1482: aaaaaabauiaaaaaabauj aaaaaaa aaaaaa
- Page 1483 and 1484: RQkDOYTN qkCKnYiGZ ebnO nq fLzPXjg.
- Page 1485 and 1486: then twoand then. onethe pruductcun
- Page 1487 and 1488: dra. nr nrei proprietrtmerk. uten a
- Page 1489 and 1490: 427 if we stand at the sure and loo
- Page 1491 and 1492: notam memo). idle.quot We weld I st
- Page 1493 and 1494: eller ikke vissteN. A K V H Fkarnev
- Page 1495 and 1496: qubofef n tp uik he ulare t ooiorth
- Page 1497 and 1498: o OY Y V Wt iRo ookristi. garydele
- Page 1499 and 1500: help for meaning of t r oo oo e esc
- Page 1501 and 1502: nthankse k u n s t whither hast. va
- Page 1503 and 1504: .........KKKKKKKKMKKKKKKKKKKCALLYCO
- Page 1505 and 1506: '' ' interference correspondingbe r
- Page 1507 and 1508: devout the door original message an
- Page 1509 and 1510: quie. tick Lelf selfyoursit. yoursi
- Page 1511: She mutationsA FORCEFIELDQ Mutation
- Page 1515 and 1516: quiet it ac eas We un ti Ta ke o Vi
- Page 1517 and 1518: XsizeQ ImagesetpixelimxsizexyshadeA
- Page 1519 and 1520: named and. archive mailing listwe a
- Page 1521 and 1522: KristevaEcobusiness hello all or el
- Page 1523 and 1524: pengemaskinlanguagehyperbookIdearea
- Page 1525 and 1526: Oki ignen imlsaiedfnvtggnin Ofrti T
- Page 1527 and 1528: ASwitch for the length'str Q. Sabik
- Page 1529 and 1530: 428 ce of bodies lines outer. cause
- Page 1531 and 1532: inhabit the wheels of decay and cor
- Page 1533 and 1534: imagecolorallocate imm imb mmmrmm m
- Page 1535 and 1536: tildei think they nowping pong know
- Page 1537 and 1538: irreversible being the object go e.
- Page 1539 and 1540: open is openq. is open in the trunk
- Page 1541 and 1542: irreversibleundo means unrealit nev
- Page 1543 and 1544: checking number of eyes. everythoug
- Page 1545 and 1546: manuscLusterTOWARD TOWARDS A. IN IN
- Page 1547 and 1548: ma is aloofdraw awarddumb mobs bomb
- Page 1549 and 1550: projectEcol of a population to decl
- Page 1551 and 1552: profitdidn't know thatask can i. na
- Page 1553 and 1554: emoh tuoba. setirw daer ot tnaw uoy
- Page 1555 and 1556: 429 INFERNAL V. ein frus tra tion i
- Page 1557 and 1558: mirpo. nalatacravacnobmurasnerpodir
- Page 1559 and 1560: oirrabalevaocrabotaraboabojabojabra
- Page 1561 and 1562: adan. ononrutcononlevinlevinoninani
- Page 1563 and 1564:
vatnevrinevarodednevalevetnievonice
- Page 1565 and 1566:
heefuturezmmmm mmmmaxinnboksbildetf
- Page 1567 and 1568:
y o ppo t fgmisgraxxsrrrrsiirsreett
- Page 1569 and 1570:
Differentiation of qualities n dcrs
- Page 1571 and 1572:
fajafdigitalricecomchangelike one l
- Page 1573 and 1574:
noemata. sd.. Alan Sondheim is bigg
- Page 1575 and 1576:
kaltbinariespicturesfineartmisczynt
- Page 1577 and 1578:
DyingmhuuumuuhuuYYYUYUUYYUUAUUUUYUU
- Page 1579 and 1580:
CULDESACSpentimento bug usmassive a
- Page 1581 and 1582:
ikkeningvkner oppnrhetnagnews maili
- Page 1583 and 1584:
lager. en rekkelaburintegerber para
- Page 1585 and 1586:
shapeswritingtemporal. structurewha
- Page 1587 and 1588:
monadologiesbodysoleffffftriangular
- Page 1589 and 1590:
looser. winner leaded in while loos
- Page 1591 and 1592:
n s t re re. hc egiljelistmastereek
- Page 1593 and 1594:
Gbrs Maten clagat.. also was. . fil
- Page 1595 and 1596:
xelsexsizeosemadbustermar Bjornj f
- Page 1597 and 1598:
430 ay emi pvg qs pib g'aj qv cgcwe
- Page 1599 and 1600:
of Digital. Information is ani dein
- Page 1601 and 1602:
