SYNDROME D'ACTIVATION MACROPHAGIQUE CHEZ L ... - Toubkal

More documents

Recommendations

Info

Cas 7 Cas 8 Cas 9 Cas 10 Cas 11 Cas 12Age 5 ans 8 mois 8 mois 7 mois 7 ans 2 ansSexe M M F M F FATCD - - - - - -Motif de consultation Distension abd PCM intenseFièvre+ Cris incessants Distension abd Pâleur, AEG et F°ictère fébrileVomissements refus de tétés PCMDélai de consultation 1 mois 1 mois 1mois 1mois 1 année 11 joursSx.généraux- Fièvre- AEG- Pâleur CM- Fièvre- AEG- Pâleur CM- Fièvre- AEG- Pâleur CM- Fièvre- AEG- Pâleur CM- Fièvre- AEG- Pâleur CM- Fièvre- AEG- Pâleur CM- DH à 5%Sx.fonctionnels Douleur abd. TouxVomissement - Distension abd EpistaxisDistensionabdominaleDyspnéeHématurieDyspnéeSx.physiquesP : -2DST : -2DSIctèreHSMGAsciteT : -2DSSMGADP axillaires etinguinales.Lx érosivesdisséminéesP : -2,5 DST : -2,5 DSSubictère, OMIHSMGPurpura (abd,MI)SMGSepsisP : -2DST : -1DSSMG énormeHMGSMGADP axillaireErythèmeLégèrehypertrophieamygdalienneNouures disséminéesTuméfaction épaulegaucheŒdème hémifacegcheSepsisDH : déshydratationP : poidsT : Taille87
NFSHb (g/dl)GB/mm3Plq/mm3Cas 1 Cas2 Cas3 Cas4Anémie HMAnémie HMAnémie HMAnémieHb à 5,8Hb à 6,2Hb : 6,8Hb : 2,1LeucopénieLeucopénieLeucopénieNGB : 3000GB : 2200GB : 2400PNN=670PNN = 616ThrombopénieThrombopénieThrombopénieThrombopéniePlq= 86000Plq = 10000Plq : 82000Plq : 11000biologieBilaninfectieuxRadiologieTransaminasUI/LSGOT : 240SGPT : 266SGOT : 232SGPT : 751bilanhépatiqueGGT/ PALUI/LGGT : 107PAL : NSGOT : 162NSGPT : 462N N NBilirubinémie N N N NLDHHémostase-TP à 41%-TP : 36, 4%-TP : NTP à 40%- H-Fg : 1,4g/l- H-Fg : 1,2- H-Fg : 1,41H-Fg à1,3Bilan lipidique H+TG : 5,11mmol/l H+TG : 3,7 H+TG : 2,16 H+TG à 3,7Ferritinémie (μg/ l) NF NF NF 520Ionogramme- Hypoprotidémie -protidémie : NProtidémie : NHypoprotidémie- hyponatrémieHyponatrémieVS ( mm )VS à 120mm VS à 85mm VS à106mmVS à 30mmCRP ( mg/l )CRP= 42,3EPP H-alb,H+γglob H-alb,H+γglob H-alb,H+γglob Hypoalb, H+γglobAutresSérologie leishmaniose NF positive Positive NégativeSérologies virales VIH : - HVA : -Autres-HSMGEcho abd.-Epanchement intrapéritonéalde faible abondanceRx thoraciqueAutres88
Page 1 and 2:
UNIVERSITE SIDI MOHAMMED BEN ABDELL
Page 3 and 4:
LHFLVILYSTM-CSFMNIMNPMQNFSNKNSEPALP
Page 5 and 6:
1. Présentation clinique .........
Page 7 and 8:
INTRODUCTION6
Page 9 and 10:
L’étude des formes génétiques
Page 11 and 12:
Le syndrome d’activation macropha
Page 13 and 14:
v Les principales étapes dans la c
Page 15 and 16:
Le SAM est intégré dans le cadre
Page 17 and 18:
I. Généralités sur les macrophag
Page 19 and 20:
Cellules souches pluripotentesMoell
Page 21 and 22:
Les monocytes sont reconnaissables
Page 23 and 24:
v Les cellules accessoires de l'imm
Page 25 and 26:
4. Activation des macrophages : [14
Page 27 and 28:
Figure 6 : Défaut d’activité cy
Page 29 and 30:
Figure7 : Boucle d’activation Th1
Page 31 and 32:
L'IFNgamma est la cytokine la plus
Page 33 and 34:
5. L’hyperferritinémie :Résulte
Page 35 and 36:
Figure 8 : Syndrome d’hyperactiva
Page 37 and 38: I. Buts de notre étude :- Rapporte
Page 39 and 40: LE SYNDROME D’ACTIVATION MACROPHA
Page 41 and 42: Masse abdominale :Matité déclive
Page 43 and 44: VII - Traitement :1. Durée d’hos
Page 45 and 46: +L’électrophorèse des protides
Page 47 and 48: - La biopsie ostéo-médullaire est
Page 49 and 50: - Le N-méthyl-glucantime a été p
Page 51 and 52: v CONCLUSION:Il s’agit d’un enf
Page 53 and 54: ‣ Le bilan hépatique de contrôl
Page 55 and 56: - fer sérique:N- Sérologie de lei
Page 57 and 58: ‣ Le patient a bénéficié d’u
Page 59 and 60: +Examen cardio-vasculaire: Présenc
Page 61 and 62: - Une AEG‣ Un bilan a été réal
Page 63 and 64: Par ailleurs les parents rapportent
Page 65 and 66: +Glycémie: 0,81 g/l+ Fonction rén
Page 67 and 68: • Ferritinémie: 55 ng/ml• Fibr
Page 69 and 70: + Examen abdominal:- Abdomen respir
Page 71 and 72: • Une hyponatrémie• Sérologie
Page 73 and 74: - des signes de déshydratation est
Page 75 and 76: v Evolution :Au 4 ème jour de son
