11.07.2015 Views

SOP – Malaria Microscopy - NVBDCP

SOP – Malaria Microscopy - NVBDCP

SOP – Malaria Microscopy - NVBDCP

SHOW MORE
SHOW LESS

You also want an ePaper? Increase the reach of your titles

YUMPU automatically turns print PDFs into web optimized ePapers that Google loves.

Quality Assurance of <strong>Malaria</strong> Diagnostic testsACRONYMS USEDAbAgATADMOELISAEQAEQASEDTAHCWFFPFTDIQCICMRJ.S.B. stainIATALTMFMPWNAMMISNIMRNRLNIB<strong>NVBDCP</strong>PHCQAQCQI: Antibody: Antigen: Air Transport Association: District <strong>Malaria</strong> Officer: Enzyme Linked Immunosorbent Assay: External Quality Assessment: External Quality Assessment Scheme: Ethylene Diamine Tetra Acetic Acid: Health Care Worker: Fresh Frozen Plasma: Fever Treatment Depot: Internal Quality Control: Indian Council of Medical Research: Jaswant Singh and Bhattacharjee stain: International Air Transport Association: Laboratory Technician: <strong>Malaria</strong> Form: Multi Purpose Worker: National Anti <strong>Malaria</strong> Management Information System: National Institute of <strong>Malaria</strong> Research: National Reference Laboratory: National Institute of Biologicals: National Vector Borne Disease Control Programme: Primary Health Centre: Quality Assurance: Quality Control: Quality Indicators<strong>SOP</strong> – <strong>Malaria</strong> <strong>Microscopy</strong>© Copyright to Dte. <strong>NVBDCP</strong> Only. Any modification are prohibited

Hooray! Your file is uploaded and ready to be published.

Saved successfully!

Ooh no, something went wrong!