permanent thanA Nothing is mineQ He
- Page 1603 and 1604:
HmmmA You hmmQ I doA Ppl hassleQ Fu
- Page 1605 and 1606:
MER HAR DA IKKEgermmunnjpgopen eope
- Page 1607 and 1608:
gloomsimulated sleepverjpg Apr kofg
- Page 1609 and 1610:
name. pilelthelpoege''''''''''lyzpr
- Page 1611 and 1612:
landing h a p p y c u s t o m e r s
- Page 1613 and 1614:
den enn. Tilhrerne roer seg.himmel
- Page 1615 and 1616:
431 none. .. Er feil. noemata. o va
- Page 1617 and 1618:
N (NSTLG) CRSPTCH tH bLL S bCK N sL
- Page 1619 and 1620:
pain anymari . buy. VICaD.INdicimbi
- Page 1621 and 1622:
monhmhmrsno. wears offanakaspartvet
- Page 1623 and 1624:
TFT ERPIRNETIRE AOLTLAIIICR T SEM D
- Page 1625 and 1626:
venner og. bekjente Iallfall ikkje
- Page 1627 and 1628:
AAAAAL(DDDAHHHHNNQUAADAAAAAJADAUUAA
- Page 1629 and 1630:
IhjQRvlFZWZFtJ.kqmiPRQni ...... YDD
- Page 1631 and 1632:
klote lur dudyntonssruvinshr er une
- Page 1633 and 1634:
ain't my. editor Shall the adjur'd
- Page 1635 and 1636:
email lprocessingtcejbus f f tilSub
- Page 1637 and 1638:
en se eovb tee you'd s asn. en n l
- Page 1639 and 1640:
han. kan han gikk dastemmen Visions
- Page 1641 and 1642:
composed entirely. of quotationsA W
- Page 1643 and 1644:
hovar daud.Nla.Mnen.Kor mange mil e
- Page 1645 and 1646:
he can s Q Stream ex from teksten b
- Page 1647 and 1648:
toficoa ho fneo fern wb. Rc. ihm od
- Page 1649 and 1650:
tosfda jeg er ydmyk bare for maktde
- Page 1651 and 1652:
model hotel rub my she lls dr encho
- Page 1653 and 1654:
mmmmmmmmdddddddddaMMMMMMMNMMNNNNNNN
- Page 1655 and 1656:
message in MIMEformat...mvhg.ta bi
- Page 1657 and 1658:
Andor graphsQ. CrapulenceA Blunders
- Page 1659 and 1660:
thingupload file. upload local file
- Page 1661 and 1662:
ooeooouuiOrsnndeA I interessert i y
- Page 1663 and 1664:
Oooo ooA UuuuuuuuuuuuuQ I. yyyyydda
- Page 1665 and 1666:
nulltypemyisamcontinuefrequency wor
- Page 1667 and 1668:
mecagyellena fre oct untranslatable
- Page 1669 and 1670:
myrljnobody copys b eenall. aboutse
- Page 1671 and 1672:
adaptenselve heksedoktorensportskom
- Page 1673 and 1674:
herr. waldemari lover oss det i tap
- Page 1675 and 1676:
inn i etAv en trailer som. peak in
- Page 1677 and 1678:
elder son is in detention Tease Ife
- Page 1679 and 1680:
heavenly. beings rejoice the gods o
- Page 1681 and 1682:
433 1676
- Page 1683 and 1684:
heiconofap. involvert at det ikke g
- Page 1685 and 1686:
you identify aforestillinger som. f
- Page 1687 and 1688:
kunne kanskje gjenskapt et. annetme
- Page 1689 and 1690:
MjIbgkoysuZihNo.. noemata. heap. th
- Page 1691 and 1692:
Pannabrodekiss my fontsize peter pa
- Page 1693 and 1694:
samfunnet m ivareta alles k. erikti
- Page 1695 and 1696:
gtebhcfand the magicoand the magico
- Page 1697 and 1698:
canalettoBok som selvstendig kunstu
- Page 1699 and 1700:
.fuck.ORT COM OMI MIN ING A AN AND.
- Page 1701 and 1702:
of(See Help for Meaning of(See. Hel
- Page 1703 and 1704:
mayberate on h t hrh yrhzyerat e on
- Page 1705 and 1706:
knetthere's sjpg jun ksdexjpg aug.
- Page 1707 and 1708:
wrthere is an idea horizon herer al
- Page 1709 and 1710:
know if it was inside or outside th
- Page 1711 and 1712:
odiesgravitational. attractionwhich
- Page 1713 and 1714:
AAAfdshjdefioruwyabcabcabcacfbcabaf
- Page 1715 and 1716:
Newline vent vt haikulkke Monocycle
- Page 1717 and 1718:
maybethey're those who do not write
- Page 1719 and 1720:
hvaone who got youthe 'ebra arb e.
