Mechanisms of Olfaction in Insects - ResearchSpace@Auckland ...

More documents

Recommendations

Info

Appendix A 134 A. Appendix A – Dose response profile of pIB- V5 His empty vector control to methyl salicylate Figure A.1: Dose response of the empty pIB-V5 His vector to methyl salicylate in the concentration range of 10 -5 M to 10 -13 M. Error bars represent the standard error of 6 responding cells.
Appendix B 135 Buffered TB (Sambrook et al., 1989) B. Appendix B – EpGOBP2 expression buffer recipe and protein details Per Litre: K phosphate 900mL water Per Litre: 12g Tryptone 23.1g KH2PO4 24g yeast Extract 125.4g K2HPO4 4mL glycerol Autoclave The TB was autoclaved and cooled to room temperature. 100 mL of sterile K phosphates was then added to it. His6-EpGOBP2 has a molecular weight of 22597.20 Daltons and the amino acid sequence is as follows: M H H H H H H S S G L V P R G S G M K E T A A A K F E R Q H M D S P D L G T D D D D K A M A D I G S E F E N L Y F Q T A E V M S H V T A H F G K A L E Q C R E E S G L S T A V L E E F Q H F W R D D F E V V H R E L G C A I L C M S N K F S L M Q D D A R M H H E N M H D Y V K S F P Q G E V L S A K M V E L I H N C E K P Y D D I K D D C E R V V K V A A C F K V D A K K A G I A P E V A M I E A V M E K Y Native EpGOBP2 has a molecular weight of 16094.51 Daltons and the amino acid sequence is as follows: TAEVMSHVTAHFGKALEQCREESGLSTAVLEEFQHFWRDDFEVVHRELGCAI LCMSNKFSLMQDDARMHHENMHDYVKSFPQGEVLSAKMVELIHNCEKPYD DIKDDCERVVKVAACFKVDAKKAGIAPEVAMIEAVMEKY
Page 1 and 2:
http://researchspace.auckland.ac.nz
Page 3 and 4:
Abstract Abstract Olfaction or the
Page 5 and 6:
Acknowledgements Acknowledgements I
Page 7 and 8:
Contents v Contents Abstract……
Page 9 and 10:
Contents 4.2.5 Degenerate PCR .....
Page 11 and 12:
List of Figures List of Figures Fig
Page 13 and 14:
List of Tables List of Tables Table
Page 15 and 16:
List of Abbreviations gDNA Genomic
Page 17 and 18:
1.1 General overview 1 General Intr
Page 19 and 20:
General Introduction 3 moth in loca
Page 21 and 22:
General Introduction 5 Figure 1.1:
Page 23 and 24:
General Introduction 7 1.5 Componen
Page 25 and 26:
General Introduction 9 OBPs have al
Page 27 and 28:
General Introduction 11 A model has
Page 29 and 30:
Page 31 and 32:
General Introduction 15 Tanaka et a
Page 33 and 34:
General Introduction 17 Table 1.1:
Page 35 and 36:
Page 37 and 38:
General Introduction 21 et al., 200
Page 39 and 40:
General Introduction 23 the attract
Page 41 and 42:
General Introduction 25 leaves and
Page 43 and 44:
Page 45 and 46:
General Introduction 29 Expression
Page 47 and 48:
General Introduction 31 BmOr2 HvOr2
Page 49 and 50:
General Introduction 33 for lepidop
Page 51 and 52:
Functional characterisation of Epip
Page 53 and 54:
Page 55 and 56:
Page 57 and 58:
Page 59 and 60:
Page 61 and 62:
Page 63 and 64:
Page 65 and 66:
Page 67 and 68:
Page 69 and 70:
Page 71 and 72:
Page 73 and 74:
3.1 Introduction 3 The roles of Epi
Page 75 and 76:
The roles of Epiphyas postvittana G
Page 77 and 78:
Page 79 and 80:
Page 81 and 82:
Page 83 and 84:
Page 85 and 86:
Page 87 and 88:
Page 89 and 90:
Page 91 and 92:
Page 93 and 94:
Page 95 and 96:
4.1 Introduction 4 Identification o
Page 97 and 98:
Identification of putative odorant
Page 99 and 100: Identification of putative odorant
Page 109 and 110: Microarray OR 454 Transcriptome OR
Page 141 and 142: 5.1 Introduction 5 Concluding Discu
Page 143 and 144: Concluding Discussion 127 VOBA sett
Page 145 and 146: Concluding Discussion 129 redundant
Page 147 and 148: Concluding Discussion 131 against t
Page 149: Concluding Discussion 133 sequencin
Page 153 and 154: Appendix C 137 C. Appendix C - Clus
Page 155 and 156: Appendix D 139 D. Appendix D - Solu
Page 157 and 158: Appendix E 141 I II
Page 159 and 160: Appendix E 143 V
Page 161 and 162: Appendix E 145 VII continued Figure
Page 163 and 164: References 147 Ansebo, L., Ignell,
Page 165 and 166: References 149 Butenandt, A., Beckm
Page 167 and 168: References 151 Fedurco, M., Romieu,
Page 169 and 170: References 153 Große-Wilde, E., St
Page 171 and 172: References 155 Hrdy, I., F. Kuldova
Page 173 and 174: References 157 Kaissling, K. E. (19
Page 175 and 176: References 159 Krieger, J., Große-
Page 177 and 178: References 161 Lopez-Gomez, R. and
Page 179 and 180: References 163 Miura, N., Nakagawa,
Page 181 and 182: References 165 Pell, J. K., Macaula
Page 183 and 184: References 167 Røstelien, T., Stra
Page 185 and 186: References 169 Stowers, L. and Loga
Page 187 and 188: References 171 Turner, C. T., Davy,
Page 189 and 190: References 173 Vogt, R. G., Riddifo
Page 191 and 192: References 175 Widmayer, P., Heifet
show all

Mechanisms of Olfaction in Insects - ResearchSpace@Auckland ...

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?