Page 77 and 78: Observation n°10:v Identité:Il s
Page 79 and 80: v La prise en charge thérapeutique
Page 81 and 82: Observation n°11:v Identité:Il s
Page 83 and 84: • Bilirubine totale : 15mg/l, bil
Page 85 and 86: + Examen cardio-vasculaire : normal
Page 87: Tableau 5 : tableaux récapitulatif
Page 91 and 92: Cas 5 Cas 6 Cas 7 Cas 8Hb (g/dl)An
Page 93 and 94: NFSHb (g/dl)GB/mm3Plq/mm3Cas 9 Cas
Page 95 and 96: RESULTATSI. Données épidémiologi
Page 97 and 98: Figure: Répartition des enfants se
Page 99 and 100: II. Etude clinique:1. Les antécéd
Page 101 and 102: Tableau 11: les signes fonctionnels
Page 103 and 104: III. Etude paraclinique:1. Bilan bi
Page 105 and 106: - Une hypercholestérolémie chez 2
Page 107 and 108: . La radiographie thoracique :Elle
Page 109 and 110: . Hémoculture : réalisée chez 1p
Page 111 and 112: VI. Traitement:a. Traitement sympto
Page 113 and 114: DISCUSSIONI. Epidémiologie .......
Page 115 and 116: Celle de la lymphohistiocytose fami
Page 117 and 118: II. Diagnostic positif:Le Diagnosti
Page 119 and 120: C.1 : Manifestations non spécifiqu
Page 121 and 122: témoignant souvent d'une évolutio
Page 123 and 124: Dans notre série :La fièvre const
Page 125 and 126: A. Les anomalies de l’hémogramme
Page 127 and 128: C. Atteinte hépatique :L’altéra
Page 129 and 130: v Une insuffisance rénale est souv
Page 131 and 132: Les perturbations du bilan hépatiq
Page 133 and 134: Ces macrophages sont de morphologie
Page 135 and 136: L'activité hématopoïétique est
Page 137 and 138: B.2 : La biopsie ganglionnaire :La
Page 139 and 140:
Dans la série de Diaz [81] (série
Page 141 and 142:
Tableau 26 : Critères diagnostique
Page 143 and 144:
III. Diagnostic différentiel :Le d
Page 145 and 146:
1. Les SAM primaires: (SAMP)Les LH
Page 147 and 148:
Tableau 28 : Principales formes gé
Page 149 and 150:
- LHF de type 3 : représente 20 à
Page 151 and 152:
lysosomes cellulaires, expliquant l
Page 153 and 154:
- Syndrome de Griscelli type 3 : co
Page 155 and 156:
mutation transforme la SAP, protéi
Page 157 and 158:
a. Les SAM post-infectieux : [36]Pr
Page 159 and 160:
C’est une pathologie fréquente e
Page 161 and 162:
v Le SAM associé à l’infection
Page 163 and 164:
l’infection associée étant le p
Page 165 and 166:
Plasmodium vivax [201]. La persista
Page 167 and 168:
n’est pas toujours facile à mett
Page 169 and 170:
- En effet, la pathologie auto-immu
Page 171 and 172:
e. Les SAM et transplantation d’o
Page 173 and 174:
Tableau 33 : Etiologies du SAM selo
Page 175 and 176:
- Administrer une antibiothérapie
Page 177 and 178:
L’étoposide peut avoir un effet
Page 179 and 180:
c. Traitements étiologiques :Le tr
Page 181 and 182:
type 3 allogreffés, 14 ont survéc
Page 183 and 184:
‣ SAM associé à la leishmaniose
Page 185 and 186:
DiagnosticHLHHistoirefamiliale (+)M
Page 187 and 188:
complications propres au syndrome h
Page 189 and 190:
pronostiques majeurs : l’absence
Page 191 and 192:
CONCLUSION190
Page 193 and 194:
RESUME192
Page 195 and 196:
(17%), présence de corps de leishm
Page 197 and 198:
iopsy and was inconclusive, skin bi
Page 199 and 200:
BIBLIOGRAPHIE198
Page 201 and 202:
[11] Marshall AHE.Histiocytic medul
Page 203 and 204:
[31] Johnston RBMonocytes and macro
Page 205 and 206:
[49]. Imashuku S, Hibi S, Sako M, I
Page 207 and 208:
[68] Shirono K, Tsuda H.Virus-assoc
Page 209 and 210:
[88] F. Gonzalez, F. Vincent, Y. Co
Page 211 and 212:
[108] Stéphan J.L., Galambrun C.Sy
Page 213 and 214:
[126] Esumi N, Ikushima S, Todo S,
Page 215 and 216:
[143] Jaffe ESHistiocytoses of lymp
Page 217 and 218:
[162] Rudd E., Goransdotter Ericson
Page 219 and 220:
[181] Imashuku S.Clinical features
Page 221 and 222:
[198] Gagnaire MH, Galambrun C, Ste
Page 223 and 224:
[217 ] Hamidou M., Boutoille D., Ma
Page 225 and 226:
[236] Makay B, Yilmaz S, Turkyilmaz
Page 227:
[254] Kilani B, Ammari L, Kanoun F,
show all

SYNDROME D'ACTIVATION MACROPHAGIQUE CHEZ L ... - Toubkal

You also want an ePaper? Increase the reach of your titles

Delete template?

Save as template?