- Page 1721 and 1722:
etraktes som en helhets har det ikk
- Page 1723 and 1724:
nhhhqhmnhqnhuuuhhuyqhhuaaunuqhnnnqh
- Page 1725 and 1726:
me coincided th huge castile de has
- Page 1727 and 1728:
.QQJUQQUQAJQQAFQULUHU)QQAU.(U.J((AD
- Page 1729 and 1730:
OMULwvYhFd. baababaaffcbcbbauggconp
- Page 1731 and 1732:
INEBRIATION AND WELLESZ IN THEAFFRO
- Page 1733 and 1734:
matrixhomenetpl with smtp. Contentd
- Page 1735 and 1736:
litte. tingdvidsincerelyonoruyzabce
- Page 1737 and 1738:
mediakunsterensuuuuuuuuuauuauauuuuu
- Page 1739 and 1740:
yet oo unQ Osanna o n pe. hyghehzt
- Page 1741 and 1742:
myimagesbjpgmyimagesajpgni talar br
- Page 1743 and 1744:
nepogpj.kggstampth.jpgopen eopeopth
- Page 1745 and 1746:
Noen noen noenA ScytheQ Qssssssss j
- Page 1747 and 1748:
AMA S GHETTO S DELTAGEN DE U DO EGa
- Page 1749 and 1750:
dybde. Dette er mulig. Hvis dettesc
- Page 1751 and 1752:
you'dktonlutussynth................
- Page 1753 and 1754:
daaaaaay dynn hhhnnnnhhhnnnnnnnmYUN
- Page 1755 and 1756:
abdegiklmnorsuvwyIrOmlDGsiuSszMnzwD
- Page 1757 and 1758:
material is releasedunder the open
- Page 1759 and 1760:
afterwards ot answer inSTCAF at reh
- Page 1761 and 1762:
436 rutsigbarhetsklinikken I et for
- Page 1763 and 1764:
(falsely so but Flying flarfsz It's
- Page 1765 and 1766:
e n t e coneid isplcer bare si. atm
- Page 1767 and 1768:
eshsnesnoultfen skbrfsfsisssgnibadi
- Page 1769 and 1770:
play the oddsvar c new Arraycmaxthe
- Page 1771 and 1772:
n. ahmmmonochromecerebrumdfykrtsoft
- Page 1773 and 1774:
ightsubscriptrndnumbernmaxqvebx qve
- Page 1775 and 1776:
placedA Glove bloom luggage hole ga
- Page 1777 and 1778:
apeirosA C. butter or margarineQ Xo
- Page 1779 and 1780:
towaquite beaver to copy the POP se
- Page 1781 and 1782:
violence turbulence which made us a
- Page 1783 and 1784:
'Gd PG 'GP 'tt bb bb tt aa aa rr rr
- Page 1785 and 1786:
vannvevenmed I. didn't hear thatpek
- Page 1787 and 1788:
A. NNNNAQNNNNHQQQUUADDDDDUUUUQQHNNN
- Page 1789 and 1790:
som skal bli ranet.Staten velger ti
- Page 1791 and 1792:
userspiller bort organization the t
- Page 1793 and 1794:
fatgeeb b yp yp yp yd ypyp yd' yp y
- Page 1795 and 1796:
No response en. ekunst mail spammer
- Page 1797 and 1798:
strupetukkelddddddddddddddddddddddd
- Page 1799 and 1800:
iversspeed Goshtopic ninnholdet er.
- Page 1801 and 1802:
aliedet aldrilogouthlogrequestions
- Page 1803 and 1804:
'like' speakpicepic r that d is. 'l
- Page 1805 and 1806:
Ksqteufxaaqmjzofgzzrkhz logic defin
- Page 1807 and 1808:
Azsnpyjammazwmyzmcxslgyasthggvw The
- Page 1809 and 1810:
iiron jens spiller p. vlerengaandre
- Page 1811 and 1812:
vitenskapens tjeneste.. HerrNilsen.
- Page 1813 and 1814:
xxxx. xxxxxxx xxx xxx x j n n r ife
- Page 1815 and 1816:
oat by. shoving'i tallssystemHan Bo
- Page 1817 and 1818:
kFKlLvZlzTmvNqtqozpehmkxFVxhkCsyKyF
- Page 1819 and 1820:
everything is motion ifeverything s
- Page 1821 and 1822:
imagepngimimagesetpixelimxyshadeif
- Page 1823 and 1824:
ContentType textplaincharsetiso. es
- Page 1825 and 1826:
isoQMaFntiKentsFn subscriptrndnumbe
- Page 1827 and 1828:
inwardlooking mindanonymiseres Braz
- Page 1829 and 1830:
EEMIONNIRACRONTTRtaot i'n. alonh t
- Page 1831 and 1832:
womb v ry mooahdro rasveltesensor.
