GTMB 7 - Gene Therapy & Molecular Biology

Gene Therapy and Molecular Biology Vol 7, page 51BFigure 2. Analysis of clone 4G11 identical to chloride channel. (A) Alignment of M. musculus (XP_134186), D. melanogaster(AAM76180), Solanum tuberosum (T07608), Oreochromis mossambicus (AAD56388), A. gambiae (EAA11899), C. elegans(NP_495940), Leishmania major (strain Friedlin) (T02805), Saccharomyces cerevisiae (P37020), Escherichia coli K12 (AAC73266),and Xenopus laevis (CAA71071) protein sequences and the translation product of clone 4G11 identified as a fragment of I. scapularischloride channel (AY296114). Protein sequences are shown in the single letter amino acid code. Identical amino acids are shown in redand amino acids conserved in 6-10 of 11 sequences are shown in blue. (B) Phylogenetic tree constructed from analysis of chloridechannel protein sequences based on a sequence distance method utilizing the Neighbor Joining algorithm of Saitou and Nei (1987).D. melanogaster PHAQGFIEVDQNVTTHHPIVREEKIVPNMQINGYENPTYKYFEI. scapularis PQAQGFVQVDQGALPASPEER---HLASMQVNGYENPTYKYFEA. gambiae PHAQGFVEVDQAVGAPVTPEE--RHVANMQINGYENPTYKYFEConsensus PHAQGFVEVDQ V P ER HVANMQINGYENPTYKYFEFigure 3. Analysis of clone 2C12 identical to beta-amyloid precursor protein. Alignment of D. melanogaster (AF181628) and A.gambiae (EAA07868) protein sequences and the translation product of clone 2C12 identified as I. scapularis beta-amyloid peptide (ß-AP) (AY296115). Protein sequences are shown in the single letter amino acid code. Identical amino acids are shown in red and aminoacids conserved in 2 of 3 sequences are shown in blue.Table 4. Characterization of I. scapularis ESTs encoding for ribosomal proteinsEST clone Predicted protein Identical aminoacids4F71A2Elongation factor 1-alpha 95%85%SpeciesNeacarus texanusMus musculusGenBank accessionnumberAAK12660NP_0319321A10 Elongation factor-2 88%80%Mastigoproctus giganteusMus musculusAAK12348BAC262031C11 eIF-5A 65%59%Drosophila melanogasterMus musculusAAM68297XP_2033361F62C3RpS4 79%75%Spodoptera frugiperdaMus musculusAAL26580AAH091002B8 RpS11 92%80%Dermacentor variabilisMus musculusAAO92287XP_1334772F8 Laminin receptor 1(RpSA)66%73%Anopheles gambiaeMus musculusEAA00413NP_0351592F10 RpL3 70%68%Spodoptera frugiperdaMus musculusAAL62468AAH096553A10 RpL7A 55%60%Drosophila melanogasterMus musculusNP_511063A302413D10 Ribophorin I 57%50%Drosophila melanogasterMus musculusAAN71150BAC266793G9 RpS8 70%71%Spodoptera frugiperdaMus musculusAAL62472XP_1349043G10 RpL27A 42% Spodoptera frugiperda AAK9215851