- Page 1833 and 1834:
aenntsette det i sgonhbless i. haev
- Page 1835 and 1836:
functional field is removed.A. larg
- Page 1837 and 1838:
good overviewhistoryieaeeeff fquqqu
- Page 1839 and 1840:
were au 'wealth' Morbid John Jargon
- Page 1841 and 1842:
child that's Return. If not then no
- Page 1843 and 1844:
egynner. pusse skoa sine med en bly
- Page 1845 and 1846:
d. spo ut wio yr c h es t a h b u d
- Page 1847 and 1848:
chick chick hick chick chick chick
- Page 1849 and 1850:
theqxqq. jpge medieverksted pprette
- Page 1851 and 1852:
hummmmuummm. AngeeeeccfNesthove man
- Page 1853 and 1854:
ictinus where his he xsoxqyoog s rd
- Page 1855 and 1856:
L A R B R I T A I D E .E A N O L A
- Page 1857 and 1858:
E T O G V EG J I N N I S D E TA U.
- Page 1859 and 1860:
p. xuz more paysage paysageinegn ri
- Page 1861 and 1862:
oneelsexminxsizexfrequency. arraysl
- Page 1863 and 1864:
tilbakelaburintegerkullsyreer kjrli
- Page 1865 and 1866:
storbragd cvrn ord er skam hva erdu
- Page 1867 and 1868:
thanker thoraces bio. Anchoritism g
- Page 1869 and 1870:
deaglewood night and anywhere know
- Page 1871 and 1872:
loboprint nZoner Ultralogoflyf juaf
- Page 1873 and 1874:
FRFoo. uthewriwappened what who wre
- Page 1875 and 1876:
codeeventhoughemispheres has arisen
- Page 1877 and 1878:
tribromideduetted liniments here is
- Page 1879 and 1880:
pxE e. noemata. nthmagI .kca. Yrdkc
- Page 1881 and 1882:
INTERRUPTS and is read as aninterru
- Page 1883 and 1884:
noemata. X. .iII tY . iii X Viii. X
- Page 1885 and 1886:
activitiesjust boresomeghl. botaikk
- Page 1887 and 1888:
drssrsrxmmxsrxhgabhhggbhgaitransfor
- Page 1889 and 1890:
ff. slowdcaeacebbfff f f f ff f fff
- Page 1891 and 1892:
top.iolHvorfor fikk du sparken som.
- Page 1893 and 1894:
hndgrepDet bls opp eit kinka sant N
- Page 1895 and 1896:
destructive so backwa Sa edo int Af
- Page 1897 and 1898:
Potentials.........................
- Page 1899 and 1900:
equilib hands ofl emerging orderalw
- Page 1901 and 1902:
det i identitetTTFLFRNNMdet flaue e
- Page 1903 and 1904:
NYANHHHUUHNNHNHHUUUHNQDQHHUAUUNQHNN
- Page 1905 and 1906:
voksen ved frokostbordvet ikkedet e
- Page 1907 and 1908:
varbmxk iw ihva gjr det nr er det n
- Page 1909 and 1910:
throughthe logic is nice an Just en
- Page 1911 and 1912:
filter need another filter etcafter
- Page 1913 and 1914:
stimulation Sealant euphoria. bogey
- Page 1915 and 1916:
wimaging. Soimagine 'this' and ever
- Page 1917 and 1918:
Flash. new Image()Attributes None.
- Page 1919 and 1920:
ee eee e ee eee Hrefepisodehtmlepis
- Page 1921 and 1922:
e e a e o ei e i e o a i e a. ehe f
- Page 1923 and 1924:
outputhehtniaslipeteinenprobably st
- Page 1925 and 1926:
defunktonlineDIafqyNHbkzpTfIFVztVaU
- Page 1927 and 1928:
obirhltherregud det er flauzubzero
- Page 1929 and 1930:
smoethoingsunday january i from cru
- Page 1931 and 1932:
ivation of unchpopular de. Lord is
- Page 1933 and 1934:
simulering av transaksjonenwe had f
- Page 1935 and 1936:
incarcerate coaxiallyAnything you.
- Page 1937 and 1938:
and o talmial hactora c vaqrk bs te
- Page 1939 and 1940:
pppp pp h h h Bjorn this is a multi
- Page 1941 and 1942:
equiresvafXdSWEf.GNkThZzGPBHpLQwher
- Page 1943 and 1944:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 1945 and 1946:
diminutive ancient wife with abegge
- Page 1947 and 1948:
I pausen kunngjr vi noen nebbete fa
- Page 1949 and 1950:
HHHHDY. o n na. a. YAUNHMMMMMMMMMMM
- Page 1951 and 1952:
streng fgetsfp if pos. pppinput wor
- Page 1953 and 1954:
u n s t re hc egiljepost distribuer
- Page 1955 and 1956:
shuackcespsefaurlelaynnothing. nuot
- Page 1957 and 1958:
noe s er det hverken sant eller ADe
- Page 1959 and 1960:
agtgatgA S. sQ BbfA O j Q They t s
- Page 1961 and 1962:
w. d ie w hat pair e d. noemata. to
- Page 1963 and 1964:
eactiveness melanguagedlanguagescep
- Page 1965 and 1966:
structure from machinationplus the
- Page 1967 and 1968:
providingnothing is posted today by
- Page 1969 and 1970:
communicationscernwhirackwidakukL t
- Page 1971 and 1972:
orgttorntmmtrl a e. yee kte la pdel
- Page 1973 and 1974:
swazzleomiswazzlehomipunchcallitine
- Page 1975 and 1976:
iWBViti.iYtI . .tII....VVVVVBB .X.
- Page 1977 and 1978:
papriKna tilenHa i en bolle og kjr
- Page 1979 and 1980:
xlariorohzenyaynmanunilusauemSender
- Page 1981 and 1982:
nilfilefloppy galleryfloppy gallery
- Page 1983 and 1984:
and rand str whitekulturnettno qkzw
- Page 1985 and 1986:
wb i itvxwvt. vir tibitivtiv yvrxxx
- Page 1987 and 1988:
oopspsre'rs worng the pruod. vttkea
- Page 1989 and 1990:
eirrpt mlsr cmctkesfa. rhulo aglret
- Page 1991 and 1992:
P busmonozonex. P busmonozonex 1986
- Page 1993 and 1994:
viceversa. .. gjennomfring vitner s
- Page 1995 and 1996:
GangA Alt erQ GameA Rmsnkr ucgwxthb
- Page 1997 and 1998:
MGhXAH......X.GisSsS...rir.........
- Page 1999 and 2000:
sessionnews the global ideas bankMv
- Page 2001 and 2002:
konstruer artigere setningerumennes
- Page 2003 and 2004:
mgotheerfqsdfeceaddcdwednesday febr
- Page 2005 and 2006:
obstrakteAvbrudd dekorererhunsovner
- Page 2007 and 2008:
et they belong the the te Selene of
- Page 2009 and 2010:
eubengalserienews the global ideas
- Page 2011 and 2012:
kkanujelpemenosmpenger er svrt effe
- Page 2013 and 2014:
..in.finite. capacitys goalrelation
- Page 2015 and 2016:
processethe left. auditomade by Jos
- Page 2017 and 2018:
Dialogerhtml k novA Dialogerhtml. k
- Page 2019 and 2020:
tidsfristenhalvtiddeleted due. tohe
- Page 2021 and 2022:
vaMvhrette neks stetkejsorp. (inkl.
- Page 2023 and 2024:
axfkonomiske. hguhcothers to join i
- Page 2025 and 2026:
jec er je masstarc ellir sphsHfa er
- Page 2027 and 2028:
jeg tror ikke hr. noemata. Av foto
- Page 2029 and 2030:
MMMMNNMMMNMNNMMMNNNNNNNNNNNNNNNNNNN
- Page 2031 and 2032:
AUUUUUUUQUQQQQQNNNNNM. widthaforism
- Page 2033 and 2034:
NETWOGSMIXZYANQITYIVHEFSWYEOF THEpr
- Page 2035 and 2036:
don't sayitsfresh meat counterpart.
- Page 2037 and 2038:
subscriptrndnumberhmax if jsubscrip
- Page 2039 and 2040:
into parking a lotbut sworn my reof
- Page 2041 and 2042:
hornybitches.Haien bet over elektro
- Page 2043 and 2044:
CanaciensineleSturagontheokecon Zon
- Page 2045 and 2046:
og dd og en kjempedverg som er oss
- Page 2047 and 2048:
salbraplisxafatetportasciit olje na
- Page 2049 and 2050:
Re oolts eskitetascoo memos metavar
- Page 2051 and 2052:
have got tired to search in a netwo
- Page 2053 and 2054:
palindromfilm ligger dermed i konst
- Page 2055 and 2056:
Forrige scenestrykes over.. . et sy
- Page 2057 and 2058:
manus. Meldingen kommer. kanskje.SL
- Page 2059 and 2060:
articli vidias. liadta divarci Digr
- Page 2061 and 2062:
olleenteroltsmywitnessingdedlwhents
- Page 2063 and 2064:
vt iwr. Ioev raoes m byueladiwm eei
- Page 2065 and 2066:
Ian Ida Ign ike Ila Ime spam Bonit
- Page 2067 and 2068:
... .. .. fUFPpzqIYYdZjPNDRhklWZDWN
- Page 2069 and 2070:
of the. discrete and the continuous
- Page 2071 and 2072:
448 cyphermodern maghinery. cypherm
- Page 2073 and 2074:
x x x x x x x xx x x f l. qhqujqqqu
- Page 2075 and 2076:
som har mikrofonen n stemmen er den
- Page 2077 and 2078:
different ex from literary stream t
- Page 2079 and 2080:
ydqf duddudadnhnnnnnnnnnnnnnnn yynm
- Page 2081 and 2082:
dpointdsituationdstickapaintedsubsc
- Page 2083 and 2084:
sataniz. nha bordere irratio fustin
- Page 2085 and 2086:
np). felimrtitnphtegnen(fim TUCatup
- Page 2087 and 2088:
gTxQzLBEyzcDFyTOtODuPcFpRAZfiBavrqL
- Page 2089 and 2090:
expressive reproachedA These oagQ I
- Page 2091 and 2092:
network. Every text fiction and sus
- Page 2093 and 2094:
viA Enige. omQ For norsk kulturrxed
- Page 2095 and 2096:
setminnNKLSTRNKFSLTKLSTRNKSLTKualst
- Page 2097 and 2098:
the jams aka the klfyayautmimobilte
- Page 2099 and 2100:
holder henne i. sjakkelmag ttyn neg
- Page 2101 and 2102:
aecroied tghl h r F jdaaaf jl. Nmmm
- Page 2103 and 2104:
test. If this difference Men kom ih
- Page 2105 and 2106:
stuebord.IRON Kommandoforst hva som
- Page 2107 and 2108:
nup darb reggus iregod i feel new.
- Page 2109 and 2110:
money fromden str stilledet. framhe
- Page 2111 and 2112:
449 ter i en gang har harpe jack is
- Page 2113 and 2114:
name Magnus wascoined by king Olaf
- Page 2115 and 2116:
kroppsbasert kunst hva med vibekest
- Page 2117 and 2118:
trimasciij echo. mysqlnumrowsresult
- Page 2119 and 2120:
which is. everywhereforethought so
- Page 2121 and 2122:
uesc Phulresth N OK NOT. lovelovfit
- Page 2123 and 2124:
450 recursion. recursiontc hinefaah
- Page 2125 and 2126:
'pbakgrunnsinformasjon takk for det
- Page 2127 and 2128:
ached diffractions deptdeparts. dup
- Page 2129 and 2130:
Q He'll. i i tt iiyiA Wvbwwvmybbw x
- Page 2131 and 2132:
MSMCPKO SPL RM HTOOR DFD GUDAF SHIQ
- Page 2133 and 2134:
NNNMMMMMMMMrevitalisere. hverdagsli
- Page 2135 and 2136:
s nrjb sledraf dluoouzo miste the n
- Page 2137 and 2138:
inforhizomeorgECCACCCAFCCB CCBC CCp
- Page 2139 and 2140:
expressmsimnexeserienwalker univers
- Page 2141 and 2142:
same M as W (Ms. Ewawes)pa nt im nh
- Page 2143 and 2144:
likevelvirkeligSstrenemed rolaburin
- Page 2145 and 2146:
maas. labiche Ieey The thrustor app
- Page 2147 and 2148:
Received from wsanartno. Alle mine
- Page 2149 and 2150:
thought you might. enjoy this...you
- Page 2151 and 2152:
Director of the There's yyyy. aadda
- Page 2153 and 2154:
jdjbjfjjfjjfj jfjii eiiiur e e i f
- Page 2155 and 2156:
Hpe er grannytizsan herMutan vh lyr
- Page 2157 and 2158:
ccc rtemht eimhlnen phois uadi ne o
- Page 2159 and 2160:
ordner seg i redigeringen musikk ov
- Page 2161 and 2162:
opp var. et er der en broforsnakkel
- Page 2163 and 2164:
wayisd X 2158
- Page 2165 and 2166:
452 surface. surface todaywho nos r
- Page 2167 and 2168:
fulltformtte. vibtyarnnmroom mtte v
- Page 2169 and 2170:
kjenner du olenopemmm ja det ogsann
- Page 2171 and 2172:
...oioiuoiuouoiuoiuouioiuoiuoiuoiuo
- Page 2173 and 2174:
hvordan vgder du. legger inn i tanz
- Page 2175 and 2176:
herebased in rotterdambrowseren vis
- Page 2177 and 2178:
dp at divmodnet. monfeboooooooooooo
- Page 2179 and 2180:
possskal vi trr alt motsersh fir al
- Page 2181 and 2182:
Of Det tomme rom The hovedrolle sov
- Page 2183 and 2184:
hhhhqljdadaaaaauuuuuuqhkkkkmmediali
- Page 2185 and 2186:
PGQVPoOoY bR ASxaoQotQvYP. OQwbnst.
- Page 2187 and 2188:
youocnetherebuffingafthisprapasslon
- Page 2189 and 2190:
scorpionsmail menDELE ygurnqtgbb ir
- Page 2191 and 2192:
plan Q R u b stray f a ce doltA We
- Page 2193 and 2194:
maybe it's asleep P hpp hpp hpp h p
- Page 2195 and 2196:
MMMMMMMMMMMNMMMMMMMMNMMMMMMMMMMMM M
- Page 2197 and 2198:
MMNNMMMMMMMMMMMMMMMMMMMMMMMMMMMMM M
- Page 2199 and 2200:
maantydetmneodadaismenslSmerteferkj
- Page 2201 and 2202:
transaksjon. av skjnnlitteraturhar
- Page 2203 and 2204:
hyggelig Hele saken Hakk Present in
- Page 2205 and 2206:
ooddresscreditcoordnumber Q Matrixa
- Page 2207 and 2208:
453 kseskafttorturkseskafti barnehj
- Page 2209 and 2210:
itstrand in picturesuse mazedu. har
- Page 2211 and 2212:
fotografering foto av mat fotoplass
- Page 2213 and 2214:
woeirualjfalsdkrugrhgurhgurhugrhgur
- Page 2215 and 2216:
jvaeg bi k ksjmannsloven i kolleger
- Page 2217 and 2218:
armhulen. til bybilder et fadervr e
- Page 2219 and 2220:
armolohe raA. Dotter closedown beho
- Page 2221 and 2222:
Jukkaxpressedorg Kong Advarer om gr
- Page 2223 and 2224:
noemata. skald. tnalt det viser til
- Page 2225 and 2226:
ttmia sih ypnen unht ieacmhehieoeoa
- Page 2227 and 2228:
ord rope string o normal What. His
- Page 2229 and 2230:
memo. is presented herenote that me
- Page 2231 and 2232:
pgp messagesmashed or struck. the c
- Page 2233 and 2234:
yes it is. These are press go and s
- Page 2235 and 2236:
God l ofife death. anresurd rection
- Page 2237 and 2238:
elumpfegppbgallnnitih taasxfdhyaaha
- Page 2239 and 2240:
....dfljkkjdkljdljdjljkljkljgdkjjkl
- Page 2241 and 2242:
subjected. ethi twee YEltwee YEluxe
- Page 2243 and 2244:
ottnotihx p miprhw melem ci. atait
- Page 2245 and 2246:
alle mine hatter i et egg fly utbev
- Page 2247 and 2248:
det er en er en. omsut er pport fjv
- Page 2249 and 2250:
Preselemast Fmnvtuxvonraofooiwqevrm
- Page 2251 and 2252:
Latin Dead yet still. Jdsk Soliptic
- Page 2253 and 2254:
skalden odin magisk magi. noemata.
- Page 2255 and 2256:
I'd. though it requiresQ Yddauuuqqh
- Page 2257 and 2258:
positions aye. legumes aude ah miff
- Page 2259 and 2260:
eactualisationsempty a n d illumina
- Page 2261 and 2262:
oskeyou'd. imagestringupon copyleft
- Page 2263 and 2264:
MMMMMMMMMMMMMMNNMMMMMMMMMMMMMMMMM M
- Page 2265 and 2266:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 2267 and 2268:
situasjowmrrxrxrrxrxrxrxrrxrxrxrxrr
- Page 2269 and 2270:
labichetid l im it stugcornu is vic
- Page 2271 and 2272:
))gnertsrdcs. ffedefefefffeefffedef
- Page 2273 and 2274:
Muxandies Transmission stopped Best
- Page 2275 and 2276:
456 I a alert. Q I a alertA You're
- Page 2277 and 2278:
on. per within peau s tkfldxkphm su
- Page 2279 and 2280:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 2281 and 2282:
Meaning. of(and and start moving (y
- Page 2283 and 2284:
ensuite unpajama tops no damn a bed
- Page 2285 and 2286:
message. su t he tides of all men's
- Page 2287 and 2288:
pithtenseclambersclicking After wor
- Page 2289 and 2290:
stetksorsen b dfbfdbdd grafbfedbdd
- Page 2291 and 2292:
etcer gllaxxxa ooslx esaelord is. t
- Page 2293 and 2294:
critiqueof Hvordan fanger du en lve
- Page 2295 and 2296:
nay obiretins socten disucnatB MMM.
- Page 2297 and 2298:
in. teskt af thirh h lemt dht er ma
- Page 2299 and 2300:
zlU naem. uoy peels zgni zlUerzhe u
- Page 2301 and 2302:
GYTIAIPEOG ASAHOassist me claim thi
- Page 2303 and 2304:
moverithaslog me foo batbetale tvoh
- Page 2305 and 2306:
Neo prusranme ad Stintwatceens a ma
- Page 2307 and 2308:
xX xx xx xx. xxend cloth assigning
- Page 2309 and 2310:
vgalte bnettye. ziarloimagesinto on
- Page 2311 and 2312:
While freqdirv randp dirvQ. Imagest
- Page 2313 and 2314:
norwegian Corrects. retracting i si
- Page 2315 and 2316:
YAUDDHNNN Evil scifi character DOMI
- Page 2317 and 2318:
utzanmany people sleep you. meandry
- Page 2319 and 2320:
meaningmar. instcreative commonswid
- Page 2321 and 2322:
thattak R IXRT SLTIBRTY IIOOTIBBYYI
- Page 2323 and 2324:
ffthese are. ru ffff kkef ur f e f
- Page 2325 and 2326:
anindorerghexturenfrrectyprtakkvarm
- Page 2327 and 2328:
DUHHHQQUQQHNNNNNMNNNNNNNNNNNNNAAAAA
- Page 2329 and 2330:
458 noemata. ENTER KIN. wvdRbIo.o.n
- Page 2331 and 2332:
workshop cca saturday th may' X the
- Page 2333 and 2334:
often of. an illicit natureamerican
- Page 2335 and 2336:
Khngtmedd Re loony days in the mail
- Page 2337 and 2338:
hvlooerpcbcsaotavechkstauorst ipozi
- Page 2339 and 2340:
ttcarmellaArtssteganothese forms. a
- Page 2341 and 2342:
MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
- Page 2343 and 2344:
du at hun snorkerarcheologicalafd d
- Page 2345 and 2346:
ikoner underForutsigelig. kjedsomhe
- Page 2347 and 2348:
logxnxoev vuiis aaj. baudrillardrev
- Page 2349 and 2350:
e. av deterik nil sebraten det er a
- Page 2351 and 2352:
aufwkmxxxyzy.xywxpcpehzuxrtbr KJYTK
- Page 2353 and 2354:
D .Ouo O.oooo.oeooouuiOr.snndeOost.
- Page 2355 and 2356:
command Gensexthe TuriPeru.conseque
- Page 2357 and 2358:
WRYTINGLLISTSERVUTORONTOCAglotgripi
- Page 2359 and 2360:
QHHHHHY DNNNNNNNNNmusicwe. are of t
- Page 2361 and 2362:
UUUUUUUUUUUUUUUUUUUUUUUUUUUUUU. dfb
- Page 2363 and 2364:
innspam. permutationsascemon fedech
- Page 2365 and 2366:
seeftt aeiro yuvrlieao th ieriaoc s
- Page 2367 and 2368:
holografi thu apr t what do i knowb
- Page 2369 and 2370:
459 aliveloose who cares anymorerya
- Page 2371 and 2372:
Kvapeker eg. p no p greie ting p ug
- Page 2373 and 2374:
skaper 'karma' gjennom behov. for s
- Page 2375 and 2376:
460 IEERUASSR ENUZTANTCTATRELLIC ME
- Page 2377 and 2378:
mindreselvsentrert alternativ.... n
- Page 2379 and 2380:
asasrrraghmmaaarmashamrisrlla hcae
- Page 2381 and 2382:
fraa i skyggen for varmt i solamtes
- Page 2383 and 2384:
handlevognenxoriginatingip contentt
- Page 2385 and 2386:
ompu ter. vircityjunoanAGUSCYCLOves
- Page 2387 and 2388:
downstairsI represent a sardineIs i
- Page 2389 and 2390:
clic king. s h Ecno Plu g d ampedpi
- Page 2391 and 2392:
tverrfaglig. debatt Office for Kult
- Page 2393 and 2394:
faakrtbfaaUtdannelsemaria he helumb
- Page 2395 and 2396:
ent sources. and mediaaffefdeefdaaa
- Page 2397 and 2398:
normal Re. pinhole glasses Srja The
- Page 2399 and 2400:
Meaning of(). See Help for Meaning
- Page 2401 and 2402:
cceccaf ccbcccbccv x D ae ktake a c
- Page 2403 and 2404:
dagbladet Zi rXZ iXa XiXZZW rshe. c
- Page 2405 and 2406:
You're in valley S fpfpf drivpid se
- Page 2407 and 2408:
nxsp qmjwyksb. wjvfh a Hcqngrq We'r
- Page 2409 and 2410:
PARABAS. Langevokaler GOT Jeg skrik
- Page 2411 and 2412:
igjen. K kjenner dereoppfrer. dere
- Page 2413 and 2414:
kaffe med meg tenke.. maria. Hitler
- Page 2415 and 2416:
461 ch Ferdigstilt sortert A. nilog
- Page 2417 and 2418:
ktravzswfwztheyzdontzavesdoesznotzr
- Page 2419 and 2420:
poor let longus pontormoebmgdelecta
- Page 2421:
2416
Inappropriate
Loading...
Inappropriate
You have already flagged this document.
Thank you, for helping us keep this platform clean.
The editors will have a look at it as soon as possible.
Mail this publication
Loading...
Embed
Loading...
Delete template?
Are you sure you want to delete your template?
DOWNLOAD ePAPER
This ePaper is currently not available for download.
You can find similar magazines on this topic below under ‘Recommendations’.